Host 162.241.216.107
United States
Software information
Apache
tcp/443 tcp/80
nginx 1.21.6
tcp/443 tcp/80
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.milleniumcosmetics.com
Port: 443
URL: https://www.milleniumcosmetics.comFirst seen 2023-02-25 20:22
Last seen 2024-09-16 22:55
Open for 569 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 22:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 20:27
Last seen 2024-09-16 22:42
Open for 630 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:42
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 20:26
Last seen 2024-09-16 22:03
Open for 630 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af2472579313956c2dc117cd05c700896e442e2Found 9 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /staging/wp-content/themes/hoon /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2024-09-16 22:03 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f7bdfd42037baeefa86f21d1486f21d14Found 3 files trough .DS_Store spidering: /lumigeek.esproj /staging /wp-content
Found on 2024-09-13 00:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e74637fc9efed1d9f695a22c3e65f5722Found 6 files trough .DS_Store spidering: /lumigeek.esproj /staging /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2024-09-10 22:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e74637fc9efed1d9f16197841e1809676Found 6 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /staging/wp-content/themes/hoon /wp-content
Found on 2024-09-07 00:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab770562bcbc33538ee4c0a86ab4effb7dFound 7 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2024-09-05 00:00 -
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d87b7124635f5bac854074c767509ca69dFound 8 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2024-09-02 07:11
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-25 19:45
Last seen 2024-09-16 22:03
Open for 753 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a7e522f6[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/gabeshaughnessy/lumigeek.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 22:03210 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2024-09-16 21:49
Open for 749 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2024-09-16 21:49
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.palomponleyte-gov-ph.triconnsolutions.com
Port: 80
URL: http://www.palomponleyte-gov-ph.triconnsolutions.comFirst seen 2024-03-13 18:51
Last seen 2024-09-16 21:23
Open for 187 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 21:23276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.staging.lumigeek.com
Port: 443
URL: https://www.staging.lumigeek.comFirst seen 2022-09-16 18:51
Last seen 2024-09-16 21:22
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c8138d443b247c62e34e7c62e34eFound 3 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/hoon
Found on 2024-09-16 21:22
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-09-22 18:45
Last seen 2024-09-16 21:22
Open for 725 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb172f423b[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://Derron_Design@bitbucket.org/Derron_Design/childlabourinagriculture.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 21:22369 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.nasugbutransportcorp.com
Port: 443
URL: https://mail.nasugbutransportcorp.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 21:19
Open for 320 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 21:19272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.nasugbutransportcorp.triconnsolutions.com
Port: 80
URL: http://www.nasugbutransportcorp.triconnsolutions.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 20:54
Open for 320 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:54272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.palomponleyte.gov.ph
Port: 80
URL: http://mail.palomponleyte.gov.phFirst seen 2024-03-13 18:51
Last seen 2024-09-16 20:47
Open for 187 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:47276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2024-03-13 18:51
Last seen 2024-09-16 20:47
Open for 187 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:47276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-30 18:42
Last seen 2024-09-16 20:39
Open for 170 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 20:39 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0ff3f7f034167efdf5381542ff381542ffFound 3 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer
Found on 2024-07-20 06:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2024-09-16 20:36
Open for 749 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2024-09-16 20:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.milleniumcosmetics.com
Port: 443
URL: https://mail.milleniumcosmetics.comFirst seen 2023-02-25 20:22
Last seen 2024-09-16 20:31
Open for 569 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: dev.crossfitwaterbury.com
Port: 443
URL: https://dev.crossfitwaterbury.comFirst seen 2022-09-16 18:30
Last seen 2024-09-16 20:25
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2024-09-16 20:25
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: nasugbutransportcorp.com
Port: 443
URL: https://nasugbutransportcorp.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 20:13
Open for 320 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:13272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 20:31
Last seen 2024-09-16 20:03
Open for 629 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.jenniferlake-me.marklake.org
Port: 443
URL: https://www.jenniferlake-me.marklake.orgFirst seen 2022-10-26 19:53
Last seen 2024-09-16 19:49
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2024-09-16 19:27
Open for 749 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2024-09-16 19:27
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-07-12 18:52
Last seen 2024-09-16 19:13
Open for 432 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 19:13276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-30 18:42
Last seen 2024-09-16 19:06
Open for 170 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 19:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642eeca31ddf26ebc1af26ebc1af26ebc1aFound 2 files trough .DS_Store spidering: /index.php /vendor
Found on 2024-09-12 16:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.dev.philpearlman.com
Port: 443
URL: https://www.dev.philpearlman.comFirst seen 2022-10-26 20:17
Last seen 2024-09-16 19:04
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1c46a26e0746a26e0746a26e07Found 2 files trough .DS_Store spidering: /wp-content /wp-content/themes
Found on 2024-09-16 19:04
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.palomponleyte.gov.ph
Port: 443
URL: https://www.palomponleyte.gov.phFirst seen 2023-07-12 18:52
Last seen 2024-09-16 18:48
Open for 431 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 18:48276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2024-09-16 18:47
Open for 748 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2024-09-16 18:47
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-10-26 20:19
Last seen 2024-09-16 18:44
Open for 690 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652249a732a4[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/triconn.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 18:44275 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.chargertrucksales.chargerspecialized.com
Port: 443
URL: https://www.chargertrucksales.chargerspecialized.comFirst seen 2022-12-26 19:58
Last seen 2024-09-16 18:36
Open for 629 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 18:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 18:57
Last seen 2024-09-16 18:25
Open for 689 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2024-09-16 18:25
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.504vintage.markwag.com
Port: 443
URL: https://www.504vintage.markwag.comFirst seen 2022-10-26 19:53
Last seen 2024-09-16 18:14
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 18:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.debhartmandigital.com
Port: 443
URL: https://mail.debhartmandigital.comFirst seen 2022-10-26 19:19
Last seen 2024-09-16 18:05
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-09-16 18:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-08 18:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.debhartmandigital.com
Port: 443
URL: https://www.debhartmandigital.comFirst seen 2022-10-26 19:19
Last seen 2024-09-16 17:57
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-09-16 17:57 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-08 21:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-09-16 17:50
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 17:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.amaall-com.psb.yhn.mybluehost.me
Port: 80
URL: http://www.amaall-com.psb.yhn.mybluehost.meFirst seen 2024-03-30 18:42
Last seen 2024-09-16 17:36
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 17:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0ff3f7f034167efdf5381542ff381542ffFound 3 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer
Found on 2024-06-04 14:25
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2024-01-11 19:54
Last seen 2024-09-16 17:17
Open for 248 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 17:17276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-09-16 16:58
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 16:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.brightbeginnings.ae
Port: 443
URL: https://mail.brightbeginnings.aeFirst seen 2022-10-27 18:57
Last seen 2024-09-16 16:33
Open for 689 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2024-09-16 16:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: catherinerussodocumentaries.com
Port: 443
URL: https://catherinerussodocumentaries.comFirst seen 2022-10-26 19:13
Last seen 2024-09-16 16:01
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab2102d61c090fff03e35c83fbcc9a7fdcFound 7 files trough .DS_Store spidering: /images /pdf /press /Scripts /SpryAssets /swf /swf/swf_final
Found on 2024-09-16 16:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e18288c9790238d9c9fc8b2a0b0d11254Found 6 files trough .DS_Store spidering: /images /pdf /press /Scripts /SpryAssets /swf
Found on 2024-06-18 14:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-09-16 15:58
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 15:58
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.palomponleyte.gov.ph
Port: 443
URL: https://mail.palomponleyte.gov.phFirst seen 2023-07-12 18:52
Last seen 2024-09-16 15:56
Open for 431 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 15:56276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.catherinerussodocumentaries.com
Port: 443
URL: https://www.catherinerussodocumentaries.comFirst seen 2022-10-26 19:13
Last seen 2024-09-16 15:36
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab2102d61c090fff03e35c83fbcc9a7fdcFound 7 files trough .DS_Store spidering: /images /pdf /press /Scripts /SpryAssets /swf /swf/swf_final
Found on 2024-09-16 15:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e18288c9790238d9c9fc8b2a0b0d11254Found 6 files trough .DS_Store spidering: /images /pdf /press /Scripts /SpryAssets /swf
Found on 2024-07-26 19:01
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.nasugbutransportcorp.com
Port: 443
URL: https://www.nasugbutransportcorp.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 15:14
Open for 319 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 15:14272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:17
Last seen 2024-09-16 15:01
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1c46a26e0746a26e0746a26e07Found 2 files trough .DS_Store spidering: /wp-content /wp-content/themes
Found on 2024-09-16 15:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: amaall-com.psb.yhn.mybluehost.me
Port: 443
URL: https://amaall-com.psb.yhn.mybluehost.meFirst seen 2024-03-30 18:42
Last seen 2024-09-16 14:49
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 14:49 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0ff3f7f034167efdf5381542ff381542ffFound 3 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer
Found on 2024-09-08 14:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: jenniferlake-me.marklake.org
Port: 443
URL: https://jenniferlake-me.marklake.orgFirst seen 2022-10-26 19:53
Last seen 2024-09-16 14:00
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 14:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2024-09-16 13:48
Open for 748 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2024-09-16 13:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 18:57
Last seen 2024-09-16 13:43
Open for 689 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2024-09-16 13:43
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.nasugbutransportcorp.triconnsolutions.com
Port: 443
URL: https://www.nasugbutransportcorp.triconnsolutions.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 13:29
Open for 319 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 13:29272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-30 18:42
Last seen 2024-09-16 13:27
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 13:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642eeca31ddf26ebc1af26ebc1af26ebc1aFound 2 files trough .DS_Store spidering: /index.php /vendor
Found on 2024-09-06 10:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0ff3f7f034167efdf5381542ff381542ffFound 3 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer
Found on 2024-06-24 07:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.catherinerussodocumentaries.com
Port: 443
URL: https://mail.catherinerussodocumentaries.comFirst seen 2022-10-26 19:13
Last seen 2024-09-16 13:27
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab2102d61c090fff03e35c83fbcc9a7fdcFound 7 files trough .DS_Store spidering: /images /pdf /press /Scripts /SpryAssets /swf /swf/swf_final
Found on 2024-09-16 13:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.amaall-com.psb.yhn.mybluehost.me
Port: 443
URL: https://www.amaall-com.psb.yhn.mybluehost.meFirst seen 2024-03-30 18:42
Last seen 2024-09-16 12:47
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 12:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642eeca31ddf26ebc1af26ebc1af26ebc1aFound 2 files trough .DS_Store spidering: /index.php /vendor
Found on 2024-09-04 16:56 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0ff3f7f034167efdf5381542ff381542ffFound 3 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer
Found on 2024-08-06 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2024-09-16 12:46
Open for 748 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2024-09-16 12:46
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.triconnsolutions.com
Port: 443
URL: https://mail.triconnsolutions.comFirst seen 2022-10-26 20:19
Last seen 2024-09-16 12:25
Open for 690 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652249a732a4[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/triconn.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 12:25275 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:23
Last seen 2024-09-16 12:25
Open for 689 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f9b22bb3f31f3f27858dee6a958dee6a9Found 3 files trough .DS_Store spidering: /IMAGE ICONS /IMAGES /LOGOs
Found on 2024-09-16 12:25
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.nasugbutransportcorp.com
Port: 80
URL: http://mail.nasugbutransportcorp.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 12:24
Open for 319 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 12:24272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: palomponleyte-gov-ph.triconnsolutions.com
Port: 80
URL: http://palomponleyte-gov-ph.triconnsolutions.comFirst seen 2024-01-11 19:54
Last seen 2024-09-16 12:14
Open for 248 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 12:14276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: chargertrucksales.chargerspecialized.com
Port: 443
URL: https://chargertrucksales.chargerspecialized.comFirst seen 2023-04-28 18:50
Last seen 2024-09-16 12:13
Open for 506 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 12:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.dev.crossfitwaterbury.com
Port: 443
URL: https://www.dev.crossfitwaterbury.comFirst seen 2022-09-16 18:30
Last seen 2024-09-16 09:32
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2024-09-16 09:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-30 18:42
Last seen 2024-09-16 09:32
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 09:32 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642eeca31ddf26ebc1af26ebc1af26ebc1aFound 2 files trough .DS_Store spidering: /index.php /vendor
Found on 2024-08-30 08:06
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-11-01 18:49
Last seen 2024-09-16 09:21
Open for 319 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 09:21272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: palomponleyte-gov-ph.triconnsolutions.com
Port: 443
URL: https://palomponleyte-gov-ph.triconnsolutions.comFirst seen 2023-07-12 18:52
Last seen 2024-09-16 08:54
Open for 431 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 08:54276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:19
Last seen 2024-09-16 08:24
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-09-16 08:24 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-08 13:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:51
Last seen 2024-09-16 08:08
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af2472579313956c2dc117cd05c700896e442e2Found 9 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /staging/wp-content/themes/hoon /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2024-09-16 08:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d87b7124635f5bac854074c767509ca69dFound 8 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2024-09-12 14:39 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e74637fc9efed1d9f16197841e1809676Found 6 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /staging/wp-content/themes/hoon /wp-content
Found on 2024-08-30 09:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9edc44f2a15fba2e8a1f1e5ac6214bd49Found 5 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /wp-content
Found on 2024-08-26 08:24 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab770562bcbc33538ee4c0a86ab4effb7dFound 7 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2024-08-18 06:08
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-25 19:45
Last seen 2024-09-16 08:08
Open for 752 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a7e522f6[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/gabeshaughnessy/lumigeek.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 08:08210 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: amaall-com.psb.yhn.mybluehost.me
Port: 80
URL: http://amaall-com.psb.yhn.mybluehost.meFirst seen 2024-03-30 18:42
Last seen 2024-09-16 08:06
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 08:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0ff3f7f034167efdf5381542ff381542ffFound 3 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer
Found on 2024-07-08 05:14
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.nasugbutransportcorp.com
Port: 80
URL: http://www.nasugbutransportcorp.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 07:53
Open for 319 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 07:53272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: nasugbutransportcorp.triconnsolutions.com
Port: 80
URL: http://nasugbutransportcorp.triconnsolutions.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 06:38
Open for 319 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 06:38272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: tingeylaw.tingeyconsulting.com
Port: 443
URL: https://tingeylaw.tingeyconsulting.comFirst seen 2022-10-27 19:23
Last seen 2024-09-16 06:38
Open for 689 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 06:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.tingeylaw.tingeyconsulting.com
Port: 443
URL: https://www.tingeylaw.tingeyconsulting.comFirst seen 2023-02-26 20:23
Last seen 2024-09-16 05:45
Open for 567 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 05:45
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.sul.pdc.mybluehost.me
Port: 443
URL: https://www.sul.pdc.mybluehost.meFirst seen 2022-09-22 18:45
Last seen 2024-09-16 05:43
Open for 724 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb172f423b[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://Derron_Design@bitbucket.org/Derron_Design/childlabourinagriculture.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 05:43369 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.beautyservice.beautyvil.com
Port: 443
URL: https://www.beautyservice.beautyvil.comFirst seen 2022-10-05 18:45
Last seen 2024-09-16 05:41
Open for 711 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b173d9f039cc07ff6119a642660e3134eeFound 34 files trough .DS_Store spidering: /Adapter /admin /architecture.md /cache /classes /config /CONTRIBUTING.md /CONTRIBUTORS.md /controllers /Core /css /docs /download /error500.html /footer.php /header.php /images.inc.php /img /index.php /init.php /install /js /localization /log /mails /modules /override /pdf /README.md /themes /tools /translations /upload /webservice
Found on 2024-09-16 05:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: beautyservice.beautyvil.com
Port: 443
URL: https://beautyservice.beautyvil.comFirst seen 2022-10-05 18:45
Last seen 2024-09-16 05:30
Open for 711 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b173d9f039cc07ff6119a642660e3134eeFound 34 files trough .DS_Store spidering: /Adapter /admin /architecture.md /cache /classes /config /CONTRIBUTING.md /CONTRIBUTORS.md /controllers /Core /css /docs /download /error500.html /footer.php /header.php /images.inc.php /img /index.php /init.php /install /js /localization /log /mails /modules /override /pdf /README.md /themes /tools /translations /upload /webservice
Found on 2024-09-16 05:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-30 18:42
Last seen 2024-09-16 05:05
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 05:05
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: nasugbutransportcorp.triconnsolutions.com
Port: 443
URL: https://nasugbutransportcorp.triconnsolutions.comFirst seen 2023-11-01 18:49
Last seen 2024-09-16 04:31
Open for 319 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 04:31272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-30 18:42
Last seen 2024-09-16 04:23
Open for 169 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877253d4142d4a7bbaca9c2f4f82740cc78aFound 11 files trough .DS_Store spidering: /index.php /vendor /vendor/phpmailer /vendor/phpmailer/COMMITMENT /vendor/phpmailer/composer.json /vendor/phpmailer/get_oauth_token.php /vendor/phpmailer/LICENSE /vendor/phpmailer/README.md /vendor/phpmailer/SECURITY.md /vendor/phpmailer/src /vendor/phpmailer/VERSION
Found on 2024-09-16 04:23
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.triconnsolutions.com
Port: 443
URL: https://www.triconnsolutions.comFirst seen 2022-10-26 20:19
Last seen 2024-09-16 04:20
Open for 690 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652249a732a4[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/triconn.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 04:20275 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-09-16 03:30
Open for 690 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 03:30
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.sul.pdc.mybluehost.me
Port: 443
URL: https://mail.sul.pdc.mybluehost.meFirst seen 2022-09-22 18:45
Last seen 2024-09-16 01:49
Open for 724 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb172f423b[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://Derron_Design@bitbucket.org/Derron_Design/childlabourinagriculture.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 01:49369 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:51
Last seen 2024-09-16 00:30
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c8138d443b247c62e34e7c62e34eFound 3 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/hoon
Found on 2024-09-16 00:30 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-05-30 05:08
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.palomponleyte-gov-ph.triconnsolutions.com
Port: 443
URL: https://www.palomponleyte-gov-ph.triconnsolutions.comFirst seen 2023-07-12 18:52
Last seen 2024-09-14 11:55
Open for 429 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652287825271[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/palompon.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-14 11:55276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.504vintage.markwag.com
Port: 80
URL: http://www.504vintage.markwag.comFirst seen 2022-10-26 19:53
Last seen 2024-09-08 06:41
Open for 682 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-08 06:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: chargertrucksales.chargerspecialized.com
Port: 80
URL: http://chargertrucksales.chargerspecialized.comFirst seen 2023-04-28 18:50
Last seen 2024-09-01 09:15
Open for 491 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-01 09:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.tingeylaw.tingeyconsulting.com
Port: 80
URL: http://www.tingeylaw.tingeyconsulting.comFirst seen 2023-02-26 20:23
Last seen 2024-08-29 20:02
Open for 549 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-08-29 20:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: tingeylaw.tingeyconsulting.com
Port: 80
URL: http://tingeylaw.tingeyconsulting.comFirst seen 2022-10-27 19:23
Last seen 2024-08-29 20:02
Open for 672 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-08-29 20:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.chargertrucksales.chargerspecialized.com
Port: 80
URL: http://www.chargertrucksales.chargerspecialized.comFirst seen 2022-12-26 19:58
Last seen 2024-08-13 23:58
Open for 596 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-13 23:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-21 15:07
Last seen 2024-07-02 21:05
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 21:05
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-05-21 15:07
Last seen 2024-07-02 21:05
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 21:05272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.ezreviewcenter.triconnsolutions.com
Port: 443
URL: https://www.ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 20:50
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 20:50272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.ezreviewcenter.triconnsolutions.com
Port: 443
URL: https://www.ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 20:50
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 20:50 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81c23c604102dde39210d57dc541cb2cc1Found 41 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss
Found on 2024-05-13 03:00 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a35c0fafb3f79f49101efdeddbd8258fccFound 43 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/style.scss
Found on 2024-04-18 20:59 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e94a7e0559075c565a94f88adb46edd94aFound 5 files trough .DS_Store spidering: /css /fonts /images /js /scss
Found on 2024-03-08 10:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: ezreviewcenter.triconnsolutions.com
Port: 443
URL: https://ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 20:28
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 20:28 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81c23c604102dde39210d57dc541cb2cc1Found 41 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss
Found on 2024-04-10 17:11
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: ezreviewcenter.triconnsolutions.com
Port: 443
URL: https://ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 20:28
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 20:28272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-21 15:07
Last seen 2024-07-02 20:19
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 20:19 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a35c0fafb3f79f49101efdeddbd8258fccFound 43 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/style.scss
Found on 2024-06-18 16:20
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-05-21 15:07
Last seen 2024-07-02 20:19
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 20:19272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: ezreviewcenter.triconnsolutions.com
Port: 80
URL: http://ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 20:17
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 20:17 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81c23c604102dde39210d57dc541cb2cc1Found 41 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss
Found on 2024-05-01 00:43 -
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf7c01fcc70f8aba84d5b3de5776bd7685Found 25 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /scss
Found on 2024-04-29 00:26
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: ezreviewcenter.triconnsolutions.com
Port: 80
URL: http://ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 20:17
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 20:17272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-21 15:07
Last seen 2024-07-02 17:27
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 17:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf7c01fcc70f8aba84d5b3de5776bd7685Found 25 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /scss
Found on 2024-05-08 20:56 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e5abc3696b4968f798fb3bfc625cf3539Found 20 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /js /scss
Found on 2024-04-28 20:34 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81c23c604102dde39210d57dc541cb2cc1Found 41 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss
Found on 2024-04-10 17:11
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-05-21 15:07
Last seen 2024-07-02 17:27
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 17:27272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-21 15:07
Last seen 2024-07-02 17:19
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 17:19 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e5abc3696b4968f798fb3bfc625cf3539Found 20 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /js /scss
Found on 2024-05-30 05:49 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81c23c604102dde39210d57dc541cb2cc1Found 41 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss
Found on 2024-04-28 23:03
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-05-21 15:07
Last seen 2024-07-02 17:19
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 17:19272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.ezreviewcenter.triconnsolutions.com
Port: 80
URL: http://www.ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 16:36
Open for 408 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 16:36272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.ezreviewcenter.triconnsolutions.com
Port: 80
URL: http://www.ezreviewcenter.triconnsolutions.comFirst seen 2023-05-21 15:07
Last seen 2024-07-02 16:36
Open for 408 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 16:36 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a35c0fafb3f79f49101efdeddbd8258fccFound 43 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/style.scss
Found on 2024-06-18 16:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e5abc3696b4968f798fb3bfc625cf3539Found 20 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /js /scss
Found on 2024-03-21 15:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-21 15:07
Last seen 2024-07-02 12:51
Open for 407 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 12:51 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f761e73e1fb224f6b47b73049c0dafe991Found 32 files trough .DS_Store spidering: /css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/style.scss
Found on 2024-06-26 09:10 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f9cf9902f9cf99096f7c82825dbe4d3b785b3658b879aeaFound 75 files trough .DS_Store spidering: /css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-06-18 13:23 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a35c0fafb3f79f49101efdeddbd8258fccFound 43 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/style.scss
Found on 2024-06-16 14:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbecc9c3328cdc079123bda5da982e035d98Found 17 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /images /js /scss
Found on 2024-04-29 00:25
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-05-21 15:07
Last seen 2024-07-02 12:51
Open for 407 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 12:51272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-21 15:07
Last seen 2024-07-02 10:36
Open for 407 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c1e3ea8c61e3ea8c6e815cc9ea8e602f1f7c8e3ded32cc55dFound 86 files trough .DS_Store spidering: /css /css/ajax-loader.gif /css/animate.css /css/bootstrap /css/bootstrap-datepicker.css /css/bootstrap.min.css /css/flaticon.css /css/jquery.timepicker.css /css/magnific-popup.css /css/owl.carousel.min.css /css/owl.theme.default.min.css /css/style.css /fonts /fonts/flaticon /fonts/flaticon/backup.txt /fonts/flaticon/font /fonts/flaticon/license /images /images/loc.png /images/person_1.jpg /images/person_2.jpg /images/person_3.jpg /images/person_4.jpg /js /js/bootstrap-datepicker.js /js/bootstrap.min.js /js/google-map.js /js/jquery-3.2.1.min.js /js/jquery-migrate-3.0.1.min.js /js/jquery.animateNumber.min.js /js/jquery.easing.1.3.js /js/jquery.magnific-popup.min.js /js/jquery.min.js /js/jquery.stellar.min.js /js/jquery.waypoints.min.js /js/main.js /js/owl.carousel.min.js /js/popper.min.js /js/range.js /js/scrollax.min.js /scss /scss/bootstrap /scss/bootstrap/_alert.scss /scss/bootstrap/_badge.scss /scss/bootstrap/_breadcrumb.scss /scss/bootstrap/_button-group.scss /scss/bootstrap/_buttons.scss /scss/bootstrap/_card.scss /scss/bootstrap/_carousel.scss /scss/bootstrap/_close.scss /scss/bootstrap/_code.scss /scss/bootstrap/_custom-forms.scss /scss/bootstrap/_dropdown.scss /scss/bootstrap/_forms.scss /scss/bootstrap/_functions.scss /scss/bootstrap/_grid.scss /scss/bootstrap/_images.scss /scss/bootstrap/_input-group.scss /scss/bootstrap/_jumbotron.scss /scss/bootstrap/_list-group.scss /scss/bootstrap/_media.scss /scss/bootstrap/_mixins.scss /scss/bootstrap/_modal.scss /scss/bootstrap/_nav.scss /scss/bootstrap/_navbar.scss /scss/bootstrap/_pagination.scss /scss/bootstrap/_popover.scss /scss/bootstrap/_print.scss /scss/bootstrap/_progress.scss /scss/bootstrap/_reboot.scss /scss/bootstrap/_root.scss /scss/bootstrap/_spinners.scss /scss/bootstrap/_tables.scss /scss/bootstrap/_toasts.scss /scss/bootstrap/_tooltip.scss /scss/bootstrap/_transitions.scss /scss/bootstrap/_type.scss /scss/bootstrap/_utilities.scss /scss/bootstrap/_variables.scss /scss/bootstrap/bootstrap-grid.scss /scss/bootstrap/bootstrap-reboot.scss /scss/bootstrap/bootstrap.scss /scss/bootstrap/mixins /scss/bootstrap/utilities /scss/bootstrap/vendor /scss/style.scss
Found on 2024-07-02 10:36
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-05-21 15:07
Last seen 2024-07-02 10:36
Open for 407 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522748cddbf[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/ezrc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-02 10:36272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-19 18:28
Last seen 2024-06-08 08:21
Open for 689 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226f6468e3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/phusion/passenger-python-flask-demo.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-06-08 08:21301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-19 18:28
Last seen 2024-06-08 08:00
Open for 689 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226f6468e3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/phusion/passenger-python-flask-demo.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-06-08 08:00301 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-23 05:43
Last seen 2024-06-02 05:02
Open for 9 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec75de6fe687f9d95d6a0223676f632f27Found 17 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes
Found on 2024-06-02 05:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf0225cecaf0e605950f23fb699d4b0f047dFound 24 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/mu-plugins /wp-content/plugins /wp-content/plugins/jetpack /wp-content/plugins/revslider /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes
Found on 2024-05-29 04:30 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc29438116ffa6980d74f92357f7f05005Found 22 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/mu-plugins /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes
Found on 2024-05-28 04:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.vce.ygs.mybluehost.me
Port: 443
URL: https://www.vce.ygs.mybluehost.meFirst seen 2024-05-23 13:01
Last seen 2024-06-01 22:13
Open for 9 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec75de6fe687f9d95d6a0223676f632f27Found 17 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes
Found on 2024-06-01 22:13 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf0225cecaf0e605950f23fb699d4b0f047dFound 24 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/mu-plugins /wp-content/plugins /wp-content/plugins/jetpack /wp-content/plugins/revslider /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes
Found on 2024-05-30 08:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-23 04:31
Last seen 2024-06-01 09:17
Open for 9 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec75de6fe687f9d95d6a0223676f632f27Found 17 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes
Found on 2024-06-01 09:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf0225cecaf0e605950f23fb699d4b0f047dFound 24 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/mu-plugins /wp-content/plugins /wp-content/plugins/jetpack /wp-content/plugins/revslider /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes
Found on 2024-05-29 04:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc29438116ffa6980d74f92357f7f05005Found 22 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/mu-plugins /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes
Found on 2024-05-27 10:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.vce.ygs.mybluehost.me
Port: 443
URL: https://mail.vce.ygs.mybluehost.meFirst seen 2024-05-23 11:53
Last seen 2024-05-31 23:37
Open for 8 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec75de6fe687f9d95d6a0223676f632f27Found 17 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes
Found on 2024-05-31 23:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc29438116ffa6980d74f92357f7f05005Found 22 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/mu-plugins /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes
Found on 2024-05-29 13:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf0225cecaf0e605950f23fb699d4b0f047dFound 24 files trough .DS_Store spidering: /demo /demo/themes /demo/wp-admin /demo/wp-content /demo/wp-content/plugins /demo/wp-includes /themes /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/mu-plugins /wp-content/plugins /wp-content/plugins/jetpack /wp-content/plugins/revslider /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes
Found on 2024-05-28 07:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-23 18:28
Last seen 2024-05-24 18:27
Open for 305 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57adf0e4e16700d0272427fe7f53cf40fb7Found 19 files trough .DS_Store spidering: /assets /assets/css /assets/fonts /assets/images /assets/js /assets/sass /css /images /images/backgrounds /images/icons /images/json /images/screenshots /js /site /site/css /site/img /site/js /site/vendor /sound
Found on 2024-05-24 18:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbe800eab3a3fec112e412059f90b2d1b90Found 15 files trough .DS_Store spidering: /assets /assets/css /assets/fonts /assets/images /assets/js /assets/sass /css /images /images/backgrounds /images/icons /images/json /images/screenshots /js /site /sound
Found on 2024-04-30 21:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877272a0bbaec4b067daa367de0d3c348a78Found 11 files trough .DS_Store spidering: /assets /assets/css /assets/fonts /assets/images /assets/js /assets/sass /css /images /js /site /sound
Found on 2024-04-28 19:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-23 18:28
Last seen 2024-05-24 18:27
Open for 305 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57adf0e4e16700d0272427fe7f53cf40fb7Found 19 files trough .DS_Store spidering: /assets /assets/css /assets/fonts /assets/images /assets/js /assets/sass /css /images /images/backgrounds /images/icons /images/json /images/screenshots /js /site /site/css /site/img /site/js /site/vendor /sound
Found on 2024-05-24 18:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f877272a0bbaec4b067daa367de0d3c348a78Found 11 files trough .DS_Store spidering: /assets /assets/css /assets/fonts /assets/images /assets/js /assets/sass /css /images /js /site /sound
Found on 2024-05-08 14:54 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbe800eab3a3fec112e412059f90b2d1b90Found 15 files trough .DS_Store spidering: /assets /assets/css /assets/fonts /assets/images /assets/js /assets/sass /css /images /images/backgrounds /images/icons /images/json /images/screenshots /js /site /sound
Found on 2024-04-18 20:09
-
-
Symfony developement panel enabled
The application has Symfony profiling enabled.
It enables an attacker to access the following sensitive content :
- System configuration
- Request log, including POST request with credentials and/or api keys
IP: 162.241.216.107
Domain: cames.dpay.online
Port: 443
URL: https://cames.dpay.online/_profiler/empty/search/resultsFirst seen 2022-09-23 18:26
Last seen 2024-05-24 17:35
Open for 608 days-
Fingerprint: 407cf4363b0e62fafca67e07ff5b0479ff5b0479ff5b0479ff5b0479ff5b0479
Symfony profiler enabled: https://cames.dpay.online/_profiler/empty/search/results
Found on 2024-05-24 17:35
-
Symfony developement panel enabled
The application has Symfony profiling enabled.
It enables an attacker to access the following sensitive content :
- System configuration
- Request log, including POST request with credentials and/or api keys
IP: 162.241.216.107
Domain: www.cames.dpay.online
Port: 443
URL: https://www.cames.dpay.online/_profiler/empty/search/resultsFirst seen 2022-09-23 18:26
Last seen 2024-05-24 15:29
Open for 608 days-
Fingerprint: 407cf4363b0e62fafca67e0749b2b74449b2b74449b2b74449b2b74449b2b744
Symfony profiler enabled: https://www.cames.dpay.online/_profiler/empty/search/results
Found on 2024-05-24 15:29
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.fjf.oha.mybluehost.me
Port: 80
URL: http://mail.fjf.oha.mybluehost.meFirst seen 2024-05-08 21:59-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 21:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.fjf.oha.mybluehost.me
Port: 443
URL: https://mail.fjf.oha.mybluehost.meFirst seen 2024-05-08 21:44-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 21:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-08 21:44-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 21:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-08 21:44-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 21:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-08 21:44-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 21:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-08 21:44-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 21:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-08 20:35-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 20:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-08 20:35-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 20:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.fjf.oha.mybluehost.me
Port: 443
URL: https://www.fjf.oha.mybluehost.meFirst seen 2024-05-08 20:22-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89fab3f147c6a797c51286a2ba5Found 10 files trough .DS_Store spidering: /app /bootstrap /config /database /public /resources /routes /storage /tests /vendor
Found on 2024-05-08 20:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:23
Last seen 2024-05-01 02:27
Open for 551 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f9b22bb3f31f3f27858dee6a958dee6a9Found 3 files trough .DS_Store spidering: /IMAGE ICONS /IMAGES /LOGOs
Found on 2024-05-01 02:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:23
Last seen 2024-05-01 02:24
Open for 551 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f9b22bb3f31f3f27858dee6a958dee6a9Found 3 files trough .DS_Store spidering: /IMAGE ICONS /IMAGES /LOGOs
Found on 2024-05-01 02:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-02-02 22:21
Open for 464 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-02 22:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-02-02 22:21
Open for 464 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-02 22:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-02-02 21:09
Open for 464 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-02 21:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.vintage504.markwag.com
Port: 80
URL: http://www.vintage504.markwag.comFirst seen 2022-10-26 19:53
Last seen 2024-02-02 21:09
Open for 464 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-02 21:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-02-02 20:08
Open for 464 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-02 20:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-02-02 03:51
Open for 463 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-02 03:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-02-02 01:55
Open for 463 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-02 01:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.vintage504.markwag.com
Port: 443
URL: https://www.vintage504.markwag.comFirst seen 2022-10-26 19:53
Last seen 2024-02-01 23:04
Open for 463 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-01 23:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2024-02-01 22:46
Open for 463 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-02-01 22:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 19:52
Last seen 2024-01-07 12:16
Open for 376 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-01-07 12:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.carlottadejulio.com
Port: 443
URL: https://mail.carlottadejulio.comFirst seen 2022-10-26 19:20
Last seen 2024-01-07 10:28
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 10:28 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764269231643c0c0ee23c0c0ee23c0c0ee23Found 2 files trough .DS_Store spidering: /Images /kdtcomputers
Found on 2023-02-25 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:20
Last seen 2024-01-07 10:28
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 10:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.carlottadejulio.dejuliocarpetcleaning.com
Port: 80
URL: http://www.carlottadejulio.dejuliocarpetcleaning.comFirst seen 2022-10-26 19:20
Last seen 2024-01-07 06:21
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 06:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:20
Last seen 2024-01-07 01:02
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 01:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: carlottadejulio.dejuliocarpetcleaning.com
Port: 443
URL: https://carlottadejulio.dejuliocarpetcleaning.comFirst seen 2022-10-26 19:20
Last seen 2024-01-07 01:02
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764269231643c0c0ee23c0c0ee23c0c0ee23Found 2 files trough .DS_Store spidering: /Images /kdtcomputers
Found on 2024-01-07 01:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-06 02:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.carlottadejulio.dejuliocarpetcleaning.com
Port: 443
URL: https://www.carlottadejulio.dejuliocarpetcleaning.comFirst seen 2022-10-26 19:20
Last seen 2024-01-07 01:02
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 01:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764269231643c0c0ee23c0c0ee23c0c0ee23Found 2 files trough .DS_Store spidering: /Images /kdtcomputers
Found on 2023-02-25 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:20
Last seen 2024-01-07 00:48
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 00:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764269231643c0c0ee23c0c0ee23c0c0ee23Found 2 files trough .DS_Store spidering: /Images /kdtcomputers
Found on 2023-02-25 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: carlottadejulio.dejuliocarpetcleaning.com
Port: 80
URL: http://carlottadejulio.dejuliocarpetcleaning.comFirst seen 2022-10-26 19:20
Last seen 2024-01-07 00:04
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 00:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:20
Last seen 2024-01-07 00:04
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 00:04 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764269231643c0c0ee23c0c0ee23c0c0ee23Found 2 files trough .DS_Store spidering: /Images /kdtcomputers
Found on 2023-02-25 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:20
Last seen 2024-01-07 00:04
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9280026da3ee700083a5ffd4d1580823fFound 5 files trough .DS_Store spidering: /Images /Images/graphicdesign /Images/photography /Images/websites /kdtcomputers
Found on 2024-01-07 00:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2023-12-28 20:06
Open for 428 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2023-12-28 20:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-25 19:27
Last seen 2023-09-23 07:47
Open for 209 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-25 19:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 19:52
Last seen 2023-09-23 07:14
Open for 270 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-26 19:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:14
Last seen 2023-09-19 07:05
Open for 327 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 20:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:14
Last seen 2023-09-18 23:56
Open for 327 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 20:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.orangesodafilms.com
Port: 443
URL: https://mail.orangesodafilms.comFirst seen 2022-10-26 20:14
Last seen 2023-09-16 18:19
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 20:14
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.natc.triconnsolutions.com
Port: 443
URL: https://www.natc.triconnsolutions.comFirst seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.natc.triconnsolutions.com
Port: 80
URL: http://www.natc.triconnsolutions.comFirst seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.nasugbutransport.com
Port: 443
URL: https://www.nasugbutransport.comFirst seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.nasugbutransport.com
Port: 80
URL: http://mail.nasugbutransport.comFirst seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: natc.triconnsolutions.com
Port: 443
URL: https://natc.triconnsolutions.comFirst seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.nasugbutransport.com
Port: 443
URL: https://mail.nasugbutransport.comFirst seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: natc.triconnsolutions.com
Port: 80
URL: http://natc.triconnsolutions.comFirst seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-14 18:45
Last seen 2023-04-28 21:41
Open for 257 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e9dea8f3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/natc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-08-14 18:45272 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:08
Last seen 2023-03-25 18:44
Open for 148 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2023-03-25 18:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:08
Last seen 2023-03-25 18:44
Open for 148 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2023-03-25 18:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:08
Last seen 2023-03-25 18:44
Open for 148 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2023-03-25 18:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:08
Last seen 2023-03-25 18:44
Open for 148 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-12-27 19:59 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:08
Last seen 2023-03-25 18:44
Open for 148 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2023-03-25 18:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:08
Last seen 2023-03-25 18:44
Open for 148 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2023-03-25 18:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: watchertravel.text-trader.com
Port: 80
URL: http://watchertravel.text-trader.comFirst seen 2023-03-07 17:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 17:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-03-07 17:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 17:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-03-07 17:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 17:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.watchertravel.text-trader.com
Port: 80
URL: http://www.watchertravel.text-trader.comFirst seen 2023-03-07 17:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 17:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-03-07 17:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 17:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-03-07 16:11-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 16:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-03-07 16:11-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 16:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.xyzzy.michaelgeatz.com
Port: 80
URL: http://www.xyzzy.michaelgeatz.comFirst seen 2023-03-07 15:42-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 15:42
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-03-07 15:42-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252276e442806fd8b6c06fd8b6cFound 3 files trough .DS_Store spidering: /.well-known /.well-known/acme-challenge /wp-includes
Found on 2023-03-07 15:42
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: powergents.triconnsolutions.com
Port: 443
URL: https://powergents.triconnsolutions.comFirst seen 2022-06-27 19:22
Last seen 2023-02-26 23:01
Open for 244 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.powergents.triconnsolutions.com
Port: 443
URL: https://www.powergents.triconnsolutions.comFirst seen 2022-06-27 19:22
Last seen 2023-02-26 20:24
Open for 244 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-10-26 20:19
Last seen 2023-02-25 20:49
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652249a732a4[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/triconn.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-10-26 20:19275 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.triconnsolutions.com
Port: 80
URL: http://mail.triconnsolutions.comFirst seen 2022-10-26 20:19
Last seen 2023-02-25 20:49
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652249a732a4[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/triconn.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-10-26 20:19275 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-10-26 20:19
Last seen 2023-02-25 20:49
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652249a732a4[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/triconn.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-10-26 20:19275 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:17
Last seen 2023-02-25 20:40
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1c46a26e0746a26e0746a26e07Found 2 files trough .DS_Store spidering: /wp-content /wp-content/themes
Found on 2022-10-26 20:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2023-02-25 20:19
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 19:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.jenniferlake-me.marklake.org
Port: 80
URL: http://www.jenniferlake-me.marklake.orgFirst seen 2022-12-26 20:27
Last seen 2023-02-25 20:19
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-26 20:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: jenniferlake-me.marklake.org
Port: 80
URL: http://jenniferlake-me.marklake.orgFirst seen 2022-10-26 19:53
Last seen 2023-02-25 20:19
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 19:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 20:27
Last seen 2023-02-25 20:19
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-26 20:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:53
Last seen 2023-02-25 20:19
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 19:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-25 18:43
Last seen 2023-01-25 19:55
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772692eda3325d216faeec636963ce00797Found 11 files trough .DS_Store spidering: /api /api/includes /assets /assets/bootstrap /assets/css /assets/fonts /assets/img /assets/img/avatars /assets/js /DATABASE /includes
Found on 2022-09-25 18:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-25 18:43
Last seen 2023-01-25 19:55
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772692eda3325d216faeec636963ce00797Found 11 files trough .DS_Store spidering: /api /api/includes /assets /assets/bootstrap /assets/css /assets/fonts /assets/img /assets/img/avatars /assets/js /DATABASE /includes
Found on 2022-09-25 18:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:51
Last seen 2023-01-18 19:42
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c8138d443b247c62e34e7c62e34eFound 3 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/hoon
Found on 2022-09-16 18:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:51
Last seen 2023-01-18 19:42
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c8138d443b247c62e34e7c62e34eFound 3 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/hoon
Found on 2022-09-16 18:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2022-12-29 19:47
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2022-08-29 18:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2022-12-29 19:47
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2022-08-29 18:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2022-12-29 19:47
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2022-08-29 18:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2022-12-29 19:47
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2022-08-29 18:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2022-12-29 19:47
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2022-08-29 18:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-08-29 18:52
Last seen 2022-12-29 19:47
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725cdd65441176c6ebfa325dc1aec7c9adcFound 9 files trough .DS_Store spidering: /_db_backups /cgi /Download /jwplayer /PNEHTML /stats /wordpress /wp-admin /wp-content
Found on 2022-08-29 18:52
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.powergents.triconnsolutions.com
Port: 80
URL: http://www.powergents.triconnsolutions.comFirst seen 2022-06-27 19:22
Last seen 2022-12-27 20:14
Open for 183 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: powergents.triconnsolutions.com
Port: 80
URL: http://powergents.triconnsolutions.comFirst seen 2022-06-27 19:22
Last seen 2022-12-27 20:14
Open for 183 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:23
Last seen 2022-12-27 20:14
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f9b22bb3f31f3f27858dee6a958dee6a9Found 3 files trough .DS_Store spidering: /IMAGE ICONS /IMAGES /LOGOs
Found on 2022-10-27 19:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:23
Last seen 2022-12-27 20:14
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f9b22bb3f31f3f27858dee6a958dee6a9Found 3 files trough .DS_Store spidering: /IMAGE ICONS /IMAGES /LOGOs
Found on 2022-10-27 19:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 19:23
Last seen 2022-12-27 20:14
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f9b22bb3f31f3f27858dee6a958dee6a9Found 3 files trough .DS_Store spidering: /IMAGE ICONS /IMAGES /LOGOs
Found on 2022-10-27 19:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.tsplatforms.rudybanks.com
Port: 443
URL: https://www.tsplatforms.rudybanks.comFirst seen 2022-10-27 19:08
Last seen 2022-12-27 19:59
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.tsplatforms.rudybanks.com
Port: 80
URL: http://www.tsplatforms.rudybanks.comFirst seen 2022-10-27 19:08
Last seen 2022-12-27 19:59
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: tsplatforms.rudybanks.com
Port: 80
URL: http://tsplatforms.rudybanks.comFirst seen 2022-10-27 19:08
Last seen 2022-12-27 19:59
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 18:57
Last seen 2022-12-27 19:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2022-10-27 18:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:17
Last seen 2022-12-26 20:40
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1c46a26e0746a26e0746a26e07Found 2 files trough .DS_Store spidering: /wp-content /wp-content/themes
Found on 2022-10-26 20:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:56
Last seen 2022-12-26 20:31
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-26 19:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:51
Last seen 2022-12-26 20:27
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af2472579313956c2dc117cd05c700896e442e2Found 9 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /staging/wp-content/themes /staging/wp-content/themes/hoon /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads
Found on 2022-12-26 20:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc208ad487b07d14d16db4099be67d39bfFound 4 files trough .DS_Store spidering: /lumigeek.esproj /staging /staging/wp-content /wp-content
Found on 2022-10-26 19:51
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-25 19:45
Last seen 2022-12-26 20:27
Open for 123 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a7e522f6[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/gabeshaughnessy/lumigeek.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-08-25 19:45210 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 19:52-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-26 19:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-26 19:52-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-26 19:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: beautyservice.beautyvil.com
Port: 80
URL: http://beautyservice.beautyvil.comFirst seen 2022-10-05 18:45
Last seen 2022-12-05 19:41
Open for 61 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b173d9f039cc07ff6119a642660e3134eeFound 34 files trough .DS_Store spidering: /Adapter /admin /architecture.md /cache /classes /config /CONTRIBUTING.md /CONTRIBUTORS.md /controllers /Core /css /docs /download /error500.html /footer.php /header.php /images.inc.php /img /index.php /init.php /install /js /localization /log /mails /modules /override /pdf /README.md /themes /tools /translations /upload /webservice
Found on 2022-10-05 18:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.beautyservice.beautyvil.com
Port: 80
URL: http://www.beautyservice.beautyvil.comFirst seen 2022-10-05 18:45
Last seen 2022-12-05 19:41
Open for 61 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b173d9f039cc07ff6119a642660e3134eeFound 34 files trough .DS_Store spidering: /Adapter /admin /architecture.md /cache /classes /config /CONTRIBUTING.md /CONTRIBUTORS.md /controllers /Core /css /docs /download /error500.html /footer.php /header.php /images.inc.php /img /index.php /init.php /install /js /localization /log /mails /modules /override /pdf /README.md /themes /tools /translations /upload /webservice
Found on 2022-10-05 18:45
-
-
Symfony developement panel enabled
The application has Symfony profiling enabled.
It enables an attacker to access the following sensitive content :
- System configuration
- Request log, including POST request with credentials and/or api keys
IP: 162.241.216.107
Domain: cames.dpay.online
Port: 80
URL: http://cames.dpay.online/_profiler/empty/search/resultsFirst seen 2022-09-23 18:26
Last seen 2022-11-23 19:38
Open for 61 days-
Fingerprint: 407cf4363b0e62fafca67e07f519b33ef519b33ef519b33ef519b33ef519b33e
Symfony profiler enabled: http://cames.dpay.online/_profiler/empty/search/results
Found on 2022-09-23 18:26
-
Symfony developement panel enabled
The application has Symfony profiling enabled.
It enables an attacker to access the following sensitive content :
- System configuration
- Request log, including POST request with credentials and/or api keys
IP: 162.241.216.107
Domain: www.cames.dpay.online
Port: 80
URL: http://www.cames.dpay.online/_profiler/empty/search/resultsFirst seen 2022-09-23 18:26
Last seen 2022-11-23 19:38
Open for 61 days-
Fingerprint: 407cf4363b0e62fafca67e07034fd31b034fd31b034fd31b034fd31b034fd31b
Symfony profiler enabled: http://www.cames.dpay.online/_profiler/empty/search/results
Found on 2022-09-23 18:26
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.sul.pdc.mybluehost.me
Port: 80
URL: http://mail.sul.pdc.mybluehost.meFirst seen 2022-09-22 18:45
Last seen 2022-11-22 19:43
Open for 61 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb172f423b[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://Derron_Design@bitbucket.org/Derron_Design/childlabourinagriculture.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-09-22 18:45369 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-09-22 18:46
Last seen 2022-11-22 19:43
Open for 61 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb172f423b[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://Derron_Design@bitbucket.org/Derron_Design/childlabourinagriculture.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-09-22 18:46369 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.sul.pdc.mybluehost.me
Port: 80
URL: http://www.sul.pdc.mybluehost.meFirst seen 2022-09-22 18:45
Last seen 2022-11-22 19:43
Open for 61 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb172f423b[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://Derron_Design@bitbucket.org/Derron_Design/childlabourinagriculture.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-09-22 18:45369 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-19 18:28
Last seen 2022-11-18 19:42
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226f6468e3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/phusion/passenger-python-flask-demo.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-07-19 18:28301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-19 18:27
Last seen 2022-11-18 19:42
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226f6468e3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/phusion/passenger-python-flask-demo.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-07-19 18:27301 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: dev.crossfitwaterbury.com
Port: 80
URL: http://dev.crossfitwaterbury.comFirst seen 2022-09-16 18:30
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2022-09-16 18:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.dev.crossfitwaterbury.com
Port: 80
URL: http://www.dev.crossfitwaterbury.comFirst seen 2022-09-16 18:30
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2022-09-16 18:30
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-27 19:22
Last seen 2022-10-27 19:25
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-27 19:22
Last seen 2022-10-27 19:25
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-27 19:22
Last seen 2022-10-27 19:25
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-27 19:22
Last seen 2022-10-27 19:25
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-27 19:22
Last seen 2022-10-27 19:25
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-27 19:22
Last seen 2022-10-27 19:25
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227632ddde[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ohmel/powergen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-27 19:22276 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: tsplatforms.rudybanks.com
Port: 443
URL: https://tsplatforms.rudybanks.comFirst seen 2022-10-27 19:08-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-10-27 19:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 18:57-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2022-10-27 18:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 18:57-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f12bc2b81ea6646a963d4b45963d4b459Found 3 files trough .DS_Store spidering: /wp-admin /wp-content /wp-includes
Found on 2022-10-27 18:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:14-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 20:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:14-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 20:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 20:14-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-26 20:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 19:19-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-10-26 19:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: www.debhartmandigital.com
Port: 80
URL: http://www.debhartmandigital.comFirst seen 2022-10-26 19:19-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-10-26 19:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.107
Domain: mail.debhartmandigital.com
Port: 80
URL: http://mail.debhartmandigital.comFirst seen 2022-10-26 19:19-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-10-26 19:19
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-09-02 18:26-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd14f66e2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://UmarWaqas@bitbucket.org/UmarWaqas/rotecon_backend_apis.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "dev"] remote = origin merge = refs/heads/dev [gui] wmstate = normal geometry = 893x435+52+52 175 196
Found on 2022-09-02 18:26443 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-09-02 18:26-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd14f66e2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://UmarWaqas@bitbucket.org/UmarWaqas/rotecon_backend_apis.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "dev"] remote = origin merge = refs/heads/dev [gui] wmstate = normal geometry = 893x435+52+52 175 196
Found on 2022-09-02 18:26443 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.cfu.twr.mybluehost.me
Port: 443
URL: https://www.cfu.twr.mybluehost.meFirst seen 2022-09-02 18:26-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd14f66e2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://UmarWaqas@bitbucket.org/UmarWaqas/rotecon_backend_apis.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "dev"] remote = origin merge = refs/heads/dev [gui] wmstate = normal geometry = 893x435+52+52 175 196
Found on 2022-09-02 18:26443 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.cfu.twr.mybluehost.me
Port: 443
URL: https://mail.cfu.twr.mybluehost.meFirst seen 2022-09-02 18:26-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd14f66e2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://UmarWaqas@bitbucket.org/UmarWaqas/rotecon_backend_apis.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "dev"] remote = origin merge = refs/heads/dev [gui] wmstate = normal geometry = 893x435+52+52 175 196
Found on 2022-09-02 18:26443 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: www.cfu.twr.mybluehost.me
Port: 80
URL: http://www.cfu.twr.mybluehost.meFirst seen 2022-09-02 18:26-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd14f66e2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://UmarWaqas@bitbucket.org/UmarWaqas/rotecon_backend_apis.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "dev"] remote = origin merge = refs/heads/dev [gui] wmstate = normal geometry = 893x435+52+52 175 196
Found on 2022-09-02 18:26443 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.107
Domain: mail.cfu.twr.mybluehost.me
Port: 80
URL: http://mail.cfu.twr.mybluehost.meFirst seen 2022-09-02 18:26-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd14f66e2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://UmarWaqas@bitbucket.org/UmarWaqas/rotecon_backend_apis.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "dev"] remote = origin merge = refs/heads/dev [gui] wmstate = normal geometry = 893x435+52+52 175 196
Found on 2022-09-02 18:26443 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-25 19:45-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a7e522f6[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/gabeshaughnessy/lumigeek.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-08-25 19:45210 Bytes
-
-
Open service 162.241.216.107:443 · www.sctplayhouse.sctplayhouse.org
2024-09-16 09:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:59:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sctplayhouse.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://sctplayhouse.com/index.php?rest_route=/wp/v2/pages/1000>; rel="alternate"; title="JSON"; type="application/json", <https://sctplayhouse.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.wildsideworkouts.com
2024-09-16 09:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:58:36 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Wild Side Workouts — Coming Soon <!DOCTYPE html><html><head><title>Wild Side Workouts — Coming Soon</title><link href='https://fonts.googleapis.com/css?family=Montserrat' rel='stylesheet' type='text/css'><style type='text/css'>body{background-color: #2D2A25;background-image: url( https://www.mojomarketplace.com/img/mojo-landing-bg.jpg );background-position: top right;background-repeat: no-repeat;font-family: 'Montserrat', sans-serif;color: #fff;}a{color: #fff;text-decoration: none;}#wrap{max-width: 900px;margin: 0 auto;}#logo{height: auto;width: 204px;padding: 30px 10px 10px 10px;max-width: 90%;}.cta{background-color: #93C933;color: #35393A;padding: 10px 20px;text-decoration: none;margin: 10px 0;display: inline-block;border-radius: 3px;}.cta:hover{color: #fff;}.content{margin: 5rem 0;font-size: 1.2rem;padding: 0 15px;}.powered-by {text-align: right;padding: 50px;font-size: 12px;}h1 span{color: #93C933;}footer{border-top: 1px solid #333;}footer a:hover{color: #ccc;}footer .col{padding: 10px 4%;display: inline-block;vertical-align: top;max-width: 100%;}footer h2, footer h2 a{color: #93C933;font-size: 1rem;text-decoration: none;}footer ul{list-style: none;padding:0;}footer li{height: 26px;}#what-is-this-content{display:none;position: fixed;top: 50%;left: 50%;margin-top: -200px;margin-left: -200px;width: 300px;height: 200px;background-color: #fff;color: #aaa;padding: 50px;}.btn{display: inline-block;margin-top:50px;text-align:center;padding: 10px 50px; border-radius: 3px;}.green{color: #343537;background: #92c835; /* Old browsers */background: -moz-linear-gradient(top, #92c835 0%, #6d9628 100%); /* FF3.6+ */background: -webkit-gradient(linear, left top, left bottom, color-stop(0%,#92c835), color-stop(100%,#6d9628)); /* Chrome,Safari4+ */background: -webkit-linear-gradient(top, #92c835 0%,#6d9628 100%); /* Chrome10+,Safari5.1+ */background: -o-linear-gradient(top, #92c835 0%,#6d9628 100%); /* Opera 11.10+ */background: -ms-linear-gradient(top, #92c835 0%,#6d9628 100%); /* IE10+ */background: linear-gradient(to bottom, #92c835 0%,#6d9628 100%);filter: progid:DXImageTransform.Microsoft.gradient( startColorstr='#92c835', endColorstr='#6d9628',GradientType=0 ); /* IE6-9 */}#what-is-this-content a{width: 50%;display:inline-block;color: #666;text-align:center;}.footer-actions a{width: 50%; text-align:center; display:inline-block;}.split-content > div:first-of-type{padding-right: 10%;}.split-content > div{width: 40%;display: inline-block;vertical-align: top;padding: 50px 80px 0 0;font-family: Arial;font-weight: lighter;line-height: 1.8rem;}#wrap .highlight{color:#90C534;}@media (max-width: 859px) {.split-content > div{width: 100%;box-sizing: border-box;padding: 5% 20%;}.btn{width: 122px;display:block;margin: 50px auto;}footer .col {width: 100%;box-sizing: border-box;padding: 5%;text-align:center;}}</style></head><body><div id='wrap'><div class='content'><h1>Website Coming Soon</h1><p>This page is used to test the proper operation of your recent <a class='highlight' href='https://www.mojomarketplace.com/explore?utm_source=mojo_wp_plugin&utm_campaign=mojo_wp_plugin&utm_medium=plugin_landing&utm_content=description_link'>MOJO Marketplace</a> installation of WordPress! If you can read this page it means your installation was successful!</p><a class='btn green' href='https://www.wildsideworkouts.com/wp-login.php'>Admin Login</a><div class='split-content'><div><h3>Just visiting?</h3><p>The owner of this website is working on making this site awesome. Why not <a class='highlight' href='#' onclick='bookmark();'>bookmark it</a> and come back again later. We are sure you will not be disappointed.</p></div><div><h3>Are you the Site Owner?</h3><p>You should <a class='highlight' href='https://www.wildsideworkouts.com/wp-login.php'>login</a> to your WordPress installation and prepare your site for launch.</p><p>To launch your site just click the link in the banner at the top of the screen.</p></div></div></div><footer><div class='col'><h2><a href='https://www.mojomarketplace.com/themes/wordpress?utm_source=mojo_wp_plugin&utm_campaign=mojo_wp_plugin&utm_medium=plugin_landinFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · usaworldchampionships.com
2024-09-16 09:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:58:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://usaworldchampionships.com/wp-json/>; rel="https://api.w.org/", <https://usaworldchampionships.com/wp-json/wp/v2/pages/179>; rel="alternate"; title="JSON"; type="application/json", <https://usaworldchampionships.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:58:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.afghanroyalsaffron.com
2024-09-16 09:56
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:57:01 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · daniyaal.ca
2024-09-16 09:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:55:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://daniyaal.ca/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:55:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.svolgere.finance
2024-09-16 09:53
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:53:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:53:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Svolgere Finance — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Svolgere Finance — Coming Soon</title> <script src="https://svolgere.finance/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://svolgere.finance/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://svolgere.finance/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · oweless-tax.diydebtsolution.com
2024-09-16 09:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:53:41 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=3fe361095e7f12e012ba5da782a2c29d; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://oweless.tax/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · aza.mhj.mybluehost.me
2024-09-16 09:53
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:53:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://aza.mhj.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://aza.mhj.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · coloringthemind.com
2024-09-16 09:53
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:53:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://coloringthemind.com/wp-json/>; rel="https://api.w.org/", <https://coloringthemind.com/wp-json/wp/v2/pages/268>; rel="alternate"; title="JSON"; type="application/json", <https://coloringthemind.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=3a0cb1a021ecc508fe842d7ef5df4dfd; path=/ Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · insuranceshoppe-me.havemedicare.com
2024-09-16 09:52
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:52:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://insuranceshoppe.me/index.php?rest_route=/>; rel="https://api.w.org/", <https://insuranceshoppe.me/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://insuranceshoppe.me/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.thinkelevate-tech.viewserendib.com
2024-09-16 09:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:51:58 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: http://www.explorefreeresults.com/?dn=box5397.bluehost.com&pid=5POJ5651L&spfwd=1 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · mail.bubbachat.com
2024-09-16 09:51
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · slaveckmoraru.com
2024-09-16 09:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:51:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: hit Content-Security-Policy: upgrade-insecure-requests Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.uxl.enu.mybluehost.me
2024-09-16 09:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:51:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bloomnbroom.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:51:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.zot.cex.mybluehost.me
2024-09-16 09:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:51:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:51:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Ryusoso — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Ryusoso — Coming Soon</title> <script src="https://ryusoso.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ryusoso.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ryusoso.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.zzj.boy.mybluehost.me
2024-09-16 09:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:51:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: hit Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:51:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · afghanroyalsaffron.com
2024-09-16 09:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:51:11 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.bookishgirlsblog.com
2024-09-16 09:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:50:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bookishgirlsblog.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:50:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · sofoodtastic.com
2024-09-16 09:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:49:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sofoodtastic.com/index.php?rest_route=/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.dsw.vsb.mybluehost.me
2024-09-16 09:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:49:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://jimmydasilva.com/en/homepage/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.asf.vvo.mybluehost.me
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gym-ergy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · clarkedonelsonphoto.com
2024-09-16 09:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:47:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: clarkedonelsonphoto.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>clarkedonelsonphoto.com — Coming Soon</title> <script src="https://clarkedonelsonphoto.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://clarkedonelsonphoto.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.8.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"> <a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><span class="dashicons dashicons-wordpress"></span><br /> <a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /> <a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for WordPress?</a><br /> </p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://clarkedonelsonphoto.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.zki.hju.mybluehost.me
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hannahsprague2025.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mc_session_ids[default]=aed96c9889bf6c89dd70f74af2e1d0f9c1ca3d23; expires=Mon, 16 Sep 2024 09:55:26 GMT; Max-Age=500; path=/; secure; HttpOnly Set-Cookie: mc_session_ids[multi][0]=74e958d8cd8904ebf9a82a4713c7b26021aaa100; expires=Mon, 16 Sep 2024 09:55:26 GMT; Max-Age=500; path=/ Set-Cookie: mc_session_ids[multi][1]=f0668acb0d1fec0b32cdcb527722b991bda99a24; expires=Mon, 16 Sep 2024 09:55:26 GMT; Max-Age=500; path=/ Set-Cookie: mc_session_ids[multi][2]=1b930cfc39139cd4a22ee1edf1909678b49fa9ee; expires=Mon, 16 Sep 2024 09:55:26 GMT; Max-Age=500; path=/ Set-Cookie: mc_session_ids[multi][3]=78f808430f33816414044032b6913f71374a1c2c; expires=Mon, 16 Sep 2024 09:55:26 GMT; Max-Age=500; path=/ Set-Cookie: mc_session_ids[multi][4]=e7b1e693e63d017f7856b1dcdead478dbdefb6a8; expires=Mon, 16 Sep 2024 09:55:26 GMT; Max-Age=500; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · mail.ypa.sfg.mybluehost.me
2024-09-16 09:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:46:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:46:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Authentous Mobile App — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Authentous Mobile App — Coming Soon</title> <script src="http://authentousapp.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://authentousapp.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://authentousapp.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.irei.com.mx
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://irei.com.mx/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.adarsh.theorphic.space
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:58 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 2903 Last-Modified: Sat, 09 Mar 2024 13:03:31 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: My Blog — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>My Blog — Coming Soon</title> <script src="http://adarsh.theorphic.space/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://adarsh.theorphic.space/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"> <a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><span class="dashicons dashicons-wordpress"></span><br /> <a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /> <a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for WordPress?</a><br /> </p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://adarsh.theorphic.space/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html> <!--Generated by Endurance Page Cache-->Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.getasafetynet.com
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://getasafetynet.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://getasafetynet.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://getasafetynet.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.visimony.com
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://visimony.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.endlessdiscoveries.net
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://endlessdiscoveries.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ozq.wvf.mybluehost.me
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://samysbeauty.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:45:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ylz.hgn.mybluehost.me
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hartfeltsolutions.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:45:15 GMT; Max-Age=315360000; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · lightoflovephotography.com
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=utf8 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.faltdyep.com
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://faltdyep.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · casasanpablo.com
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:09 GMT Server: Apache Vary: User-Agent,Accept-Encoding Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 16 Jul 2024 04:53:12 GMT Accept-Ranges: bytes Content-Length: 51130 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: max-age=0, no-cache, no-store, must-revalidate Pragma: no-cache Expires: Mon, 29 Oct 1923 20:30:00 GMT Content-Type: text/html; charset=UTF-8 Page title: Welcome to Casa San Pablo - Casa San Pablo <!DOCTYPE html><html lang="en-US"><head><meta charset="UTF-8"><link rel="profile" href="https://gmpg.org/xfn/11"><meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /><!-- <link media="all" href="https://casasanpablo.com/wp-content/cache/autoptimize/css/autoptimize_7caa9490637ffa33df329a603bb3dd49.css" rel="stylesheet" /> --> <link rel="stylesheet" type="text/css" href="//casasanpablo.com/wp-content/cache/wpfc-minified/mlhhz2mx/1xhom.css" media="all"/><!-- <link media="only screen and (max-width: 768px)" href="https://casasanpablo.com/wp-content/cache/autoptimize/css/autoptimize_541e2ced151704f4ff1844c6de47ec02.css" rel="stylesheet" /> --> <link rel="stylesheet" type="text/css" href="//casasanpablo.com/wp-content/cache/wpfc-minified/q5m2rkyp/68656.css" media="only screen and (max-width: 768px)"/><!-- <link media="(max-width:768px)" href="https://casasanpablo.com/wp-content/cache/autoptimize/css/autoptimize_67beaa95617232ad91cc07e54605489f.css" rel="stylesheet" /> --> <link rel="stylesheet" type="text/css" href="//casasanpablo.com/wp-content/cache/wpfc-minified/kajb9o9w/68656.css" media="(max-width:768px)"/><title>Welcome to Casa San Pablo - Casa San Pablo</title><link rel="canonical" href="https://casasanpablo.com/" /><meta property="og:locale" content="en_US" /><meta property="og:type" content="website" /><meta property="og:title" content="Welcome to Casa San Pablo - Casa San Pablo" /><meta property="og:description" content="Welcome to Casa San Pablo Welcome! We are a friendly and comfortable B&B within easy reach of some of San Pablo City’s many attractions. We like to call ourselves a “house of stories” because we try our best to give ... Read more" /><meta property="og:url" content="https://casasanpablo.com/" /><meta property="og:site_name" content="Casa San Pablo" /><meta property="article:modified_time" content="2023-07-15T04:03:38+00:00" /><meta property="og:image" content="https://casasanpablo.com/wp-content/uploads/2019/11/Gavin-Katrina-Casa-San-Pablo-021.jpg" /><meta property="og:image:width" content="600" /><meta property="og:image:height" content="400" /><meta property="og:image:type" content="image/jpeg" /><meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://casasanpablo.com/","url":"https://casasanpablo.com/","name":"Welcome to Casa San Pablo - Casa San Pablo","isPartOf":{"@id":"https://casasanpablo.com/#website"},"about":{"@id":"https://casasanpablo.com/#organization"},"primaryImageOfPage":{"@id":"https://casasanpablo.com/#primaryimage"},"image":{"@id":"https://casasanpablo.com/#primaryimage"},"thumbnailUrl":"https://casasanpablo.com/wp-content/uploads/2019/11/Gavin-Katrina-Casa-San-Pablo-021.jpg","datePublished":"2019-11-21T06:16:02+00:00","dateModified":"2023-07-15T04:03:38+00:00","breadcrumb":{"@id":"https://casasanpablo.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://casasanpablo.com/"]}]},{"@type":"ImageObject","inLanguage":"en-US","@id":"https://casasanpablo.com/#primaryimage","url":"https://casasanpablo.com/wp-content/uploads/2019/11/Gavin-Katrina-Casa-San-Pablo-021.jpg","contentUrl":"https://casasanpablo.com/wp-content/uploads/2019/11/Gavin-Katrina-Casa-San-Pablo-021.jpg","width":600,"height":400},{"@type":"BreadcrumbList","@id":"https://casasanpablo.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://casasanpablo.com/#website","url":"https://casasanpablo.com/","name":"Casa San Pablo","description":"Your creative break starts here.","publisher":{"@id":"https://casasanpablo.com/#organization"},"potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://casasanpablo.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"},{"@type":"Organization","@id":"https://casasanpablo.com/#organization","namFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.maidinatlantacleaning.com
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.maidinatlantacleaning.com/wp-json/>; rel="https://api.w.org/", <https://www.maidinatlantacleaning.com/wp-json/wp/v2/pages/360>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PciFup-5O>; rel=shortlink Cache-Control: max-age=14400 Expires: Mon, 16 Sep 2024 13:45:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.nbd.upt.mybluehost.me
2024-09-16 09:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:44:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://napa-story.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:44:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.campinglyfe.com
2024-09-16 09:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:44:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://campinglyfe.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://campinglyfe.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://campinglyfe.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · foreverfervent.com
2024-09-16 09:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:44:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ferventforever.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:44:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.casinsure.com
2024-09-16 09:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:44:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://casinsure.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:44:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · cfoofsaas.com
2024-09-16 09:43
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:43:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 230 Location: http://cfoofsaas.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://cfoofsaas.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · mail.opu.nuh.mybluehost.me
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://teentas.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.waqfbaghlafalzafer.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:39 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://waqfbaghlafalzafer.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · mail.zzj.boy.mybluehost.me
2024-09-16 09:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:43:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: hit Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · hry.qhd.mybluehost.me
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Jetpack-Boost-Cache: miss X-LiteSpeed-Tag: 25c_HTTP.200,25c_HTTP.301 X-Redirect-By: WordPress X-LiteSpeed-Cache-Control: no-cache Cache-Control: no-cache, no-store, must-revalidate, max-age=0 Location: https://by-amysue.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.cfoofsaas.com
2024-09-16 09:43
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:43:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 235 Location: https://www.cfoofsaas.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.cfoofsaas.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.drlindaenoh.com
2024-09-16 09:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:43:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://drlindaenoh.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://drlindaenoh.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://drlindaenoh.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.realidadciudadana.com
2024-09-16 09:43
HTTP/1.1 503 Service Temporarily Unavailable Date: Mon, 16 Sep 2024 09:43:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Retry-After: 86400 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache; private Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress Connection: close Transfer-Encoding: chunked Page title: Realidad Ciudadana <!DOCTYPE html> <html lang="es"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <!-- SEO --> <title>Realidad Ciudadana</title><meta name="description" content="Informativo comunitario de Esmeraldas"/> <!-- og meta for facebook, googleplus --> <meta property="og:title" content="Realidad Ciudadana"/> <meta property="og:description" content="Informativo comunitario de Esmeraldas"/> <meta property="og:url" content="https://realidadciudadana.com"/> <meta property="og:type" content="website" /> <meta property="og:image" content="https://realidadciudadana.com/wp-content/uploads/2023/03/Portada-FPRealidadCiudadana-02-1024x576.jpg"/> <!-- twitter meta --> <meta name="twitter:card" content="summary_large_image"/> <meta name="twitter:title" content="Realidad Ciudadana"/> <meta name="twitter:description" content="Informativo comunitario de Esmeraldas"/> <meta name="twitter:url" content="https://realidadciudadana.com"/> <meta name="twitter:image" content="https://realidadciudadana.com/wp-content/uploads/2023/03/Portada-FPRealidadCiudadana-02-1024x576.jpg"/> <link rel="icon" href="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-32x32.png" sizes="32x32" /> <link rel="icon" href="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-192x192.png" sizes="192x192" /> <link rel="apple-touch-icon" href="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-180x180.png" /> <meta name="msapplication-TileImage" content="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-270x270.png" /> <link rel="stylesheet" href="https://realidadciudadana.com/wp-content/plugins/cmp-coming-soon-maintenance/themes/construct/style.css?v=4.1.13" type="text/css" media="all"> <link rel="stylesheet" href="https://realidadciudadana.com/wp-content/plugins/cmp-coming-soon-maintenance/css/animate.min.css"> <link href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/5.14.0/css/all.min.css" rel="stylesheet" > <link href="https://fonts.googleapis.com/css?family=Fjalla+One:700%7CAverage+Sans:400,700,400&subset=latin-ext,latin" rel="stylesheet"> <style> body,input, select, textarea, button {font-family:'Average Sans', 'sans-serif';color:#686868;} input {font-family: Average Sans, 'Font Awesome 5 Free';} body {background-color:#ffffff} a {color:#686868;} h1,h2,h3,h4,h5,h6 {font-family:'Fjalla One', 'sans-serif';} h1,h2,h3,h4,h5,h6,a:hover {color:#f37004;} input[type="email"]:focus {border:1px solid #f37004;} input[type="submit"]{background-color: #f37004;} .social-list a:hover{background:#f37004;} body {font-size:17px;} .section-body p {line-height: 1.6; letter-spacing: 0px;font-weight:400;; } .section-social {background-color: #f8f8f8} h1:not(.text-logo),h2, h3,h4,h5,h6,.text-logo-wrapper {font-size:2.3529411764706em;letter-spacing: 0px; font-weight:700;; } h1 {font-weight:700;;} </style> <style> .wp-video {margin: 0 auto;} .wp-video-shortcode {max-width: 100%;} .grecaptcha-badge {display: none!important;} .text-logo {display: inline-block;} #gdpr-checkbox {-webkit-appearance: checkbox;-moz-appearance: checkbox;width: initial;height: initial;} #counter.expired {display: none; } input, button { box-shadow: inset 0 0 0 0 !important; -webkit-box-shadow: inset 0 0 0 0 !important; -webkit-appearance: none; outline: none; } </style> </head> <body id="body"> <section class="section section-logo"> <div class="logo-wrapper text text-logo-wrapper"><a href="https://realidadciudadana.com" style="text-decoration:none;color:inherit"><h1 class="text-logo">Realidad Ciudadana</h1></a></div> </section> <divFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.eby.wyz.mybluehost.me
2024-09-16 09:43
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:43:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.eby.wyz.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.eby.wyz.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · freedomhealthministries.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://freedomhealthministries.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:47:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.stalledprojects.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:48 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://stalledprojects.com/ Cache-Control: max-age=3600 Expires: Mon, 16 Sep 2024 10:42:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · jzi.rmg.mybluehost.me
2024-09-16 09:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:42:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://jzi.rmg.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jzi.rmg.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jzi.rmg.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · sungmanhk.com
2024-09-16 09:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:42:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: bcb_HTTP.200 Link: <https://sungmanhk.com/wp-json/>; rel="https://api.w.org/", <https://sungmanhk.com/wp-json/wp/v2/pages/2373>; rel="alternate"; title="JSON"; type="application/json", <https://sungmanhk.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.evergreennotebuyer.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://evergreennotebuyer.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.bereant.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bereant.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.insurancebydesign.org
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://insurancebydesign.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.recruitfit.net
2024-09-16 09:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:41:59 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://recruitfit.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · shop.golddiggermercantile.com
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:53 GMT Server: Apache Link: <https://shop.golddiggermercantile.com/wp-json/>; rel="https://api.w.org/", <https://shop.golddiggermercantile.com/wp-json/wp/v2/pages/4388>; rel="alternate"; title="JSON"; type="application/json", <https://shop.golddiggermercantile.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · nanutanu.grm.csp.mybluehost.me
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:41:00 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://nanutanu.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.hhh.bow.mybluehost.me
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://iton.store/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fiton.store%2F; expires=Mon, 14 Oct 2024 09:40:51 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · waqfbaghlafalzafer.com
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:36 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://waqfbaghlafalzafer.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.sungmanhk.com
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: bcb_HTTP.200,bcb_HTTP.301 X-Redirect-By: WordPress Location: https://sungmanhk.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.casinsure.havemedicare.com
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://casinsure.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · gml.feb.mybluehost.me
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://tripsavior.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Vary: User-Agent X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.deweyread.com
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:40:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://deweyread.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://deweyread.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://deweyread.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · jaladmissions.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:00 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.jaladmissions.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.cyr.fgc.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://diamondmemory.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · visiondefenderpro.com
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:40:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fvisiondefenderpro.com%2F; expires=Mon, 14 Oct 2024 09:40:00 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked Page title: Vision Defender Pro — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Vision Defender Pro — Coming Soon</title> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://visiondefenderpro.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://visiondefenderpro.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> <script src="https://visiondefenderpro.com/wp-includes/js/jquery/jquery.js"></script></body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.jqe.lnr.mybluehost.me
2024-09-16 09:39
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:39:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.jqe.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.jqe.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.by-amysue.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Jetpack-Boost-Cache: miss X-LiteSpeed-Tag: 25c_HTTP.200,25c_HTTP.301 X-Redirect-By: WordPress X-LiteSpeed-Cache-Control: no-cache Cache-Control: no-cache, no-store, must-revalidate, max-age=0 Location: https://by-amysue.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.iton.store
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://iton.store/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fiton.store%2F; expires=Mon, 14 Oct 2024 09:39:35 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.qgf.bsd.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://selabuildstx.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ourmoments.au
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Our Moments — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Our Moments — Coming Soon</title> <script src="https://ourmoments.com.au/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ourmoments.com.au/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.5.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ourmoments.com.au/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.waygookincookin.com
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Waygookin Cookin — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Waygookin Cookin — Coming Soon</title> <script src="https://waygookincookin.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://waygookincookin.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://waygookincookin.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.bibarecateringservices.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bibarecateringservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kayeokearny.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://kayeokearny.com/xmlrpc.php X-Redirect-By: WordPress Location: https://kayeokearny.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.theastralmode.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.theastralmode.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.qgf.bsd.mybluehost.me
2024-09-16 09:39
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.cybridtechnology.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cybridtechnology.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_llms_session_a577a37243d0a941e1494ecfc495c34d=4bf2b0e0315d95e6ae24e524a900aab7%7C%7C1726501146%7C%7C1726497546%7C%7C21ef872addf881e856598ef2d81f8693; expires=Mon, 16 Sep 2024 15:39:06 GMT; Max-Age=21600; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.austinb.xyz
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://austinb.xyz/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:44:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Austin Brittain <!DOCTYPE html> <html class="no-js" lang="en-US"> <head> <meta http-equiv="content-type" content="text/html" charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" > <link rel="profile" href="http://gmpg.org/xfn/11"> <title>Austin Brittain</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//austinb.xyz' /> <link rel="alternate" type="application/rss+xml" title="Austin Brittain » Feed" href="https://austinb.xyz/feed/" /> <link rel="alternate" type="application/rss+xml" title="Austin Brittain » Comments Feed" href="https://austinb.xyz/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/austinb.xyz\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); /* ]]> */ </script> <style id='wp-emoji-styles-inline-css' type='text/css'> img.wp-smiley, img.emoji { display: inline !important; border: none !important;Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.eef.rwz.mybluehost.me
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://www.lfnlafricaine.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=18070537e546da5623ba11fc2a0df66b; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.badrabbitpictures.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://badrabbitpictures.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.stockportsilver.org
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://stockportsilver.co.uk/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.vip.adventureinblack.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:56 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 92914 Last-Modified: Fri, 05 Apr 2024 01:30:30 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: Adventure In Black – Members Area <!DOCTYPE html> <!--[if !(IE 6) | !(IE 7) | !(IE 8) ]><!--> <html lang="en-US" class="no-js"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1, user-scalable=0"> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>Adventure In Black – Members Area</title> <meta name='robots' content='max-image-preview:large' /> <link rel='stylesheet' id='learndash_quiz_front_css-css' href='//vip.adventureinblack.com/wp-content/plugins/sfwd-lms/themes/legacy/templates/learndash_quiz_front.min.css?ver=4.10.3' media='all' /> <link rel='stylesheet' id='jquery-dropdown-css-css' href='//vip.adventureinblack.com/wp-content/plugins/sfwd-lms/assets/css/jquery.dropdown.min.css?ver=4.10.3' media='all' /> <link rel='stylesheet' id='learndash_lesson_video-css' href='//vip.adventureinblack.com/wp-content/plugins/sfwd-lms/themes/legacy/templates/learndash_lesson_video.min.css?ver=4.10.3' media='all' /> <link rel='stylesheet' id='learndash-front-css' href='//vip.adventureinblack.com/wp-content/plugins/sfwd-lms/themes/ld30/assets/css/learndash.min.css?ver=4.10.3' media='all' /> <style id='learndash-front-inline-css'> .learndash-wrapper .ld-item-list .ld-item-list-item.ld-is-next, .learndash-wrapper .wpProQuiz_content .wpProQuiz_questionListItem label:focus-within { border-color: #000000; } /* .learndash-wrapper a:not(.ld-button):not(#quiz_continue_link):not(.ld-focus-menu-link):not(.btn-blue):not(#quiz_continue_link):not(.ld-js-register-account):not(#ld-focus-mode-course-heading):not(#btn-join):not(.ld-item-name):not(.ld-table-list-item-preview):not(.ld-lesson-item-preview-heading), */ .learndash-wrapper .ld-breadcrumbs a, .learndash-wrapper .ld-lesson-item.ld-is-current-lesson .ld-lesson-item-preview-heading, .learndash-wrapper .ld-lesson-item.ld-is-current-lesson .ld-lesson-title, .learndash-wrapper .ld-primary-color-hover:hover, .learndash-wrapper .ld-primary-color, .learndash-wrapper .ld-primary-color-hover:hover, .learndash-wrapper .ld-primary-color, .learndash-wrapper .ld-tabs .ld-tabs-navigation .ld-tab.ld-active, .learndash-wrapper .ld-button.ld-button-transparent, .learndash-wrapper .ld-button.ld-button-reverse, .learndash-wrapper .ld-icon-certificate, .learndash-wrapper .ld-login-modal .ld-login-modal-login .ld-modal-heading, #wpProQuiz_user_content a, .learndash-wrapper .ld-item-list .ld-item-list-item a.ld-item-name:hover, .learndash-wrapper .ld-focus-comments__heading-actions .ld-expand-button, .learndash-wrapper .ld-focus-comments__heading a, .learndash-wrapper .ld-focus-comments .comment-respond a, .learndash-wrapper .ld-focus-comment .ld-comment-reply a.comment-reply-link:hover, .learndash-wrapper .ld-expand-button.ld-button-alternate { color: #000000 !important; } .learndash-wrapper .ld-focus-comment.bypostauthor>.ld-comment-wrapper, .learndash-wrapper .ld-focus-comment.role-group_leader>.ld-comment-wrapper, .learndash-wrapper .ld-focus-comment.role-administrator>.ld-comment-wrapper { background-color:rgba(0, 0, 0, 0.03) !important; } .learndash-wrapper .ld-primary-background, .learndash-wrapper .ld-tabs .ld-tabs-navigation .ld-tab.ld-active:after { background: #000000 !important; } .learndash-wrapper .ld-course-navigation .ld-lesson-item.ld-is-current-lesson .ld-status-incomplete, .learndash-wrapper .ld-focus-comment.bypostauthor:not(.ptype-sfwd-assignment) >.ld-comment-wrapper>.ld-comment-avatar img, .learndash-wrapper .ld-focus-comment.role-group_leader>.ld-comment-wrapper>.ld-comment-avatar img, .learndash-wrapper .ld-focus-comment.role-administrator>.ld-comment-wrapper>.ld-comment-avatar img { border-color: #000000 !important; } .learndash-wrapper .ld-loading::before { border-top:3px solid #000000 !important; } .learndash-wrapper .ld-button:hover:not(.learndash-link-previous-incomplete):not(.ld-button-transparent), #learndash-tooltips .ld-tooltip:after, #learndash-tooltips .ld-tooltip, .learndash-wrapper .ld-prFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.jzi.rmg.mybluehost.me
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://jzi.rmg.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jzi.rmg.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jzi.rmg.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.cabaninsurance.havemedicare.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cabaninsurance.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://cabaninsurance.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://cabaninsurance.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.heathergargis.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://heathergargis.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-aad32b03.nagarajfirstdomainname.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:54 GMT Server: Apache Link: <https://nagarajfirstdomainname.com/website_aad32b03/wp-json/>; rel="https://api.w.org/", <https://nagarajfirstdomainname.com/website_aad32b03/wp-json/wp/v2/pages/9>; rel="alternate"; title="JSON"; type="application/json", <https://nagarajfirstdomainname.com/website_aad32b03/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.fromloathingtolove.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: From loathing to love — Coming Soon <!DOCTYPE html> <html lang="en-US" xmlns:og="http://opengraphprotocol.org/schema/" xmlns:fb="http://www.facebook.com/2008/fbml" prefix="og: http://ogp.me/ns# article: http://ogp.me/ns/article#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>From loathing to love — Coming Soon</title> <script src="https://fromloathingtolove.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://fromloathingtolove.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.6.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <div id="subscribe-text"> <p>Be the first to know when we launch, enter your email address and we will let you know when we go live and any future website updates we have.</p> </div> <div id="success" class="status-message"> Thank you, please check your email to confirm your subscription. </div> <div id="error-active" class="status-message"> Your email address is already subscribed to this website. Stay tuned to your inbox for our updates or try a different email address. </div> <div id="error-invalid" class="status-message"> There was an error with your submission and you were not subscribed. Please try again with a valid email address. </div> <form action="" method="post" accept-charset="utf-8" id="subscribe"> <input type="hidden" name="action" value="newfold_coming_soon_subscribe"> <input type="hidden" id="newfold-nonce-coming-soon-subscribe" name="newfold-nonce-coming-soon-subscribe" value="38a3deb8d5" /><input type="hidden" name="_wp_http_referer" value="/" /> <span class="inputs email" id="subscribe-email"> <label id="subscribe-label" for="subscribe-field"> Email </label> <input type="email" name="email" required="required" value="" id="subscribe-field" placeholder="Enter your email address" > </span> <span class="inputs submit" id="subscribe-submit"> <input class="btn" type="submit" value="Subscribe" name="subscriptions_widget"> </span> </form> <script> var ajaxscript = { ajax_url: 'https://fromloathingtolove.com/wp-admin/admin-ajax.php' }; jQuery(document).ready(function ($) { $('#subscribe-submit input').click(function (e) { e.preventDefault(); $('#success').hide(); $('#error').hide(); var email = $('#subscribe-field').val(); var nonce = $('#newfold-nonce-coming-soon-subscribe').val(); $.ajax({ type: 'POST', url: window.ajaxscript.ajax_url, data: { 'action': 'newfold_coming_soon_subscribe', 'emaiFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kwe.tzg.mybluehost.me
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://taiwan-tourbus.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dsv.aca.mybluehost.me
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: CMB Unlimited Solutions — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>CMB Unlimited Solutions — Coming Soon</title> <script src="https://cmbunlimitedsolutions.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cmbunlimitedsolutions.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cmbunlimitedsolutions.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.zenarklogistics.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zenarklogistics.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · peni-ai.leny.ai
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: a5c_HTTP.200,a5c_HTTP.301 X-Redirect-By: WordPress Location: https://peni.ai/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mwai_session_id=66e7fc9d81cfd
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.vjl.mqz.mybluehost.me
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kondangsarana.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.youngbloodinsurance.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://youngbloodinsurance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.justinlichter.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Mon, 16 Sep 2024 09:38:22 GMT Pragma: no-cache Cache-Control: no-cache, must-revalidate, maxage=0 Vary: User-Agent,Accept-Encoding Link: <https://www.justinlichter.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.justinlichter.com/index.php?rest_route=/wp/v2/pages/10>; rel="alternate"; type="application/json", <https://www.justinlichter.com/>; rel=shortlink Last-Modified: Mon, 16 Sep 2024 09:38:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.afghanroyalsaffron.com
2024-09-16 09:38
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:38:09 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · uuw.rbb.mybluehost.me
2024-09-16 09:38
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.alabrepartyrentals.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alabrepartyrentals.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.talladegaritz.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://ritztalladega.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=37558bdf65f3c1ec8d20da075f6fb080; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · rxp.vvo.mybluehost.me
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alshabakairaq.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:37:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.selfgrowzone.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 10:37:41 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://selfgrowzone.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.pregoworld.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://pregoworld.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=d5c119265be50610c5833f58ab1842ca; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.emptyvessels.media
2024-09-16 09:37
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 09:37:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Connection: close Transfer-Encoding: chunked Page title: WordPress › Error <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='max-image-preview:large, noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kayeokearny.notemusings.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://kayeokearny.com/xmlrpc.php X-Redirect-By: WordPress Location: https://kayeokearny.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · hkr.hgn.mybluehost.me
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aliciasharp.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.eddiejoyce.net
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:12 GMT Server: Apache X-Pingback: https://www.eddiejoyce.net/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.eddiejoyce.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · austinb.xyz
2024-09-16 09:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:37:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://austinb.xyz/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:42:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Austin Brittain <!DOCTYPE html> <html class="no-js" lang="en-US"> <head> <meta http-equiv="content-type" content="text/html" charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" > <link rel="profile" href="http://gmpg.org/xfn/11"> <title>Austin Brittain</title> <meta name='robots' content='max-image-preview:large' /> <link rel="alternate" type="application/rss+xml" title="Austin Brittain » Feed" href="https://austinb.xyz/feed/" /> <link rel="alternate" type="application/rss+xml" title="Austin Brittain » Comments Feed" href="https://austinb.xyz/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/austinb.xyz\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); /* ]]> */ </script> <style id='wp-emoji-styles-inline-css' type='text/css'> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !imFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.thd.wxt.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://linkedvaservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ire.nsm.mybluehost.me
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://noriz-tel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:41:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: NorizTel LP – Business Voip <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <meta http-equiv="x-ua-compatible" content="ie=edge"> <title>NorizTel LP – Business Voip</title> <link rel='dns-prefetch' href='//noriz-tel.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Feed" href="https://noriz-tel.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Comments Feed" href="https://noriz-tel.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/noriz-tel.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.26"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='contact-form-7-css' href='https://noriz-tel.com/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.0.4' type='text/css' media='all' /> <link rel='stylesheet' id='dima-take-action-css' href='https://noriz-tel.com/wp-content/plugins/dima-take-action/public/css/dima-take-action-public.css?ver=1.0.5' type='text/css' media='all' /> <link rel='stylesheet' id='rs-plugin-settings-css' href='https://noriz-tel.com/wp-content/plugins/revslider/public/assets/css/settings.css?ver=5.4.8' type='text/css' media='all' /> <style id='rs-plugin-settings-inline-css' type='text/css'> #rs-demo-id {} </style> <link rel='stylesheet' id='woocommerce-layout-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-layout.css?ver=3.4.8' type='text/css' media='all' /> <link rel='stylesheet' id='woocommerce-smallscreen-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-smallscreen.css?ver=3.4.8' type='text/css' media='only screen and (maxFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · babat.site
2024-09-16 09:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:35:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Babat — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Babat — Coming Soon</title> <script src="https://babat.site/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://babat.site/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://babat.site/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · corerenovationgroup.com
2024-09-16 09:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:35:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://corerenovationgroup.com/wp-json/>; rel="https://api.w.org/", <https://corerenovationgroup.com/wp-json/wp/v2/pages/1443>; rel="alternate"; title="JSON"; type="application/json", <https://corerenovationgroup.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.corerenovationgroup.com
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://corerenovationgroup.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.rmrconsult.com
2024-09-16 09:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:35:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <http://www.rmrconsult.com/wp-json/>; rel="https://api.w.org/", <http://www.rmrconsult.com/wp-json/wp/v2/pages/12402>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/P932QG-3e2>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.kie.kao.mybluehost.me
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://troypicturesinc.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · zsk.wvf.mybluehost.me
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://taprootmgmt.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · cotique.media
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cotique.media/wp-json/>; rel="https://api.w.org/", <https://cotique.media/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://cotique.media/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.twx.egj.mybluehost.me
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:11 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://peakvisualsstudios.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:39:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.kathygoodkin.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:46 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://kathygoodkin.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://wp.me/2NeY3>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · leftlegfirst.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:46 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://leftlegfirst.com/wp-json/>; rel="https://api.w.org/", <https://leftlegfirst.com/>; rel=shortlink Vary: Accept-Encoding Set-Cookie: PHPSESSID=b7a70cf7233a2b03624ad8cee29284e2; path=/ Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Student Athlete Fundraiser to Cure LupusLeft Leg First | | Lupus | Facts Symptoms Treatment | We Can Make A Difference Fundraising | May is Lupus Awareness Month | <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html lang="en-US" prefix="og: http://ogp.me/ns#" xmlns="http://www.w3.org/1999/xhtml"> <head profile="http://gmpg.org/xfn/11"> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title>Student Athlete Fundraiser to Cure LupusLeft Leg First | | Lupus | Facts Symptoms Treatment | We Can Make A Difference Fundraising | May is Lupus Awareness Month |</title> <link rel="stylesheet" type="text/css" media="all" href="https://leftlegfirst.com/wp-content/themes/php-ease/css/bp.screen.css" /> <link rel="stylesheet" type="text/css" media="all" href="https://leftlegfirst.com/wp-content/themes/php-ease/css/bp.yui.css" /> <link rel="stylesheet" type="text/css" media="all" href="https://leftlegfirst.com/wp-content/themes/php-ease/style.css" /> <link rel="pingback" href="https://leftlegfirst.com/xmlrpc.php" /> <link rel="stylesheet" type="text/css" media="print" href="https://leftlegfirst.com/wp-content/themes/php-ease/css/bp.print.css" /> <!--[if lt IE 7]><link rel="stylesheet" type="text/css" media="all" href="https://leftlegfirst.com/wp-content/themes/php-ease/css/bp.ie.css" /><![endif]--> <!-- This site is optimized with the Yoast SEO plugin v4.0 - https://yoast.com/wordpress/plugins/seo/ --> <meta name="description" content="Student Athlete fundraising campaign | Fundraising to cure SLE Lupus | Sign-up today and pledge your support towards athletic fundraiser."/> <meta name="robots" content="noodp"/> <link rel="canonical" href="https://leftlegfirst.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Student Athlete Fundraiser to Cure Lupus" /> <meta property="og:description" content="Student Athlete fundraising campaign | Fundraising to cure SLE Lupus | Sign-up today and pledge your support towards athletic fundraiser." /> <meta property="og:url" content="https://leftlegfirst.com/" /> <meta property="og:site_name" content="Left Leg First" /> <meta property="og:image" content="http://69.195.124.63/~leftlegf/wp-content/uploads/2012/10/purple-ribbon-214x300.png" /> <script type='application/ld+json'>{"@context":"http:\/\/schema.org","@type":"WebSite","@id":"#website","url":"https:\/\/leftlegfirst.com\/","name":"Left Leg First","potentialAction":{"@type":"SearchAction","target":"https:\/\/leftlegfirst.com\/?s={search_term_string}","query-input":"required name=search_term_string"}}</script> <script type='application/ld+json'>{"@context":"http:\/\/schema.org","@type":"WebSite","@id":"#website","url":"https:\/\/leftlegfirst.com\/","name":"Left Leg First","potentialAction":{"@type":"SearchAction","target":"https:\/\/leftlegfirst.com\/?s={search_term_string}","query-input":"required name=search_term_string"}}</script> <script type='application/ld+json'>{"@context":"http:\/\/schema.org","@type":"WebSite","@id":"#website","url":"https:\/\/leftlegfirst.com\/","name":"Left Leg First","potentialAction":{"@type":"SearchAction","target":"https:\/\/leftlegfirst.com\/?s={search_term_string}","query-input":"required name=search_term_string"}}</script> <script type='application/ld+json'>{"@context":"http:\/\/schema.org","@type":"WebSite","@id":"#website","url":"https:\/\/leftlegfirst.com\/","name":"Left Leg First","potentialAction":{"@type":"SearchAction","target":"https:\/\/leftlegfirst.com\/?s={search_term_string}","query-input":"required name=search_term_string"}}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Left Leg First » Feed" href="https://leftlegfirst.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Left Leg First » Comments Feed" href="https://leftlegfirst.com/comments/feed/" /> <link rel='https://api.w.org/' href='https://leftlegfirst.com/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://leftlegfirst.com/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.thecedarwoodcottage.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thecedarwoodcottage.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:38:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.avant-gardetech.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:44 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:38:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://box5397.temp.domains/~silvevg9/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5397.temp.domains/~silvevg9/wp-content/plugins/mojo-marketplace-wp-plugin/assets/styles/coming-soon.css?v=3.2.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> Is this your website? Log in to <a href="https://box5397.temp.domains/~silvevg9/wp-login.php">WordPress</a> or <a href="https://www.mojomarketplace.com/login" target="_blank" rel="noopener noreferrer nofollow">MOJO</a>. </p> </footer> </body> </html> <!--Generated by Newfold Page Cache-->Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.pdesigngroup.artecse.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:43 GMT Server: Apache Link: <https://pdesigngroup.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://pdesigngroup.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://pdesigngroup.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:38:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.melfami.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://melfami.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · daraghjgrant.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://daraghjgrant.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · appraisenet.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.appraisenet.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:38:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.saragazarekmusic.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 10:33:12 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://saragazarek.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.outdoorgearsx.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:03 GMT Server: Apache Link: <https://outdoorgearsx.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Outdoor Gears X - Top Rated Outdoor Gear Reviews <!DOCTYPE html> <html lang="en-US"> <head > <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v23.4 - https://yoast.com/wordpress/plugins/seo/ --> <title>Outdoor Gears X - Top Rated Outdoor Gear Reviews</title> <meta name="description" content="Top rated outdoor gear reviews and buyer's guides to help you find the best products in the market." /> <link rel="canonical" href="https://outdoorgearsx.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Outdoor Gears X" /> <meta property="og:description" content="Top rated outdoor gear reviews and buyer's guides to help you find the best products in the market." /> <meta property="og:url" content="https://outdoorgearsx.com/" /> <meta property="og:site_name" content="Outdoor Gears X" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"CollectionPage","@id":"https://outdoorgearsx.com/","url":"https://outdoorgearsx.com/","name":"Outdoor Gears X - Top Rated Outdoor Gear Reviews","isPartOf":{"@id":"https://outdoorgearsx.com/#website"},"description":"Top rated outdoor gear reviews and buyer's guides to help you find the best products in the market.","breadcrumb":{"@id":"https://outdoorgearsx.com/#breadcrumb"},"inLanguage":"en-US"},{"@type":"BreadcrumbList","@id":"https://outdoorgearsx.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://outdoorgearsx.com/#website","url":"https://outdoorgearsx.com/","name":"Outdoor Gears X","description":"","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://outdoorgearsx.com/?s={search_term_string}"},"query-input":{"@type":"PropertyValueSpecification","valueRequired":true,"valueName":"search_term_string"}}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//outdoorgearsx.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//maxcdn.bootstrapcdn.com' /> <link rel="alternate" type="application/rss+xml" title="Outdoor Gears X » Feed" href="https://outdoorgearsx.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Outdoor Gears X » Comments Feed" href="https://outdoorgearsx.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/outdoorgearsx.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.dev.crossfitwaterbury.com
2024-09-16 09:32
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 09:33:00 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · kindreset.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.kindreset.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.buzzpointllc.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:40 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://buzzpointllc.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · justinlichter.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 09:32:43 GMT Pragma: no-cache Cache-Control: no-cache, must-revalidate, maxage=0 Vary: User-Agent X-Redirect-By: WordPress Last-Modified: Mon, 16 Sep 2024 09:32:43 GMT Location: https://www.justinlichter.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.wearecousin.org
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wearecousin.org/index.php?rest_route=/>; rel="https://api.w.org/", <https://wearecousin.org/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://wearecousin.org/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-004ee500.tcc.xjl.mybluehost.me
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:36 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: SaturdayMorningKitchen — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>SaturdayMorningKitchen — Coming Soon</title> <script src="https://tcc.xjl.mybluehost.me/website_004ee500/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tcc.xjl.mybluehost.me/website_004ee500/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tcc.xjl.mybluehost.me/website_004ee500/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · magpieasmartbird.com
2024-09-16 09:32
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:32:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: https://magpieasmartbird.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://magpieasmartbird.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.members.successfactornetwork.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://members.successfactornetwork.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.nbd.upt.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://napa-story.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.amaall.com
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:28 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 31483 Last-Modified: Sun, 28 Jul 2024 06:50:08 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Page title: شركة آمال المحدودة <!DOCTYPE HTML> <html lang="en"> <head> <meta charset="utf-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <title>شركة آمال المحدودة</title> <!-- Favicons --> <link rel="shortcut icon" href="favicon.png"> <link rel="apple-touch-icon" href="apple-touch-icon.png"> <link rel="apple-touch-icon" sizes="72x72" href="apple-touch-icon-72x72.png"> <link rel="apple-touch-icon" sizes="114x114" href="apple-touch-icon-114x114.png"> <!-- Styles --> <link href="https://fonts.googleapis.com/css?family=Oswald:300,400,700" rel="stylesheet"> <link href="https://fonts.googleapis.com/css?family=Montserrat:400,700" rel="stylesheet"> <link href="css/style.css" rel="stylesheet" media="screen"> <link href="css/owl.carousel.min.css" rel="stylesheet" media="screen"> <link href="css/media.css" rel="stylesheet" media="screen"> <!-- Google Tag Manager --> <script>(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start': new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0], j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src= 'https://www.googletagmanager.com/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f); })(window,document,'script','dataLayer','GTM-K5972KW4');</script> <!-- End Google Tag Manager --> </head> <body> <div class="se-pre-con"></div> <!-- Header --> <header id="top" class="header-inner"> <div class="vision2030 js-target-scroll"> <img src="img/saudi vision.svg" alt=""> </div> <div class="brand-panel"> <a href="index.html" class="brand js-target-scroll"> <img src="img/logo.svg" alt=""> </a> </div> <!-- Navigation Desctop --> <nav class="navbar-desctop visible-md visible-lg"> <div class="container"> <a href="index.html" class="brand js-target-scroll"> <img src="img/logo-color.svg" alt=""> </a> <a href="#" class="vision-scrl js-target-scroll"> <img src="img/saudi visiovn.svg" alt=""> </a> <ul class="navbar-desctop-menu"> <li > <a href="index.html">الرئيسية</a> </li> <li > <a href="about.html">من نحن</a> </li> <li> <a href="services.html">الخدمات</a> </li> <li > <a href="#">المشاريع</a> <ul> <li><a href="available-projects.html">المشاريع الحالية</a></li> <li ><a href="completed-projects.html">المشاريع السابقة </a></li> <li><a href="soon-projects.html">المشاريع المستقبلية</a></li> </ul> </li> <li> <a href="news.html">الأخبار</a> </li> <li> <a href="contacts.html">اتصل بنا</a> </li> <li> <a href="soon-projects.html">سجل اهتمامك</a> </li> </ul> </div> </nav> <!-- Navigation Mobile --> <nav class="navbar-mobile"> <a href="#" class="brand js-target-scroll"> <img src="img/logo-color.svg" alt=""> </a> <!-- Navbar Collapse --> <button type="button" class="navbar-toggle collapsed" data-toggle="collapse" data-target="#navbar-mobile"> <span class="sr-only">Toggle navigation</span> <span class="icon-bar"></span> <span class="icon-bar"></span> <span class="icon-bar"></span> </button> <div class="collapse navbar-collapse" id="navbar-mobile"> <ul class="navbar-nav-mobile"> <li > <a href="index.html">الرئيسية </a>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · habitationsequilibre.com
2024-09-16 09:32
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:32:15 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: equi-libreconstruction.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>equi-libreconstruction.com — Coming Soon</title> <script src="https://nzm.wlu.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nzm.wlu.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nzm.wlu.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.toddschaap.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://toddschaap.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.projectbulgingbelly.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://projectbulgingbelly.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.thedeeprootsapothecary.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.thedeeprootsapothecary.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.wfj.zzh.mybluehost.me
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wfj.zzh.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.closeupedition.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://closeupedition.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · walleyewoodfloors.com
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://walleyewoodfloors.com/wp-json/>; rel="https://api.w.org/", <https://walleyewoodfloors.com/wp-json/wp/v2/pages/14>; rel="alternate"; title="JSON"; type="application/json", <https://walleyewoodfloors.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:36:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.premiumbeveragespdx.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://premiumbeveragespdx.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:36:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.marilynnutter.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marilynnutter.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · bloomnbroom.com
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bloomnbroom.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.phj.edd.mybluehost.me
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://verbiks.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.cih.efs.mybluehost.me
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Rigby Russell — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Rigby Russell — Coming Soon</title> <script src="https://rigbyrussell.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rigbyrussell.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rigbyrussell.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · insuranceshoppe.me
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://insuranceshoppe.me/index.php?rest_route=/>; rel="https://api.w.org/", <https://insuranceshoppe.me/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://insuranceshoppe.me/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · thd.wxt.mybluehost.me
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://linkedvaservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.knightwatchpublishing.sirchase.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:08 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.knightwatchpublishing.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.mvb.zzh.mybluehost.me
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://purplehippotravels.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.fbs.bzx.mybluehost.me
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cassenergyhealer.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.drowsymind.com
2024-09-16 09:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:30:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://drowsymind.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · thebrothersreed.com
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:21 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: accept,content-type X-Redirect-By: WordPress Set-Cookie: PHPSESSID=44c1dd274ec34b0b7c07631bac0deb43; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.thebrothersreed.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.astekdev.com
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://website-2a49a058.xsk.nqg.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · assuredag.com
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:26 GMT Server: Apache Link: <https://assuredag.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://assuredag.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://assuredag.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.timshels.com
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:15 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=1 Expires: Mon, 16 Sep 2024 09:29:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://timshels.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://timshels.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://timshels.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · angiebuyshouses.com
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://angiebuyshouses.com/wp-json/>; rel="https://api.w.org/", <https://angiebuyshouses.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://angiebuyshouses.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.vhu.vgn.mybluehost.me
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bibarecateringservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.pupsandprosecco.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://pupsandprosecco.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-ec847a65.tcc.xjl.mybluehost.me
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:42 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Attitude — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Attitude — Coming Soon</title> <script src="https://tcc.xjl.mybluehost.me/website_ec847a65/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tcc.xjl.mybluehost.me/website_ec847a65/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tcc.xjl.mybluehost.me/website_ec847a65/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.dai.noo.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://investirbien.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.thechesspage.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thechesspage.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.bloomnbroom.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bloomnbroom.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.opu.nuh.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://teentas.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-a87fbc10.grm.csp.mybluehost.me
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: zona0.mx — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>zona0.mx — Coming Soon</title> <script src="https://zona0.mx/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://zona0.mx/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://zona0.mx/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.treonabateman.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:18 GMT Server: Apache X-Pingback: https://treonabateman.com/xmlrpc.php Upgrade: h2,h2c Connection: Upgrade, close Location: https://treonabateman.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.nox.sjd.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nox.sjd.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.aad.dei.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bereant.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · myprojecttutor.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://myprojecttutor.com/wp-json/>; rel="https://api.w.org/", <https://myprojecttutor.com/wp-json/wp/v2/pages/7>; rel="alternate"; title="JSON"; type="application/json", <https://myprojecttutor.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · gkmhs.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://gkmhs.com/wp-json/>; rel="https://api.w.org/", <https://gkmhs.com/wp-json/wp/v2/pages/88>; rel="alternate"; title="JSON"; type="application/json", <https://gkmhs.com/>; rel=shortlink Server-Timing: wp-before-template;dur=4196.57 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Vary: Accept-Encoding Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.makeupbycherise.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:10 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: twp_session=733a87294ca1a7569e730b27dea362e1%7C%7C1726480691%7C%7C1726480331; expires=Mon, 16-Sep-2024 09:58:11 GMT; Max-Age=1800; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://makeupbycherise.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.cgi.cno.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://culturestrategy.io/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · wyy.dst.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://preppinglittles.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:28:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: configurations=%20
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · freedomhealthministries.revelationrevealedtoday.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://freedomhealthministries.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:32:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.noriz-tel.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://noriz-tel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:32:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: NorizTel LP – Business Voip <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <meta http-equiv="x-ua-compatible" content="ie=edge"> <title>NorizTel LP – Business Voip</title> <link rel='dns-prefetch' href='//noriz-tel.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Feed" href="https://noriz-tel.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Comments Feed" href="https://noriz-tel.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/noriz-tel.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.26"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='contact-form-7-css' href='https://noriz-tel.com/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.0.4' type='text/css' media='all' /> <link rel='stylesheet' id='dima-take-action-css' href='https://noriz-tel.com/wp-content/plugins/dima-take-action/public/css/dima-take-action-public.css?ver=1.0.5' type='text/css' media='all' /> <link rel='stylesheet' id='rs-plugin-settings-css' href='https://noriz-tel.com/wp-content/plugins/revslider/public/assets/css/settings.css?ver=5.4.8' type='text/css' media='all' /> <style id='rs-plugin-settings-inline-css' type='text/css'> #rs-demo-id {} </style> <link rel='stylesheet' id='woocommerce-layout-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-layout.css?ver=3.4.8' type='text/css' media='all' /> <link rel='stylesheet' id='woocommerce-smallscreen-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-smallscreen.css?ver=3.4.8' type='text/css' media='only screen and (maxFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.visiondefenderpro.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://visiondefenderpro.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fvisiondefenderpro.com%2F; expires=Mon, 14 Oct 2024 09:27:48 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.heisong.org
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://heisong.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.visiondefenderpro.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://visiondefenderpro.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fvisiondefenderpro.com%2F; expires=Mon, 14 Oct 2024 09:27:44 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.beddingbathreview.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:36 GMT Server: Apache Link: <https://beddingbathreview.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Bedding Bath Review - Top Rated Bedding and Bath Product Reviews <!DOCTYPE html> <html lang="en-US"> <head > <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Bedding Bath Review - Top Rated Bedding and Bath Product Reviews</title> <meta name="description" content="Top rated bedding and bath product reviews and buyer's guides to help you find the best products in the market." /> <link rel="canonical" href="https://beddingbathreview.com/" /> <link rel="next" href="https://beddingbathreview.com/page/2/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Bedding Bath Review" /> <meta property="og:description" content="Top rated bedding and bath product reviews and buyer's guides to help you find the best products in the market." /> <meta property="og:url" content="https://beddingbathreview.com/" /> <meta property="og:site_name" content="Bedding Bath Review" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"CollectionPage","@id":"https://beddingbathreview.com/","url":"https://beddingbathreview.com/","name":"Bedding Bath Review - Top Rated Bedding and Bath Product Reviews","isPartOf":{"@id":"https://beddingbathreview.com/#website"},"description":"Top rated bedding and bath product reviews and buyer's guides to help you find the best products in the market.","breadcrumb":{"@id":"https://beddingbathreview.com/#breadcrumb"},"inLanguage":"en-US"},{"@type":"BreadcrumbList","@id":"https://beddingbathreview.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://beddingbathreview.com/#website","url":"https://beddingbathreview.com/","name":"Bedding Bath Review","description":"","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://beddingbathreview.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//beddingbathreview.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//maxcdn.bootstrapcdn.com' /> <link rel="alternate" type="application/rss+xml" title="Bedding Bath Review » Feed" href="https://beddingbathreview.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Bedding Bath Review » Comments Feed" href="https://beddingbathreview.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/beddingbathreview.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udbFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.vjl.mqz.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kondangsarana.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.endurancephysio.ca
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://endurancephysio.ca/xmlrpc.php X-Redirect-By: WordPress Location: https://endurancephysio.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.insuranceladyusa.havemedicare.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://insuranceladyusa.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://insuranceladyusa.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://insuranceladyusa.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · getasafetynet.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://getasafetynet.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://getasafetynet.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://getasafetynet.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.floydvincent.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://floydvincent.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.foreignautospa.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://foreignautospa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.xqq.sco.mybluehost.me
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://adonebbbm.store/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 1 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:26:39 GMT; Max-Age=315360000; path=/ Set-Cookie: wp_llms_session_c5a9ef501e000fb40143c7b1d059da40=3df909c019160b7e1e4efa926155f19c%7C%7C1726500401%7C%7C1726496801%7C%7C425b959784cbf8f9870ce223f922c96e; expires=Mon, 16 Sep 2024 15:26:41 GMT; Max-Age=21600; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.res.oea.mybluehost.me
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://stillnavigating.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ableproductsusa.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ableproductsusa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.tanarosxm.com
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:13 GMT Server: Apache Link: <https://www.tanarosxm.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.tanarosxm.com/index.php?rest_route=/wp/v2/pages/4548>; rel="alternate"; type="application/json", <https://www.tanarosxm.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · fromanotherrealm.marklake.org
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding,User-Agent Link: <https://fromanotherrealm.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/aDIUW>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:31:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.diamondmemory.net
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://diamondmemory.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.fds.lgu.mybluehost.me
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gowomenbeyondborders.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.jnq.ytr.mybluehost.me
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://wholesumwoman.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://wholesumwoman.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://wholesumwoman.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · therestlessrunaway.com
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://therestlessrunaway.com/wp-json/>; rel="https://api.w.org/", <https://therestlessrunaway.com/wp-json/wp/v2/pages/9>; rel="alternate"; type="application/json", <https://therestlessrunaway.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-b519884b.cyb.xjy.mybluehost.me
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.beyondmedicinepr.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.stephanierupp.net
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:01 GMT Server: Apache Link: <https://www.stephanierupp.net/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: My Blog | Just another WordPress site <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <title>My Blog | Just another WordPress site</title> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.stephanierupp.net/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.stephanierupp.net/wp-content/themes/twentyfourteen/js/html5.js"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="My Blog » Feed" href="https://www.stephanierupp.net/feed/" /> <link rel="alternate" type="application/rss+xml" title="My Blog » Comments Feed" href="https://www.stephanierupp.net/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.stephanierupp.net\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.dxs.oui.mybluehost.me
2024-09-16 09:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:00 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://xwatchshop.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · wcy.sgz.mybluehost.me
2024-09-16 09:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://luxartists.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.thesmarthomeninja.com
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:53 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 09:24:54 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://thesmarthomeninja.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thesmarthomeninja.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thesmarthomeninja.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · asx.lll.mybluehost.me
2024-09-16 09:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:24:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://avanttechgroup.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=82c7d8994230d489d873a21a3e004672; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.yvm.wid.mybluehost.me
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:35 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://edithmayhall.co.uk/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · gym-ergy.com
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://gym-ergy.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://gym-ergy.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://gym-ergy.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · leny.ai
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:23 GMT Server: Apache Link: <https://leny.ai/wp-json/>; rel="https://api.w.org/", <https://leny.ai/wp-json/wp/v2/pages/4740>; rel="alternate"; title="JSON"; type="application/json", <https://leny.ai/>; rel=shortlink Set-Cookie: mwai_session_id=66e7f9478202c Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · divinecaregroup.com.au
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://divinecaregroup.com.au/wp-json/>; rel="https://api.w.org/", <https://divinecaregroup.com.au/wp-json/wp/v2/pages/22>; rel="alternate"; title="JSON"; type="application/json", <https://divinecaregroup.com.au/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.warteg.xyz
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:53 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://warteg.xyz/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://warteg.xyz/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://warteg.xyz/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.pilothouseagency.myhoneylist.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:53 GMT Server: Apache X-Pingback: https://pilothouseagency.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://pilothouseagency.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.babat.site
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://babat.site/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.fbi.yvm.mybluehost.me
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=3aae2fe41c0d9e752404b57cf7dd36c9; path=/ set-cookie: __cf_bm=DNP3bb0lorGcflR8HtgqDuPGSVFen46x7FCoZ2mkvjs-1726478608-1.0.1.1-umiO_DKmB0_aoqiSKuPO49W0caTWkw0gGRiYFRK7QWqKpwPdQg_C8aGvRfEWQbpbEvNH21_mOm9DdDjao_6A_cs5tAZHexejwo81vLjr9WU; path=/; expires=Mon, 16-Sep-24 09:53:28 GMT; domain=.clickfunnels.com; HttpOnly; Secure set-cookie: _cfuvid=owQg0HP1pgdJ8NfD9w7NVY0Vc4WLXIoW5ee8rNBMJD4-1726478608527-0.0.1.1-604800000; path=/; domain=.clickfunnels.com; HttpOnly; Secure; SameSite=None Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.yvm.wid.mybluehost.me
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:16 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://edithmayhall.co.uk/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · wwallianceforthehomeless.org
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:27 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: accept,content-type X-Pingback: https://www.wwallianceforthehomeless.com/xmlrpc.php X-Redirect-By: WordPress Set-Cookie: PHPSESSID=d7a79e775b70cdefa14165c1b318ab9e; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.wwallianceforthehomeless.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.rooseveltptg.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:10 GMT Server: Apache X-Pingback: https://legacy.rooseveltptg.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://legacy.rooseveltptg.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.wwallianceforthehomeless.org
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:58 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: accept,content-type X-Pingback: https://www.wwallianceforthehomeless.com/xmlrpc.php X-Redirect-By: WordPress Set-Cookie: PHPSESSID=4a6c32059d670a7a57eb9eadfd2a72e2; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.wwallianceforthehomeless.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.nag.zca.mybluehost.me
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://heisong.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.trustandcorp.com
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trustandcorp.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · cochranfirmchicago.courtneysimone.com
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cochranfirmchicago.courtneysimone.com/wp-json/>; rel="https://api.w.org/", <https://cochranfirmchicago.courtneysimone.com/wp-json/wp/v2/pages/2039>; rel="alternate"; title="JSON"; type="application/json", <https://cochranfirmchicago.courtneysimone.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:27:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.macris360.com
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:19 GMT Server: Apache Link: <https://www.macris360.com/wp-json/>; rel="https://api.w.org/", <https://www.macris360.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Nicholas Macris – Elite Level Hockey Player <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://macris360.com/xmlrpc.php" /> <title>Nicholas Macris – Elite Level Hockey Player</title> <link rel='dns-prefetch' href='//macris360.com' /> <link rel='dns-prefetch' href='//vjs.zencdn.net' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Nicholas Macris » Feed" href="https://www.macris360.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Nicholas Macris » Comments Feed" href="https://www.macris360.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/macris360.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.7.29"}}; !function(t,a,e){var r,n,i,o=a.createElement("canvas"),l=o.getContext&&o.getContext("2d");function c(t){var e=a.createElement("script");e.src=t,e.defer=e.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(e)}for(i=Array("flag","emoji4"),e.supports={everything:!0,everythingExceptFlag:!0},n=0;n<i.length;n++)e.supports[i[n]]=function(t){var e,a=String.fromCharCode;if(!l||!l.fillText)return!1;switch(l.clearRect(0,0,o.width,o.height),l.textBaseline="top",l.font="600 32px Arial",t){case"flag":return(l.fillText(a(55356,56826,55356,56819),0,0),o.toDataURL().length<3e3)?!1:(l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,65039,8205,55356,57096),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,55356,57096),0,0),e!==o.toDataURL());case"emoji4":return l.fillText(a(55357,56425,55356,57341,8205,55357,56507),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55357,56425,55356,57341,55357,56507),0,0),e!==o.toDataURL()}return!1}(i[n]),e.supports.everything=e.supports.everything&&e.supports[i[n]],"flag"!==i[n]&&(e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&e.supports[i[n]]);e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&!e.supports.flag,e.DOMReady=!1,e.readyCallback=function(){e.DOMReady=!0},e.supports.everything||(r=function(){e.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",r,!1),t.addEventListener("load",r,!1)):(t.attachEvent("onload",r),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&e.readyCallback()})),(r=e.source||{}).concatemoji?c(r.concatemoji):r.wpemoji&&r.twemoji&&(c(r.twemoji),c(r.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='siteorigin-panels-front-css' href='https://macris360.com/wp-content/plugins/siteorigin-panels/css/front.css?ver=2.4.20' type='text/css' media='all' /> <link rel='stylesheet' id='slideshow-jquery-image-gallery-stylesheet_functional-css' href='https://macris360.com/wp-content/plugins/slideshow-jquery-image-gallery/style/SlideshowPlugin/functional.css?ver=2.3.1' type='text/css' media='all' /> <link rel='stylesheet' id='slideshow-jquery-image-gallery-ajax-stylesheet_style-light-css' href='https://macris360.com/wp-admin/admin-ajax.php?action=slideshow_jquery_image_gallery_load_stylesheet&style=style-light&ver=2.3.1' type='text/css' media='all' /> <link rel='stylesheet' id='slideshow-jquery-image-gallery-ajax-stylesheet_style-dark-css' href='https://macris360.com/wp-admin/admin-ajax.php?action=slideshow_jquery_image_gallery_load_stylesheet&style=style-dark&ver=2.3.1' type='Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.muy-i.v0985004622.com
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.muy-i.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== content-Security-Policy: upgrade-insecure-requests X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.ueg.eln.mybluehost.me
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://helpfulmba.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · opu.nuh.mybluehost.me
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://teentas.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · nasugbutransportcorp.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:34 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Fri, 09 Aug 2024 02:01:58 GMT Accept-Ranges: bytes Content-Length: 20103 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: NATC <!DOCTYPE html> <html lang="zxx" class="no-js"> <head> <!-- Mobile Specific Meta --> <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no"> <!-- Favicon--> <link rel="shortcut icon" href="img/favicon.ico"> <!-- Author Meta --> <meta name="author" content="colorlib"> <!-- Meta Description --> <meta name="description" content=""> <!-- Meta Keyword --> <meta name="keywords" content=""> <!-- meta character set --> <meta charset="UTF-8"> <!-- Site Title --> <title>NATC</title> <link href="https://fonts.googleapis.com/css?family=Poppins:100,200,400,300,500,600,700" rel="stylesheet"> <!-- CSS ============================================= --> <link rel="stylesheet" href="css/linearicons.css"> <link rel="stylesheet" href="css/font-awesome.min.css"> <link rel="stylesheet" href="css/bootstrap.css"> <link rel="stylesheet" href="css/magnific-popup.css"> <link rel="stylesheet" href="css/nice-select.css"> <link rel="stylesheet" href="css/animate.min.css"> <link rel="stylesheet" href="css/jquery-ui.css"> <link rel="stylesheet" href="css/main.css"> <style> .select{ height:100px; overflow:scroll; } </style> </head> <body> <header id="header"> <div class="header-top"> </div> <div class="container main-menu"> <div class="row align-items-center justify-content-between d-flex"> <a href="index.html"><img src="img/logo.png" alt="" title="" /></a> <nav id="nav-menu-container"> <ul class="nav-menu"> <li class="menu-active"><a href="index.html">Home</a></li> <li><a href="about.html">About</a></li> <li><a href="rates.php">Rates</a></li> <li><a href="tracking.html">Tracking</a></li> <!--<li><a href="service.html">Services</a></li>--> <!--<li><a href="gallery.html">Gallery</a></li>--> <!--<li class="menu-has-children"><a href="">Blog</a>--> <!--<ul>--> <!--<li><a href="blog-home.html">Blog Home</a></li>--> <!--<li><a href="blog-single.html">Blog Single</a></li>--> <!--<li class="menu-has-children"><a href="">Level 2</a>--> <!--<ul>--> <!--<li><a href="#">Item One</a></li>--> <!--<li><a href="#">Item Two</a></li>--> <!--</ul>--> <!--</li> --> <!--</ul>--> <!--</li>--> <!--<li><a href="elements.html">Elements</a></li> --> <li><a href="contact.html">Contact</a></li> </ul> </nav><!-- #nav-menu-container --> </div> </div> </header><!-- #header --> <!-- start banner Area --> <section class="banner-area relative" id="home"> <div class="overlay overlay-bg"></div> <div class="container"> <div class="row fullscreen d-flex align-items-center justify-content-between"> <div class="banner-content col-lg-6 col-md-6"> <h4 class="text-white ">Do you need Airport Taxi?</h4> <div class=""> <h1 class="text-uppercase"> BOOK NOW! <br/> <small><a class="btn btn-success" href="https://nasugbutransportcorp.com/natransco.apk">Download App Here!</a></small> </h1> </div> </div> <div class="col-lg-4 col-md-6 header-right" style="background: #bde6e2 !important;"> <img src="img/natclogo.png" class="img-fluid" alt="" width="150"/> <br/> <br/> <h4 class="pb-30">Airport Transport Online!</h4> <form class="form" method="post" action="booking.php"> <div class="from-group"> <input class="form-control txt-field" required type="text" name="name" placeholder="Your name" oFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.type1travels.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://type1travels.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/aiUhl>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:26:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.otm.bgd.mybluehost.me
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://otm.bgd.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kelley-bean.com
2024-09-16 09:21
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:21:17 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.groovecity7.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Pingback: https://www.groovecity7.com/xmlrpc.php Link: <https://www.groovecity7.com/wp-json/>; rel="https://api.w.org/", <https://www.groovecity7.com/wp-json/wp/v2/pages/295>; rel="alternate"; title="JSON"; type="application/json", <https://www.groovecity7.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.archaeologypod.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://archaeologypod.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:26:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.markwag.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:15 GMT Server: Apache X-Pingback: https://www.markwag.com/xmlrpc.php Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=7c2d350e420fa490f6d9a646521d9f15; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.markwag.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · imericlee.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:14 GMT Server: Apache X-Pingback: https://imericlee.com/xmlrpc.php Link: <https://imericlee.com/wp-json/>; rel="https://api.w.org/", <https://imericlee.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.preppinglittles.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://preppinglittles.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:21:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: configurations=%20
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · istrumpalive.babeslay.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://istrumpalive.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://istrumpalive.com/index.php?rest_route=/wp/v2/pages/15>; rel="alternate"; type="application/json", <https://istrumpalive.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:25:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · convenientaccounting.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-cache WPO-Cache-Status: cached Last-Modified: Sun, 15 Sep 2024 18:40:39 GMT Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · hth.hzw.mybluehost.me
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Retry-After: 86400 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: bLEOz - Our name is the promise of standard and quality. is under construction <title>bLEOz - Our name is the promise of standard and quality. is under construction</title> <link rel="stylesheet" href="https://fonts.bunny.net/css?family=Roboto:400,900"> <link rel="stylesheet" href="https://bleoz.com/wp-content/plugins/under-construction-page/themes/css/bootstrap.min.css?v=3.97" type="text/css"> <link rel="stylesheet" href="https://bleoz.com/wp-content/plugins/under-construction-page/themes/css/common.css?v=3.97" type="text/css"> <link rel="stylesheet" href="https://bleoz.com/wp-content/plugins/under-construction-page/themes/mad_designer/style.css?v=3.97" type="text/css"> <link rel="stylesheet" href="https://bleoz.com/wp-content/plugins/under-construction-page/themes/css/font-awesome.min.css?v=3.97" type="text/css"> <link rel="icon" href="https://bleoz.com/wp-content/plugins/under-construction-page/themes/images/favicon.png" /> <div id="hero-image"> <img src="https://bleoz.com/wp-content/plugins/under-construction-page/themes/mad_designer/mad-designer.png" alt="Mad Designer at work" title="Mad Designer at work"> </div> <div class="container"> <div class="row"> <div class="col-xs-12 col-md-12 col-lg-12"> <h1>Sorry, we're doing some work on the site</h1> </div> </div> <div class="row"> <div class="col-xs-12 col-md-8 col-md-offset-2 col-lg-offset-2 col-lg-8"> <p class="content">Thank you for being patient. We are doing some work on the site and will be back shortly.</p> </div> </div> <div class="row" id="social"> <div class="col-xs-12 col-md-12 col-lg-12"> </div> </div> </div> <div id="login-button" class="loggedout"><a href="https://bleoz.com/wp-login.php"><i class="fa fa-wordpress fa-2x" aria-hidden="true"></i></a></div>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.leny.ai
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:46 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: mwai_session_id=66e7f86eddf5e Upgrade: h2,h2c Connection: Upgrade, close Location: https://leny.ai/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · drstenhq.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://drstenhq.com/wp-json/>; rel="https://api.w.org/", <https://drstenhq.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://drstenhq.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:25:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Dr. Sten – Staff Scientist at STScI (COS) <!DOCTYPE html> <html lang="en-US" class="no-js"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <script>(function(html){html.className = html.className.replace(/\bno-js\b/,'js')})(document.documentElement);</script> <title>Dr. Sten – Staff Scientist at STScI (COS)</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Dr. Sten » Feed" href="https://drstenhq.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Dr. Sten » Comments Feed" href="https://drstenhq.com/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v9.0.1 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No tracking code set --> <!-- / Google Analytics by MonsterInsights --> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/drstenhq.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.eFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · coffieldfamilyusa.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://coffieldfamilyusa.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://coffieldfamilyusa.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://coffieldfamilyusa.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.neuenschwandermusicstudio.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:22 GMT Server: Apache Expires: Mon, 16 Sep 2024 10:20:23 GMT Cache-Control: max-age=3600 X-Redirect-By: redirection Upgrade: h2,h2c Connection: Upgrade, close Location: https://mycreativepiano.com host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.coffieldfamilyusa.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://coffieldfamilyusa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.eileendrapizapsychotherapy.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eileendrapizapsychotherapy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · metafifa.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:06 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.metafifa.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:25:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · glenvilleliving-com-au.m10truss.com.au
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:02 GMT Server: Apache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://glenvilleliving.com.au/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · poctechnology.com
2024-09-16 09:19
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 09:19:47 GMT Server: Apache X-Pingback: https://poctechnology.com/xmlrpc.php Link: <https://poctechnology.com/wp-json/>; rel="https://api.w.org/", <https://poctechnology.com/wp-json/wp/v2/pages/453>; rel="alternate"; title="JSON"; type="application/json", <https://poctechnology.com/>; rel=shortlink Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: WordPress › Error <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <title></title> <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='max-image-preview:large, noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kan.xeh.mybluehost.me
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://foreignautospa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.laststory-claims.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://laststory-claims.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.overseasjo.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://overseasjo.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · lyfit.life
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding P3P: CP="ALL DSP NID CURa ADMa DEVa HISa OTPa OUR NOR NAV DEM" Link: <https://lyfit.life/wp-json/>; rel="https://api.w.org/", <https://lyfit.life/wp-json/wp/v2/pages/3646>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PbNQjJ-WO>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://lyfit.life/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://lyfit.life Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.ginathetc.com
2024-09-16 09:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:18:58 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ginathetc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-2fb1a1cb.irz.zga.mybluehost.me
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:18:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:18:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Our Moments — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Our Moments — Coming Soon</title> <script src="https://ourmoments.com.au/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ourmoments.com.au/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.5.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ourmoments.com.au/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dev.marcbelnick.com
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:18:28 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:18:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 <br /> <b>Deprecated</b>: Function create_function() is deprecated in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/master-slider/includes/classes/class-msp-main-widget.php</b> on line <b>95</b><br /> <br /> <b>Deprecated</b>: Array and string offset access syntax with curly braces is deprecated in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/woocommerce/includes/wc-formatting-functions.php</b> on line <b>511</b><br /> <br /> <b>Deprecated</b>: Array and string offset access syntax with curly braces is deprecated in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/woocommerce/includes/wc-formatting-functions.php</b> on line <b>511</b><br /> <br /> <b>Deprecated</b>: Array and string offset access syntax with curly braces is deprecated in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/woocommerce/includes/wc-formatting-functions.php</b> on line <b>512</b><br /> <br /> <b>Deprecated</b>: Array and string offset access syntax with curly braces is deprecated in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/woocommerce/includes/wc-formatting-functions.php</b> on line <b>512</b><br /> <br /> <b>Deprecated</b>: Array and string offset access syntax with curly braces is deprecated in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/woocommerce/includes/wc-formatting-functions.php</b> on line <b>513</b><br /> <br /> <b>Deprecated</b>: Array and string offset access syntax with curly braces is deprecated in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/woocommerce/includes/wc-formatting-functions.php</b> on line <b>513</b><br /> <br /> <b>Deprecated</b>: Unparenthesized `a ? b : c ? d : e` is deprecated. Use either `(a ? b : c) ? d : e` or `a ? b : (c ? d : e)` in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/js_composer/include/classes/editors/class-vc-frontend-editor.php</b> on line <b>640</b><br /> <br /> <b>Deprecated</b>: The each() function is deprecated. This message will be suppressed on further calls in <b>/home1/marcbeln/public_html/dev/wp-content/plugins/js_composer/include/classes/core/class-vc-mapper.php</b> on line <b>72</b><br /> <br /> <b>Warning</b>: Cannot modify header information - headers already sent by (output started at /home1/marcbeln/public_html/dev/wp-content/plugins/master-slider/includes/classes/class-msp-main-widget.php:95) in <b>/home1/marcbeln/public_html/dev/wp-includes/pluggable.php</b> on line <b>1435</b><br /> <br /> <b>Warning</b>: Cannot modify header information - headers already sent by (output started at /home1/marcbeln/public_html/dev/wp-content/plugins/master-slider/includes/classes/class-msp-main-widget.php:95) in <b>/home1/marcbeln/public_html/dev/wp-includes/pluggable.php</b> on line <b>1438</b><br />
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.neuenschwandermusicstudio.mycreativepiano.com
2024-09-16 09:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:54 GMT Server: Apache Expires: Mon, 16 Sep 2024 10:17:56 GMT Cache-Control: max-age=3600 X-Redirect-By: redirection Upgrade: h2,h2c Connection: Upgrade, close Location: https://mycreativepiano.com host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · xcj.cul.mybluehost.me
2024-09-16 09:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://usaworldchampionships.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:17:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.byc.dvw.mybluehost.me
2024-09-16 09:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.theastralmode.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:17:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.auntbsgiftshop.com
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://auntbsgiftshop.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:17:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.tanarosxm.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:56 GMT Server: Apache Link: <https://www.tanarosxm.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.tanarosxm.com/index.php?rest_route=/wp/v2/pages/4548>; rel="alternate"; type="application/json", <https://www.tanarosxm.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · kelley-bean.com
2024-09-16 09:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:16:55 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.secretpicnicbox.com
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:16:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://secretpicnicbox.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · xsk.nqg.mybluehost.me
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://xsk.nqg.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · drowsymind.com
2024-09-16 09:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:15:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://drowsymind.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:15:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.ccr.dfq.mybluehost.me
2024-09-16 09:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:15:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://immunologicpro.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:15:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pmpro_visit=1; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.xsk.nqg.mybluehost.me
2024-09-16 09:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:15:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://xsk.nqg.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:15:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.drinkwicks.com
2024-09-16 09:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:14:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://drinkwicks.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:19:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_woocommerce_session_aad11c029d0c61bab35a23341d538da1=50d331acc7c3aa302d16fcbba1e868ec%7C%7C1726650862%7C%7C1726647262%7C%7Cecc06ebdb21bb4be37564043b0af8c97; expires=Wed, 18-Sep-2024 09:14:22 GMT; Max-Age=172800; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · nostophical.portal.mdatac.com
2024-09-16 09:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:13:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:18:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Nostophical — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Nostophical — Coming Soon</title> <script src="https://nostophical.portal.mdatac.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nostophical.portal.mdatac.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nostophical.portal.mdatac.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · chubbthoughts.com
2024-09-16 09:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:12:31 GMT Server: Apache Link: <https://chubbthoughts.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://chubbthoughts.com/index.php?rest_route=/wp/v2/pages/28>; rel="alternate"; title="JSON"; type="application/json", <https://chubbthoughts.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:17:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · insuranceladyusa.havemedicare.com
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:11:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://insuranceladyusa.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://insuranceladyusa.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://insuranceladyusa.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · fashionbyfa.com
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:11:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:11:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://jwf.zzh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jwf.zzh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jwf.zzh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.lafrancerochelle.com
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:11:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lafrancerochelle.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:11:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.insurancebydesign.org
2024-09-16 09:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:10:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://insurancebydesign.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · imagesofvermont.net
2024-09-16 09:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:09:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://imagesofvermont.net/wp-json/>; rel="https://api.w.org/", <https://imagesofvermont.net/wp-json/wp/v2/pages/7811>; rel="alternate"; title="JSON"; type="application/json", <https://imagesofvermont.net/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:14:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.habitationsequilibre.com
2024-09-16 09:09
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:09:26 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: equi-libreconstruction.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>equi-libreconstruction.com — Coming Soon</title> <script src="https://nzm.wlu.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nzm.wlu.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nzm.wlu.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.nzm.wlu.mybluehost.me
2024-09-16 09:09
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:09:26 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: equi-libreconstruction.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>equi-libreconstruction.com — Coming Soon</title> <script src="https://nzm.wlu.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nzm.wlu.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nzm.wlu.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.dwo.tqp.mybluehost.me
2024-09-16 09:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:09:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://nutrahealthwave.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=5937b74c02ae8b1beab9c16d829af01b; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.artecse.com
2024-09-16 09:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:08:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://artecse.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:13:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.8dtransformations.soulsofvirtue.com
2024-09-16 09:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:08:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://8dtransformations.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://8dtransformations.com/index.php?rest_route=/wp/v2/pages/1421>; rel="alternate"; title="JSON"; type="application/json", <https://8dtransformations.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pmpro_visit=1; path=/; secure; HttpOnly Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.tahammondmarketing.com
2024-09-16 09:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:08:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tahammondmarketing.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:08:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.luxartists.com
2024-09-16 09:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:08:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://luxartists.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ypa.sfg.mybluehost.me
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Authentous Mobile App — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Authentous Mobile App — Coming Soon</title> <script src="https://authentousapp.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://authentousapp.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://authentousapp.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · rmrconsult.com
2024-09-16 09:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:07:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://www.rmrconsult.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.lailasandbaek.com
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lailasandbaek.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:12:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.modmoods.com
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:17 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://box5397.temp.domains/~modmoods/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5397.temp.domains/~modmoods/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://box5397.temp.domains/~modmoods/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.ellisoncartercattle.com
2024-09-16 09:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:06:59 GMT Server: Apache Link: <https://www.ellisoncartercattle.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/P2N3om-m>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Ellison Carter Cattle Company <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://www.ellisoncartercattle.com/xmlrpc.php" /> <title>Ellison Carter Cattle Company</title> <!-- All in One SEO Pack 3.2.7 by Michael Torbert of Semper Fi Web Design[272,279] --> <meta name="description" content="Ellison Carter Cattle Company is a family owned and operated business. From one head to a truckload, we buy and sell according to your needs. We have been serving the cattle industry since 1977." /> <meta name="keywords" content="Cattle, cows, calves, steers, bulls, cattle sales, cattle buying, order buying. Cattle pens, cattle selling, cattle hauling, cattle auctions, cattle scales, cattle weights, cattle prices, Ellison Carter, Renee Carter, James Carter, Nathan Carter, Walton Carter, Kayla Carter, Hannah Elison, Trucking, hauling, selling, order buying, auctions, scales, weights, Santo, Gordon, Weatherford, Brock, Millsap, Strawn, Lone Camp, Stephenville, Fort Worth" /> <script type="application/ld+json" class="aioseop-schema">{"@context":"https://schema.org","@graph":[{"@type":"Organization","@id":"https://www.ellisoncartercattle.com/#organization","url":"https://www.ellisoncartercattle.com/","name":"","sameAs":[]},{"@type":"WebSite","@id":"https://www.ellisoncartercattle.com/#website","url":"https://www.ellisoncartercattle.com/","name":"","publisher":{"@id":"https://www.ellisoncartercattle.com/#organization"},"potentialAction":{"@type":"SearchAction","target":"https://www.ellisoncartercattle.com/?s={search_term_string}","query-input":"required name=search_term_string"}},{"@type":"WebPage","@id":"https://www.ellisoncartercattle.com/#webpage","url":"https://www.ellisoncartercattle.com/","inLanguage":"en-US","name":"About","isPartOf":{"@id":"https://www.ellisoncartercattle.com/#website"},"image":{"@type":"ImageObject","@id":"https://www.ellisoncartercattle.com/#primaryimage","url":"https://www.ellisoncartercattle.com/wp-content/uploads/2019/09/DSC_0234.jpg","width":4608,"height":3072},"primaryImageOfPage":{"@id":"https://www.ellisoncartercattle.com/#primaryimage"},"datePublished":"2012-10-08T16:09:10+00:00","dateModified":"2019-09-27T20:18:32+00:00","about":{"@id":"https://www.ellisoncartercattle.com/#organization"},"description":"Ellison Carter Cattle Company is a family owned and operated business. From one head to a truckload, we buy and sell according to your needs. We have been serving the cattle industry since 1977."}]}</script> <link rel="canonical" href="https://www.ellisoncartercattle.com/" /> <!-- All in One SEO Pack --> <link rel='dns-prefetch' href='//s0.wp.com' /> <link rel='dns-prefetch' href='//secure.gravatar.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title=" » Feed" href="https://www.ellisoncartercattle.com/feed/" /> <link rel="alternate" type="application/rss+xml" title=" » Comments Feed" href="https://www.ellisoncartercattle.com/comments/feed/" /> <link rel="alternate" type="application/rss+xml" title=" » About Comments Feed" href="https://www.ellisoncartercattle.com/about/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.ellisoncartercattle.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.2.21"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),tFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.doombots.co
2024-09-16 09:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:06:59 GMT Server: Apache Link: <https://www.doombots.co/wp-json/>; rel="https://api.w.org/", <https://www.doombots.co/wp-json/wp/v2/pages/467>; rel="alternate"; title="JSON"; type="application/json", <https://www.doombots.co/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ukc.feb.mybluehost.me
2024-09-16 09:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:06:56 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ukc.feb.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ukc.feb.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ukc.feb.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.t2rtx.com
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://t2rtx.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · xqq.sco.mybluehost.me
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://adonebbbm.store/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 1 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:06:20 GMT; Max-Age=315360000; path=/ Set-Cookie: wp_llms_session_c5a9ef501e000fb40143c7b1d059da40=7097ce132e68186bc6e74eee252b723c%7C%7C1726499180%7C%7C1726495580%7C%7C5801023c309e32c5fc4c167bb30139f7; expires=Mon, 16 Sep 2024 15:06:20 GMT; Max-Age=21600; path=/; secure; HttpOnly
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.madosamart.com
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://madosamart.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.rubberduckyresort.com
2024-09-16 09:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:05:15 GMT Server: Apache X-Pingback: https://www.rubberduckyresort.com/xmlrpc.php X-FRAME-OPTIONS: SAMEORIGIN X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.rubberduckyresort.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:05:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · bubbachat.au
2024-09-16 09:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:04:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bubbachat.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:04:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · megsmedicareandmore.havemedicare.com
2024-09-16 09:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:04:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Meg's Medicare and More — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Meg's Medicare and More — Coming Soon</title> <script src="https://megsmedicareandmore.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://megsmedicareandmore.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://megsmedicareandmore.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.dsv.aca.mybluehost.me
2024-09-16 09:02
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:02:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:02:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: CMB Unlimited Solutions — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>CMB Unlimited Solutions — Coming Soon</title> <script src="https://cmbunlimitedsolutions.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cmbunlimitedsolutions.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cmbunlimitedsolutions.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.youngbloodinsurance.havemedicare.com
2024-09-16 09:01
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:01:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://youngbloodinsurance.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://youngbloodinsurance.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://youngbloodinsurance.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · envirogreen.pdl.jfc.mybluehost.me
2024-09-16 09:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:00:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.envirogreen.ae/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:00:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · pdl.jfc.mybluehost.me
2024-09-16 08:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:59:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding X-Pingback: https://pdl.jfc.mybluehost.me/xmlrpc.php Link: <https://pdl.jfc.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://pdl.jfc.mybluehost.me/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PacBwN-2>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:04:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · campinglyfe.com
2024-09-16 08:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:59:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://campinglyfe.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://campinglyfe.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://campinglyfe.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.wxa.aca.mybluehost.me
2024-09-16 08:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:59:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: üpgrade-insecure-requests" Location: https://schneider-et.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:59:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.lightoflovephotography.com
2024-09-16 08:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:58:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=utf8 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.zzj.boy.mybluehost.me
2024-09-16 08:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:58:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: miss Link: <https://abbachildrenhome.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:58:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · artecse.com
2024-09-16 08:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:58:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://artecse.com/wp-json/>; rel="https://api.w.org/", <https://artecse.com/wp-json/wp/v2/pages/86>; rel="alternate"; title="JSON"; type="application/json", <https://artecse.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:03:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.drstenhq.babeslay.com
2024-09-16 08:57
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:57:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://drstenhq.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:02:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · filmnoirfile.spectorsoul.com
2024-09-16 08:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:56:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Location: https://www.filmnoirfile.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.culturestrategy.io
2024-09-16 08:54
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:54:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://culturestrategy.io/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:54:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · palomponleyte-gov-ph.triconnsolutions.com
2024-09-16 08:54
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:54:12 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 21 May 2024 05:46:07 GMT Accept-Ranges: bytes Content-Length: 60186 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: Municipality of Palompon, Leyte <!DOCTYPE html> <html lang="en"> <head> <meta charset="utf-8"> <title>Municipality of Palompon, Leyte</title> <meta content="width=device-width, initial-scale=1.0" name="viewport"> <meta content="" name="keywords"> <meta content="" name="description"> <!-- Favicon --> <link href="img/favicon.ico" rel="icon"> <!-- Google Web Fonts --> <link rel="preconnect" href="https://fonts.googleapis.com"> <link rel="preconnect" href="https://fonts.gstatic.com" crossorigin> <link href="https://fonts.googleapis.com/css2?family=Montserrat:wght@400;500&family=Roboto:wght@500;700&display=swap" rel="stylesheet"> <!-- Icon Font Stylesheet --> <link href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/5.10.0/css/all.min.css" rel="stylesheet"> <link href="https://cdn.jsdelivr.net/npm/bootstrap-icons@1.4.1/font/bootstrap-icons.css" rel="stylesheet"> <!-- Libraries Stylesheet --> <link href="lib/animate/animate.min.css" rel="stylesheet"> <link href="lib/owlcarousel/assets/owl.carousel.min.css" rel="stylesheet"> <link href="lib/lightbox/css/lightbox.min.css" rel="stylesheet"> <!-- Customized Bootstrap Stylesheet --> <link href="css/bootstrap.min.css" rel="stylesheet"> <!-- Template Stylesheet --> <link href="css/style.css" rel="stylesheet"> <script src="https://ajax.googleapis.com/ajax/libs/jquery/3.6.1/jquery.min.js"></script> </head> <body> <!-- All Modals --> <!-- Modal REGISTER --> <div class="modal fade" id="register" data-bs-backdrop="static" data-bs-keyboard="false" tabindex="-1" aria-labelledby="register" aria-hidden="true"> <div class="modal-dialog modal-xl"> <form action="userRegister.php" method="post"> <div class="modal-content"> <div class="modal-header"> <h5 class="modal-title" id="staticBackdropLabel"><b>Let’s Get Started!</b> <br/><small>Create Account</small></h5> <button type="button" class="btn-close" data-bs-dismiss="modal" aria-label="Close"></button> </div> <div class="modal-body"> <div class="input-group input-group-md mb-3"> <input type="text" name="fname" class="form-control" placeholder="First Name" aria-label="First Name" required> <input type="text" name="lname" class="form-control" placeholder="Last Name" aria-label="Last Name" required> <!--<input type="text" class="form-control" placeholder="Middle Name" aria-label="Middle Name" required>--> </div> <div class="input-group input-group-md mb-3"> <input type="email" name="email" class="form-control" placeholder="Email Address as Username" aria-label="Email Address" aria-describedby="basic-addon2" required> <span class="input-group-text" id="basic-addon2"><i class="fa fa-envelope"></i></span> </div> <!--<div class="alert alert-warning" role="alert" style="font-size: 12px; padding: 5px !important;">--> <!--Verification Email will be sent to this Address.--> <!--</div>--> <div class="alert alert-danger" id="passwordnotmatch" role="alert" style="font-size: 12px; padding: 5px !important; display: none"> Password did not match! </div> <div class="input-group input-group-md mb-3"> <input type="password" name="password" id="password" class="form-control" placeholder="Password" aria-label="Password" required> <input type="password" name="password2" id="password2" class="form-control" placeholder="Retype Password" aria-label="Retype Password" required> <span class="input-group-text" onmouseup="$('#password').attr('type', 'password'); $('#password2').attr('type', 'password'); $(this).text('Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.galaherlaw.com
2024-09-16 08:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:53:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://galaherlaw.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:58:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.clearvisiondefend.com
2024-09-16 08:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:53:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://clearvisiondefend.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:53:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · joannlee.me
2024-09-16 08:52
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:52:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://joannlee.me/wp-json/>; rel="https://api.w.org/", <https://joannlee.me/wp-json/wp/v2/pages/21>; rel="alternate"; title="JSON"; type="application/json", <https://joannlee.me/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:52:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · edyukation.com
2024-09-16 08:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:51:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://www.edyukation.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:56:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.edyukation.com%2F; expires=Mon, 14 Oct 2024 08:51:33 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · chubbthoughts.babeslay.com
2024-09-16 08:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:51:17 GMT Server: Apache Link: <https://chubbthoughts.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://chubbthoughts.com/index.php?rest_route=/wp/v2/pages/28>; rel="alternate"; title="JSON"; type="application/json", <https://chubbthoughts.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:56:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · cristinamarie.co
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:50:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Cristina Marie — Coming Soon <!DOCTYPE html> <html lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Cristina Marie — Coming Soon</title> <script src="https://cristinamarie.co/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cristinamarie.co/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cristinamarie.co/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.1migrationworldwide.com
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: 56b_HTTP.200,56b_HTTP.301 X-Redirect-By: WordPress Location: https://1migrationworldwide.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · augustgarrett.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:32 GMT Server: Apache Link: <https://augustgarrett.com/wp-json/>; rel="https://api.w.org/", <https://augustgarrett.com/wp-json/wp/v2/pages/287>; rel="alternate"; title="JSON"; type="application/json", <https://augustgarrett.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.treedownservices.com
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://treedownservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.qgt.nsm.mybluehost.me
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tillisholdingsllc.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.cosmaxnbtusa.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cosmaxnbtusa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:09:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: HIT
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-099b56d3.cvr.jzw.mybluehost.me
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: apex — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>apex — Coming Soon</title> <script src="https://apexusaenterpriseinc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://apexusaenterpriseinc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://apexusaenterpriseinc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dai.noo.mybluehost.me
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://investirbien.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.hny.bhx.mybluehost.me
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://hny.bhx.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hny.bhx.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hny.bhx.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-b42a782f.zsk.wvf.mybluehost.me
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fields-fowler.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.jacksontel.com
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jacksontel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.divinecaregroup.com.au
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://divinecaregroup.com.au/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.adultingtoo.com
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://adultingtoo.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.mwprintingllc.com
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://yho.rdx.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.devotedfmo.havemedicare.com
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Devoted FMO — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Devoted FMO — Coming Soon</title> <script src="https://box5397.temp.domains/~havemedi/devotedfmo/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5397.temp.domains/~havemedi/devotedfmo/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://box5397.temp.domains/~havemedi/devotedfmo/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.euromontpvc.net
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://euromontpvc.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · denyseforoc.com
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:34 GMT Server: Apache Link: <https://denyseforoc.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://denyseforoc.com/index.php?rest_route=/wp/v2/pages/64>; rel="alternate"; title="JSON"; type="application/json", <https://denyseforoc.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · by-amysue.com
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: hit Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.opexanswers.com
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://opexanswers.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://opexanswers.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://opexanswers.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kayecoaching.com
2024-09-16 08:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kayecoaching.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:51:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.stonedloverboy.com
2024-09-16 08:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stonedloverboy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-f69fa513.samysbeauty.com
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:17 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: InnoaiGen — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>InnoaiGen — Coming Soon</title> <script src="https://ozq.wvf.mybluehost.me/website_f69fa513/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ozq.wvf.mybluehost.me/website_f69fa513/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ozq.wvf.mybluehost.me/website_f69fa513/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kindreset.moonandpledge.com
2024-09-16 08:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.kindreset.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · akn.wyt.mybluehost.me
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://akn.wyt.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://akn.wyt.mybluehost.me/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/Pa5WJh-4>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.schneider-et.net
2024-09-16 08:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:45:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: üpgrade-insecure-requests" Location: https://schneider-et.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-b445bfff.mkz.tuk.mybluehost.me
2024-09-16 08:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:45:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://visimony.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dve.uxb.mybluehost.me
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mamaliciously.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://mamaliciously.com/index.php?rest_route=/wp/v2/pages/2595>; rel="alternate"; title="JSON"; type="application/json", <https://mamaliciously.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.sctplayhouse.com
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sctplayhouse.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://sctplayhouse.com/index.php?rest_route=/wp/v2/pages/1000>; rel="alternate"; title="JSON"; type="application/json", <https://sctplayhouse.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dcglobejotters.org
2024-09-16 08:45
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dhm.wxt.mybluehost.me
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://daniyaal.ca/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.apis.flamalama.com
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:03 GMT Server: Apache X-Pingback: https://apispasteleria.cl/xmlrpc.php Link: <https://apispasteleria.cl/index.php?rest_route=/>; rel="https://api.w.org/", <https://apispasteleria.cl/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · by-amysue.com
2024-09-16 08:44
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-099b56d3.cvr.jzw.mybluehost.me
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: apex — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>apex — Coming Soon</title> <script src="https://apexusaenterpriseinc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://apexusaenterpriseinc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://apexusaenterpriseinc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · roq.swq.mybluehost.me
2024-09-16 08:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: bcb_HTTP.200,bcb_HTTP.301 X-Redirect-By: WordPress Location: https://sungmanhk.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · startuparabia.com
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://startuparabia.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:49:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ugs.cup.mybluehost.me
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://fairytaletravelguide.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.tcc.xjl.mybluehost.me
2024-09-16 08:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://prettywyld.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.solicitymedia.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://solicitymedia.com/xmlrpc.php X-Redirect-By: WordPress Location: https://solicitymedia.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.afp.zyv.mybluehost.me
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://nexo-motors.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-6dfc558e.mpt.qsp.mybluehost.me
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://idiomas.uas.edu.mx/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · sunnybrookefootball-ca.sunnybrookefootball.com
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sunnybrookefootball.ca/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:48:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: sunnybrooke-fr – Building winners one snap at a time <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta http-equiv="X-UA-Compatible" content="IE=10" /> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://sunnybrookefootball.ca/xmlrpc.php" /> <title>sunnybrooke-fr – Building winners one snap at a time</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//sunnybrookefootball.ca' /> <link rel="alternate" type="application/rss+xml" title="sunnybrooke-fr » Feed" href="https://sunnybrookefootball.ca/feed/" /> <link rel="alternate" type="application/rss+xml" title="sunnybrooke-fr » Comments Feed" href="https://sunnybrookefootball.ca/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/sunnybrookefootball.ca\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); /* ]]> */ </script> <style id='wp-emoji-styles-inline-css' type='text/css'> img.wp-smilFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-cc21065f.hny.bhx.mybluehost.me
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:23 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Loveable Cavaliers — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Loveable Cavaliers — Coming Soon</title> <script src="https://hny.bhx.mybluehost.me/.website_cc21065f/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hny.bhx.mybluehost.me/.website_cc21065f/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hny.bhx.mybluehost.me/.website_cc21065f/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · uncageyourinnerlioness.livewholistic.com
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:18 GMT Server: Apache Link: <https://uncageyourinnerlioness.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://uncageyourinnerlioness.com/index.php?rest_route=/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://uncageyourinnerlioness.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:48:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.selabuildstx.com
2024-09-16 08:42
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · playitforwardsportstherapy.com
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:53 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.playitforwardsportstherapy.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.realidadciudadana.bettyhallshopping.com
2024-09-16 08:42
HTTP/1.1 503 Service Temporarily Unavailable Date: Mon, 16 Sep 2024 08:42:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Retry-After: 86400 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache; private Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress Connection: close Transfer-Encoding: chunked Page title: Realidad Ciudadana <!DOCTYPE html> <html lang="es"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <!-- SEO --> <title>Realidad Ciudadana</title><meta name="description" content="Informativo comunitario de Esmeraldas"/> <!-- og meta for facebook, googleplus --> <meta property="og:title" content="Realidad Ciudadana"/> <meta property="og:description" content="Informativo comunitario de Esmeraldas"/> <meta property="og:url" content="https://realidadciudadana.com"/> <meta property="og:type" content="website" /> <meta property="og:image" content="https://realidadciudadana.com/wp-content/uploads/2023/03/Portada-FPRealidadCiudadana-02-1024x576.jpg"/> <!-- twitter meta --> <meta name="twitter:card" content="summary_large_image"/> <meta name="twitter:title" content="Realidad Ciudadana"/> <meta name="twitter:description" content="Informativo comunitario de Esmeraldas"/> <meta name="twitter:url" content="https://realidadciudadana.com"/> <meta name="twitter:image" content="https://realidadciudadana.com/wp-content/uploads/2023/03/Portada-FPRealidadCiudadana-02-1024x576.jpg"/> <link rel="icon" href="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-32x32.png" sizes="32x32" /> <link rel="icon" href="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-192x192.png" sizes="192x192" /> <link rel="apple-touch-icon" href="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-180x180.png" /> <meta name="msapplication-TileImage" content="https://realidadciudadana.com/wp-content/uploads/2023/02/cropped-Icono-Cuadrado-270x270.png" /> <link rel="stylesheet" href="https://realidadciudadana.com/wp-content/plugins/cmp-coming-soon-maintenance/themes/construct/style.css?v=4.1.13" type="text/css" media="all"> <link rel="stylesheet" href="https://realidadciudadana.com/wp-content/plugins/cmp-coming-soon-maintenance/css/animate.min.css"> <link href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/5.14.0/css/all.min.css" rel="stylesheet" > <link href="https://fonts.googleapis.com/css?family=Fjalla+One:700%7CAverage+Sans:400,700,400&subset=latin-ext,latin" rel="stylesheet"> <style> body,input, select, textarea, button {font-family:'Average Sans', 'sans-serif';color:#686868;} input {font-family: Average Sans, 'Font Awesome 5 Free';} body {background-color:#ffffff} a {color:#686868;} h1,h2,h3,h4,h5,h6 {font-family:'Fjalla One', 'sans-serif';} h1,h2,h3,h4,h5,h6,a:hover {color:#f37004;} input[type="email"]:focus {border:1px solid #f37004;} input[type="submit"]{background-color: #f37004;} .social-list a:hover{background:#f37004;} body {font-size:17px;} .section-body p {line-height: 1.6; letter-spacing: 0px;font-weight:400;; } .section-social {background-color: #f8f8f8} h1:not(.text-logo),h2, h3,h4,h5,h6,.text-logo-wrapper {font-size:2.3529411764706em;letter-spacing: 0px; font-weight:700;; } h1 {font-weight:700;;} </style> <style> .wp-video {margin: 0 auto;} .wp-video-shortcode {max-width: 100%;} .grecaptcha-badge {display: none!important;} .text-logo {display: inline-block;} #gdpr-checkbox {-webkit-appearance: checkbox;-moz-appearance: checkbox;width: initial;height: initial;} #counter.expired {display: none; } input, button { box-shadow: inset 0 0 0 0 !important; -webkit-box-shadow: inset 0 0 0 0 !important; -webkit-appearance: none; outline: none; } </style> </head> <body id="body"> <section class="section section-logo"> <div class="logo-wrapper text text-logo-wrapper"><a href="https://realidadciudadana.com" style="text-decoration:none;color:inherit"><h1 class="text-logo">Realidad Ciudadana</h1></a></div> </section> <divFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.estessparkles.com
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://estessparkles.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:42:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-e10ff660.sxm.wyy.mybluehost.me
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:22 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:42:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Delta Steel Building — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Delta Steel Building — Coming Soon</title> <script src="https://sxm.wyy.mybluehost.me/.website_e10ff660/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://sxm.wyy.mybluehost.me/.website_e10ff660/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://sxm.wyy.mybluehost.me/.website_e10ff660/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · drstenhq.babeslay.com
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://drstenhq.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:47:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ginathetc.com
2024-09-16 08:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:41:48 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ginathetc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · jgw.gro.mybluehost.me
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:45 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:41:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://jgw.gro.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jgw.gro.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jgw.gro.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.stillnavigating.com
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://stillnavigating.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:41:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.stephanierupp.net
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:59 GMT Server: Apache Link: <https://www.stephanierupp.net/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: My Blog | Just another WordPress site <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <title>My Blog | Just another WordPress site</title> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.stephanierupp.net/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.stephanierupp.net/wp-content/themes/twentyfourteen/js/html5.js"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.stephanierupp.net' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="My Blog » Feed" href="https://www.stephanierupp.net/feed/" /> <link rel="alternate" type="application/rss+xml" title="My Blog » Comments Feed" href="https://www.stephanierupp.net/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.stephanierupp.net\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.pfcontractorsteam.com
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:11 GMT Server: Apache Link: <https://www.pfcontractorsteam.com/wp-json/>; rel="https://api.w.org/", <https://www.pfcontractorsteam.com/wp-json/wp/v2/pages/143>; rel="alternate"; type="application/json", <https://www.pfcontractorsteam.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · vjl.mqz.mybluehost.me
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kondangsarana.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · evergreennote.com
2024-09-16 08:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:38:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://evergreennote.com/wp-json/>; rel="https://api.w.org/", <https://evergreennote.com/wp-json/wp/v2/pages/14>; rel="alternate"; title="JSON"; type="application/json", <https://evergreennote.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · edyukation.com
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.edyukation.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:43:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.edyukation.com%2F; expires=Mon, 14 Oct 2024 08:38:13 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · marinvest.cv
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://marinvest.cv/wp-json/>; rel="https://api.w.org/", <https://marinvest.cv/wp-json/wp/v2/pages/356>; rel="alternate"; title="JSON"; type="application/json", <https://marinvest.cv/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · findingataraxia.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.findingataraxia.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.stockportsilver.co.uk
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stockportsilver.co.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · adarsh.theorphic.space
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:37 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 2903 Last-Modified: Sat, 09 Mar 2024 13:03:31 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: My Blog — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>My Blog — Coming Soon</title> <script src="http://adarsh.theorphic.space/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://adarsh.theorphic.space/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"> <a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><span class="dashicons dashicons-wordpress"></span><br /> <a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /> <a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for WordPress?</a><br /> </p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://adarsh.theorphic.space/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html> <!--Generated by Endurance Page Cache-->Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kst.ths.mybluehost.me
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://awakencentre.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · tengomedicare.havemedicare.com
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:42:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Tengo Medicare — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Tengo Medicare — Coming Soon</title> <script src="https://tengomedicare.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tengomedicare.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.0.11" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tengomedicare.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html> <!--Generated by Newfold Page Cache-->Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-27017e92.rmp.uqp.mybluehost.me
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:18 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Mike DiNapoli — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Mike DiNapoli — Coming Soon</title> <script src="https://rmp.uqp.mybluehost.me/.website_27017e92/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rmp.uqp.mybluehost.me/.website_27017e92/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rmp.uqp.mybluehost.me/.website_27017e92/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.premiumbeveragesllc.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://premiumbeveragesllc.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:42:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.megsmedicareandmore.havemedicare.com
2024-09-16 08:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Meg's Medicare and More — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Meg's Medicare and More — Coming Soon</title> <script src="https://megsmedicareandmore.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://megsmedicareandmore.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://megsmedicareandmore.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · priorityyou.net
2024-09-16 08:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:36:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://priorityyou.net/wp-json/>; rel="https://api.w.org/", <https://priorityyou.net/wp-json/wp/v2/pages/55>; rel="alternate"; title="JSON"; type="application/json", <https://priorityyou.net/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · rbs.fih.mybluehost.me
2024-09-16 08:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:36:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://rbs.fih.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rbs.fih.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rbs.fih.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.ableproductsusa.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ableproductsusa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.lauraaaa.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.lauraaaa.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:41:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.ozq.wvf.mybluehost.me
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://samysbeauty.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:36:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.members.rocketyourcontent.com
2024-09-16 08:35
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.schneider-et.net
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: üpgrade-insecure-requests" Location: https://schneider-et.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.mkz.tuk.mybluehost.me
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mkz.tuk.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.getbettersleeptoday.com
2024-09-16 08:35
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-d15f2dd6.irz.zga.mybluehost.me
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://workerx.com.au/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.tchnoweb.com
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: b9d_HTTP.200,b9d_HTTP.301 X-Redirect-By: WordPress Location: https://tchnoweb.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · opexanswers.com
2024-09-16 08:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:34:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:34:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://opexanswers.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://opexanswers.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://opexanswers.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · bhf.bma.mybluehost.me
2024-09-16 08:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:33:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://prjelectric.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:33:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.markpevsner.com
2024-09-16 08:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:32:24 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://markpevsner.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.oidm.com
2024-09-16 08:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:32:23 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://integritydatamanagement.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.timshels.com
2024-09-16 08:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:01 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://timshels.com/ Cache-Control: max-age=1 Expires: Mon, 16 Sep 2024 08:31:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · lvq.mjj.mybluehost.me
2024-09-16 08:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:30:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:30:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://lvq.mjj.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lvq.mjj.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lvq.mjj.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.dve.uxb.mybluehost.me
2024-09-16 08:30
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ups.zsr.mybluehost.me
2024-09-16 08:29
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · teamwcoaching.com
2024-09-16 08:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:29:44 GMT Server: Apache Link: <https://teamwcoaching.com/wp-json/>; rel="https://api.w.org/", <https://teamwcoaching.com/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://teamwcoaching.com/>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://teamwcoaching.com/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://teamwcoaching.com Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:34:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ugs.cup.mybluehost.me
2024-09-16 08:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:29:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://fairytaletravelguide.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:28:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.onii-corp.com
2024-09-16 08:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:28:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:28:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome my dear friend! — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome my dear friend! — Coming Soon</title> <script src="https://onii-corp.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://onii-corp.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://onii-corp.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.mxy.oea.mybluehost.me
2024-09-16 08:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:28:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:28:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://2hrdwrkrs.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://2hrdwrkrs.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://2hrdwrkrs.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · fanhorror.penthousedog.com
2024-09-16 08:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:27:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://fanhorror.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/afr7Z>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:32:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · debhartmandigital.com
2024-09-16 08:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:24:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://debhartmandigital.com/wp-json/>; rel="https://api.w.org/", <https://debhartmandigital.com/wp-json/wp/v2/pages/121>; rel="alternate"; type="application/json", <https://wp.me/P6MQod-1X>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome - Deb Hartman Digital <!DOCTYPE html> <html lang="en-US"> <head> <!--[if IE]> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> `` <![endif]--> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <link rel="profile" href="" /> <!-- Theme Css --> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Welcome - Deb Hartman Digital</title> <link rel="canonical" href="https://debhartmandigital.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Welcome - Deb Hartman Digital" /> <meta property="og:url" content="https://debhartmandigital.com/" /> <meta property="og:site_name" content="Deb Hartman Digital" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://debhartmandigital.com/","url":"https://debhartmandigital.com/","name":"Welcome - Deb Hartman Digital","isPartOf":{"@id":"https://debhartmandigital.com/#website"},"datePublished":"2016-07-27T20:52:27+00:00","dateModified":"2016-07-27T20:52:27+00:00","breadcrumb":{"@id":"https://debhartmandigital.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://debhartmandigital.com/"]}]},{"@type":"BreadcrumbList","@id":"https://debhartmandigital.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://debhartmandigital.com/#website","url":"https://debhartmandigital.com/","name":"Deb Hartman Digital","description":"Say it right online.","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://debhartmandigital.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//secure.gravatar.com' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//v0.wordpress.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Deb Hartman Digital » Feed" href="https://debhartmandigital.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Deb Hartman Digital » Comments Feed" href="https://debhartmandigital.com/comments/feed/" /> <!-- This site uses the Google Analytics by ExactMetrics plugin v7.26.0 - Using Analytics tracking - https://www.exactmetrics.com/ --> <!-- Note: ExactMetrics is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the ExactMetrics settings panel. --> <!-- No tracking code set --> <!-- / Google Analytics by ExactMetrics --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/debhartmandigital.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.stalledprojects.com
2024-09-16 08:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:24:03 GMT Server: Apache Link: <https://stalledprojects.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=3600 Expires: Mon, 16 Sep 2024 09:24:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · mail.filmnoirfile.com
2024-09-16 08:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:23:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Location: http://www.filmnoirfile.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-9f122a69.eduresourceteam.com
2024-09-16 08:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:23:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://recruitfit.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · cctraining.ca
2024-09-16 08:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:23:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:22:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: cctraining — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>cctraining — Coming Soon</title> <script src="https://cctraining.ca/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cctraining.ca/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cctraining.ca/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.helpfulmba.com
2024-09-16 08:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:21:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://helpfulmba.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:21:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · lzf.bqn.mybluehost.me
2024-09-16 08:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:21:35 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:21:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://lzf.bqn.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lzf.bqn.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lzf.bqn.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · bubbachat.com.au
2024-09-16 08:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:21:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bubbachat.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:21:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.ire.nsm.mybluehost.me
2024-09-16 08:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:20:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://noriz-tel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:25:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: NorizTel LP – Business Voip <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <meta http-equiv="x-ua-compatible" content="ie=edge"> <title>NorizTel LP – Business Voip</title> <link rel='dns-prefetch' href='//noriz-tel.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Feed" href="https://noriz-tel.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Comments Feed" href="https://noriz-tel.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/noriz-tel.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.26"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='contact-form-7-css' href='https://noriz-tel.com/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.0.4' type='text/css' media='all' /> <link rel='stylesheet' id='dima-take-action-css' href='https://noriz-tel.com/wp-content/plugins/dima-take-action/public/css/dima-take-action-public.css?ver=1.0.5' type='text/css' media='all' /> <link rel='stylesheet' id='rs-plugin-settings-css' href='https://noriz-tel.com/wp-content/plugins/revslider/public/assets/css/settings.css?ver=5.4.8' type='text/css' media='all' /> <style id='rs-plugin-settings-inline-css' type='text/css'> #rs-demo-id {} </style> <link rel='stylesheet' id='woocommerce-layout-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-layout.css?ver=3.4.8' type='text/css' media='all' /> <link rel='stylesheet' id='woocommerce-smallscreen-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-smallscreen.css?ver=3.4.8' type='text/css' media='only screen and (maxFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.newideasservices.com
2024-09-16 08:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:20:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:20:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://newideasservices.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://newideasservices.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://newideasservices.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · abcgomedicare.havemedicare.com
2024-09-16 08:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:20:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: ABC Go Medicare — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>ABC Go Medicare — Coming Soon</title> <script src="https://abcgomedicare.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://abcgomedicare.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://abcgomedicare.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.dik.hsk.mybluehost.me
2024-09-16 08:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:20:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: 87d_HTTP.200 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:20:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Make It Good — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Make It Good — Coming Soon</title> <script src="https://dik.hsk.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://dik.hsk.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://dik.hsk.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · feliztips.com
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:52 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.feliztips.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.kristinmacdermott.com
2024-09-16 08:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:18:51 GMT Server: Apache Link: <https://www.kristinmacdermott.com/wp-json/>; rel="https://api.w.org/", <https://www.kristinmacdermott.com/wp-json/wp/v2/pages/60>; rel="alternate"; title="JSON"; type="application/json", <https://www.kristinmacdermott.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ghr.hgs.mybluehost.me
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: 5d4_HTTP.200,5d4_HTTP.301 X-Redirect-By: WordPress Location: https://rubberint.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.iwantittoday.net
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://iwantittoday.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:18:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.jwf.zzh.mybluehost.me
2024-09-16 08:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:17:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://jwf.zzh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jwf.zzh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jwf.zzh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.zbv.ujd.mybluehost.me
2024-09-16 08:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:15 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: The Science Cipher — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>The Science Cipher — Coming Soon</title> <script src="https://thesciencecipher.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thesciencecipher.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"> <a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><span class="dashicons dashicons-wordpress"></span><br /> <a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /> <a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for WordPress?</a><br /> </p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thesciencecipher.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · rmkm.rmrc.site
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: RMKM — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>RMKM — Coming Soon</title> <script src="https://rmkm.rmrc.site/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rmkm.rmrc.site/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rmkm.rmrc.site/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.buzzpointllc.lifehacksx.com
2024-09-16 08:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:16:40 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://buzzpointllc.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:16:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · revassistant.lifehacksx.com
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:16 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:16:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Virtual Assistants — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Virtual Assistants — Coming Soon</title> <script src="https://revassistant.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://revassistant.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.8.3" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://revassistant.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · zappamacchine.com
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:03 GMT Server: Apache Link: <https://zappamacchine.com/wp-json/>; rel="https://api.w.org/", <https://zappamacchine.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · tbh.qjv.mybluehost.me
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:16:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://evergreennotebuyer.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:16:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · caosventura.com
2024-09-16 08:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:20:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Caosventura — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Caosventura — Coming Soon</title> <script src="https://caosventura.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://caosventura.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://caosventura.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · blog.overseasjo.com
2024-09-16 08:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:15:56 GMT Server: Apache Link: <https://blog.overseasjo.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.maithri.varshavg.com
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:15:27 GMT Server: Apache X-Redirect-By: WordPress Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Upgrade: h2,h2c Connection: Upgrade, close Location: https://maithri.varshavg.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.tessandtrix.theheartofsurrender.com
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:15:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.tessandtrix.com/ Cache-Control: max-age=604800 Expires: Mon, 23 Sep 2024 08:15:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.psduo.com
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:15:27 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://markpevsner.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.theartoflivin.com
2024-09-16 08:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:15:27 GMT Server: Apache Link: <https://theartoflivin.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · hoskia.walisng.com
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.hoskia.walisng.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:14:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.electricalgeelong-com.irz.zga.mybluehost.me
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://electricalgeelong.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:14:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.brkujima.com
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://brkujima.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:19:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.makerofthehome.blog
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://makerofthehome.blog/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:14:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.allenrussell.org
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:42 GMT Server: Apache Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: allenrussell.org — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>allenrussell.org — Coming Soon</title> <script src="https://www.allenrussell.org/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://www.allenrussell.org/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.0.6" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://www.allenrussell.org/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · jwf.zzh.mybluehost.me
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://jwf.zzh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jwf.zzh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jwf.zzh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · eddiejoyce.net
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:22 GMT Server: Apache X-Pingback: https://www.eddiejoyce.net/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.eddiejoyce.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.plt.sfw.mybluehost.me
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://miriamlynn.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.altonbranch.com
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.altonbranch.com/wp-json/>; rel="https://api.w.org/", <https://www.altonbranch.com/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://www.altonbranch.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:18:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.melissalynportraits.com
2024-09-16 08:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:00 GMT Server: Apache X-ProPhoto-Cache: HIT Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=utf8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · twx.egj.mybluehost.me
2024-09-16 08:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:12:22 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://peakvisualsstudios.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:17:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.marcbelnick.com
2024-09-16 08:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:12:21 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Mon, 16 Sep 2024 07:15:21 GMT Accept-Ranges: bytes Content-Length: 86759 Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:12:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Type: text/html Page title: Marc Belnick's – Wealth Accumulation Trading System <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://www.marcbelnick.com/xmlrpc.php" /> <link rel="icon" type="image/x-icon" href="https://www.marcbelnick.com/wp-content/themes/adviser/skins/adviser/images/favicon.ico" /> <title>Marc Belnick's – Wealth Accumulation Trading System</title> <meta name='robots' content='max-image-preview:large' /> <script>window._wca = window._wca || [];</script> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Marc Belnick's » Feed" href="https://www.marcbelnick.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Marc Belnick's » Comments Feed" href="https://www.marcbelnick.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.marcbelnick.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.amontit.com
2024-09-16 08:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:11:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-UA-Compatible: IE=edge Expires: Mon, 16 Sep 2024 09:11:53 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://amontit.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.tky.rfl.mybluehost.me
2024-09-16 08:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:11:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://lunametallic.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:11:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.drowsymind.com
2024-09-16 08:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:11:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://drowsymind.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:11:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · maithri.varshavg.com
2024-09-16 08:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:11:09 GMT Server: Apache Link: <https://maithri.varshavg.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:16:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Blog Away… – World of Words <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <link rel="pingback" href="https://maithri.varshavg.com/xmlrpc.php"> <title>Blog Away… – World of Words</title> <meta name='robots' content='noindex,nofollow' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Blog Away... » Feed" href="https://maithri.varshavg.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Blog Away... » Comments Feed" href="https://maithri.varshavg.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/maithri.varshavg.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.4.16"}}; /*! This file is auto-generated */ !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://maithri.varshavg.com/wp-includes/css/dist/block-library/style.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='https://maithri.varshavg.com/wp-includes/css/dist/block-library/theme.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='uptown-style-css' href='https://maithri.varshavg.com/wp-content/themes/uptown-style/style.css?ver=1.1.3' type='text/css' media='all' /> <style id='uptown-style-inline-css' type='text/css'> .hero{background-image:url(https://maithri.varshavg.com/wp-content/uploads/2020/10/cropped-61paK0VxpDL._SL1190_.jpg);} .site-title a,.site-title a:visited{Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.lumigeek.com
2024-09-16 08:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:08:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 P3P: CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT" Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://lumigeek.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: Cart66DBSID=GH0YE1IQI72GXMWLRBFOXFUNNPDE7FP01I0YVKWN; path=/
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.lumigeek.com
2024-09-16 08:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:08:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 P3P: CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT" Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://lumigeek.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: Cart66DBSID=G18CJPZTP754KG4Z1N26S1E8IEDPZGDAHC62JB69; path=/
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.lumigeek.com
2024-09-16 08:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:08:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 P3P: CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT" Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://lumigeek.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: Cart66DBSID=3XUKP18YP6PIUYRADF0S4WMJ4OI2IW4AB8SPVPIB; path=/
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.qds.yfm.mybluehost.me
2024-09-16 08:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:08:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:08:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://inmotiontransit.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://inmotiontransit.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://inmotiontransit.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-e6cfe59a.sailwildair.com
2024-09-16 08:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:07:53 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:07:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: CelalBayar — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>CelalBayar — Coming Soon</title> <script src="https://fnq.hju.mybluehost.me/website_e6cfe59a/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://fnq.hju.mybluehost.me/website_e6cfe59a/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://fnq.hju.mybluehost.me/website_e6cfe59a/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-542cc209.growmybusinessquick.com
2024-09-16 08:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:07:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://initialservicescorp.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:07:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · woodworkingbug.com
2024-09-16 08:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:07:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:07:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: My Blog — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>My Blog — Coming Soon</title> <script src="https://woodworkingbug.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://woodworkingbug.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://woodworkingbug.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.yeq.twj.mybluehost.me
2024-09-16 08:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:07:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://theanukchronicles.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=30cd57a511bff916096bd8d60858db19; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · bergennaacp.org
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bergennaacp.org/wp-json/>; rel="https://api.w.org/", <https://bergennaacp.org/wp-json/wp/v2/pages/22>; rel="alternate"; title="JSON"; type="application/json", <https://bergennaacp.org/>; rel=shortlink X-ET-API-VERSION: v1 X-ET-API-ROOT: https://bergennaacp.org/wp-json/tribe/tickets/v1/ X-ET-API-ORIGIN: https://bergennaacp.org X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://bergennaacp.org/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://bergennaacp.org Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.engconcepts.tech
2024-09-16 08:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:06:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://engconcepts.tech/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.tyr.mqz.mybluehost.me
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:11 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tyr.mqz.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tyr.mqz.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tyr.mqz.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · amaall-com.psb.yhn.mybluehost.me
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:07 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 31483 Last-Modified: Sun, 28 Jul 2024 06:50:08 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Page title: شركة آمال المحدودة <!DOCTYPE HTML> <html lang="en"> <head> <meta charset="utf-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <title>شركة آمال المحدودة</title> <!-- Favicons --> <link rel="shortcut icon" href="favicon.png"> <link rel="apple-touch-icon" href="apple-touch-icon.png"> <link rel="apple-touch-icon" sizes="72x72" href="apple-touch-icon-72x72.png"> <link rel="apple-touch-icon" sizes="114x114" href="apple-touch-icon-114x114.png"> <!-- Styles --> <link href="https://fonts.googleapis.com/css?family=Oswald:300,400,700" rel="stylesheet"> <link href="https://fonts.googleapis.com/css?family=Montserrat:400,700" rel="stylesheet"> <link href="css/style.css" rel="stylesheet" media="screen"> <link href="css/owl.carousel.min.css" rel="stylesheet" media="screen"> <link href="css/media.css" rel="stylesheet" media="screen"> <!-- Google Tag Manager --> <script>(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start': new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0], j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src= 'https://www.googletagmanager.com/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f); })(window,document,'script','dataLayer','GTM-K5972KW4');</script> <!-- End Google Tag Manager --> </head> <body> <div class="se-pre-con"></div> <!-- Header --> <header id="top" class="header-inner"> <div class="vision2030 js-target-scroll"> <img src="img/saudi vision.svg" alt=""> </div> <div class="brand-panel"> <a href="index.html" class="brand js-target-scroll"> <img src="img/logo.svg" alt=""> </a> </div> <!-- Navigation Desctop --> <nav class="navbar-desctop visible-md visible-lg"> <div class="container"> <a href="index.html" class="brand js-target-scroll"> <img src="img/logo-color.svg" alt=""> </a> <a href="#" class="vision-scrl js-target-scroll"> <img src="img/saudi visiovn.svg" alt=""> </a> <ul class="navbar-desctop-menu"> <li > <a href="index.html">الرئيسية</a> </li> <li > <a href="about.html">من نحن</a> </li> <li> <a href="services.html">الخدمات</a> </li> <li > <a href="#">المشاريع</a> <ul> <li><a href="available-projects.html">المشاريع الحالية</a></li> <li ><a href="completed-projects.html">المشاريع السابقة </a></li> <li><a href="soon-projects.html">المشاريع المستقبلية</a></li> </ul> </li> <li> <a href="news.html">الأخبار</a> </li> <li> <a href="contacts.html">اتصل بنا</a> </li> <li> <a href="soon-projects.html">سجل اهتمامك</a> </li> </ul> </div> </nav> <!-- Navigation Mobile --> <nav class="navbar-mobile"> <a href="#" class="brand js-target-scroll"> <img src="img/logo-color.svg" alt=""> </a> <!-- Navbar Collapse --> <button type="button" class="navbar-toggle collapsed" data-toggle="collapse" data-target="#navbar-mobile"> <span class="sr-only">Toggle navigation</span> <span class="icon-bar"></span> <span class="icon-bar"></span> <span class="icon-bar"></span> </button> <div class="collapse navbar-collapse" id="navbar-mobile"> <ul class="navbar-nav-mobile"> <li > <a href="index.html">الرئيسية </a>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.financialexamacademy.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:15 GMT Server: Apache Vary: Accept-Encoding,Cookie X-Pingback: https://financialexamacademy.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://financialexamacademy.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 <!-- WP Super Cache is installed but broken. The constant WPCACHEHOME must be set in the file wp-config.php and point at the WP Super Cache plugin directory. -->
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.reca.us
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:11 GMT Server: Apache X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://reca.us/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.herewme.com
2024-09-16 08:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:04:10 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://www.herewme.com/wp-json/>; rel="https://api.w.org/" Set-Cookie: PHPSESSID=2d9d0d63ceccdc5a54ab62684f06b0e1; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.sashashulmanlaw.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:13 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.sashashulmanlaw.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.jkbvideo.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:09 GMT Server: Apache X-Pingback: https://joshbrede.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://joshbrede.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ericksontattoo.com
2024-09-16 08:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:03:59 GMT Server: Apache X-Pingback: https://ericksontattoo.com/xmlrpc.php Upgrade: h2,h2c Connection: Upgrade, close Location: https://ericksontattoo.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.hpq.wev.mybluehost.me
2024-09-16 08:01
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 08:01:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.hpq.wev.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.hpq.wev.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · debhartmandigital.com
2024-09-16 08:01
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:01:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://debhartmandigital.com/wp-json/>; rel="https://api.w.org/", <https://debhartmandigital.com/wp-json/wp/v2/pages/121>; rel="alternate"; type="application/json", <https://wp.me/P6MQod-1X>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome - Deb Hartman Digital <!DOCTYPE html> <html lang="en-US"> <head> <!--[if IE]> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> `` <![endif]--> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <link rel="profile" href="" /> <!-- Theme Css --> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Welcome - Deb Hartman Digital</title> <link rel="canonical" href="https://debhartmandigital.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Welcome - Deb Hartman Digital" /> <meta property="og:url" content="https://debhartmandigital.com/" /> <meta property="og:site_name" content="Deb Hartman Digital" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://debhartmandigital.com/","url":"https://debhartmandigital.com/","name":"Welcome - Deb Hartman Digital","isPartOf":{"@id":"https://debhartmandigital.com/#website"},"datePublished":"2016-07-27T20:52:27+00:00","dateModified":"2016-07-27T20:52:27+00:00","breadcrumb":{"@id":"https://debhartmandigital.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://debhartmandigital.com/"]}]},{"@type":"BreadcrumbList","@id":"https://debhartmandigital.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://debhartmandigital.com/#website","url":"https://debhartmandigital.com/","name":"Deb Hartman Digital","description":"Say it right online.","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://debhartmandigital.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//secure.gravatar.com' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//v0.wordpress.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Deb Hartman Digital » Feed" href="https://debhartmandigital.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Deb Hartman Digital » Comments Feed" href="https://debhartmandigital.com/comments/feed/" /> <!-- This site uses the Google Analytics by ExactMetrics plugin v7.26.0 - Using Analytics tracking - https://www.exactmetrics.com/ --> <!-- Note: ExactMetrics is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the ExactMetrics settings panel. --> <!-- No tracking code set --> <!-- / Google Analytics by ExactMetrics --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/debhartmandigital.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.wetarted.com
2024-09-16 08:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:00:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wetarted.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:00:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.otl.bjl.mybluehost.me
2024-09-16 07:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:59:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:59:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://opexanswers.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://opexanswers.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://opexanswers.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.destinationhabit.com
2024-09-16 07:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:59:42 GMT Server: Apache Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://destinationhabit.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.kosidesigns.com.au
2024-09-16 07:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:59:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kosidesigns.com.au/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:04:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · stephanierupp.net
2024-09-16 07:58
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:58:52 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.stephanierupp.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.nasugbutransportcorp.com
2024-09-16 07:53
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:53:16 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Fri, 09 Aug 2024 02:01:58 GMT Accept-Ranges: bytes Content-Length: 20103 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: NATC <!DOCTYPE html> <html lang="zxx" class="no-js"> <head> <!-- Mobile Specific Meta --> <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no"> <!-- Favicon--> <link rel="shortcut icon" href="img/favicon.ico"> <!-- Author Meta --> <meta name="author" content="colorlib"> <!-- Meta Description --> <meta name="description" content=""> <!-- Meta Keyword --> <meta name="keywords" content=""> <!-- meta character set --> <meta charset="UTF-8"> <!-- Site Title --> <title>NATC</title> <link href="https://fonts.googleapis.com/css?family=Poppins:100,200,400,300,500,600,700" rel="stylesheet"> <!-- CSS ============================================= --> <link rel="stylesheet" href="css/linearicons.css"> <link rel="stylesheet" href="css/font-awesome.min.css"> <link rel="stylesheet" href="css/bootstrap.css"> <link rel="stylesheet" href="css/magnific-popup.css"> <link rel="stylesheet" href="css/nice-select.css"> <link rel="stylesheet" href="css/animate.min.css"> <link rel="stylesheet" href="css/jquery-ui.css"> <link rel="stylesheet" href="css/main.css"> <style> .select{ height:100px; overflow:scroll; } </style> </head> <body> <header id="header"> <div class="header-top"> </div> <div class="container main-menu"> <div class="row align-items-center justify-content-between d-flex"> <a href="index.html"><img src="img/logo.png" alt="" title="" /></a> <nav id="nav-menu-container"> <ul class="nav-menu"> <li class="menu-active"><a href="index.html">Home</a></li> <li><a href="about.html">About</a></li> <li><a href="rates.php">Rates</a></li> <li><a href="tracking.html">Tracking</a></li> <!--<li><a href="service.html">Services</a></li>--> <!--<li><a href="gallery.html">Gallery</a></li>--> <!--<li class="menu-has-children"><a href="">Blog</a>--> <!--<ul>--> <!--<li><a href="blog-home.html">Blog Home</a></li>--> <!--<li><a href="blog-single.html">Blog Single</a></li>--> <!--<li class="menu-has-children"><a href="">Level 2</a>--> <!--<ul>--> <!--<li><a href="#">Item One</a></li>--> <!--<li><a href="#">Item Two</a></li>--> <!--</ul>--> <!--</li> --> <!--</ul>--> <!--</li>--> <!--<li><a href="elements.html">Elements</a></li> --> <li><a href="contact.html">Contact</a></li> </ul> </nav><!-- #nav-menu-container --> </div> </div> </header><!-- #header --> <!-- start banner Area --> <section class="banner-area relative" id="home"> <div class="overlay overlay-bg"></div> <div class="container"> <div class="row fullscreen d-flex align-items-center justify-content-between"> <div class="banner-content col-lg-6 col-md-6"> <h4 class="text-white ">Do you need Airport Taxi?</h4> <div class=""> <h1 class="text-uppercase"> BOOK NOW! <br/> <small><a class="btn btn-success" href="https://nasugbutransportcorp.com/natransco.apk">Download App Here!</a></small> </h1> </div> </div> <div class="col-lg-4 col-md-6 header-right" style="background: #bde6e2 !important;"> <img src="img/natclogo.png" class="img-fluid" alt="" width="150"/> <br/> <br/> <h4 class="pb-30">Airport Transport Online!</h4> <form class="form" method="post" action="booking.php"> <div class="from-group"> <input class="form-control txt-field" required type="text" name="name" placeholder="Your name" oFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · bisbeejoe.com
2024-09-16 07:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:49:29 GMT Server: Apache Link: <https://bisbeejoe.com/wp-json/>; rel="https://api.w.org/", <https://bisbeejoe.com/wp-json/wp/v2/pages/84>; rel="alternate"; title="JSON"; type="application/json", <https://bisbeejoe.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · thebankinglady.com
2024-09-16 07:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:46:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:51:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: The Banking Lady — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>The Banking Lady — Coming Soon</title> <script src="https://thebankinglady.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thebankinglady.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thebankinglady.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · guardianmedtransport.com
2024-09-16 07:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:46:09 GMT Server: Apache Link: <https://guardianmedtransport.com/wp-json/>; rel="https://api.w.org/", <https://guardianmedtransport.com/wp-json/wp/v2/pages/278>; rel="alternate"; type="application/json", <https://guardianmedtransport.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.freedomfootage.babeslay.com
2024-09-16 07:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:45:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://freedomfootage.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:45:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: youtube_showcase_emd_wp_session=90e9a44cfb42d4df6cb32d7c13df54f2%7C%7C1726474520%7C%7C1726474160; expires=Mon, 16 Sep 2024 08:15:20 GMT; Max-Age=1800; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.oweless.tax
2024-09-16 07:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:43:56 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=c6eaddf92e19df6f09542775303c3336; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://oweless.tax/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.lzv.mqz.mybluehost.me
2024-09-16 07:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:43:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:43:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Kredyty Plus Minus — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Kredyty Plus Minus — Coming Soon</title> <script src="https://kredytyplusminus.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kredytyplusminus.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kredytyplusminus.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.olivardecardenas.rnsfonts.com
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:42:38 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.olivardecardenas.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.sunnybrookefootball.ca
2024-09-16 07:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:41:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sunnybrookefootball.ca/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:46:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: sunnybrooke-fr – Building winners one snap at a time <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta http-equiv="X-UA-Compatible" content="IE=10" /> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://sunnybrookefootball.ca/xmlrpc.php" /> <title>sunnybrooke-fr – Building winners one snap at a time</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//sunnybrookefootball.ca' /> <link rel="alternate" type="application/rss+xml" title="sunnybrooke-fr » Feed" href="https://sunnybrookefootball.ca/feed/" /> <link rel="alternate" type="application/rss+xml" title="sunnybrooke-fr » Comments Feed" href="https://sunnybrookefootball.ca/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/sunnybrookefootball.ca\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); /* ]]> */ </script> <style id='wp-emoji-styles-inline-css' type='text/css'> img.wp-smilFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.pcy.frl.mybluehost.me
2024-09-16 07:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:41:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 247 Location: https://buddysbeachhouse.my.canva.site/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:41:12 GMT X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 301 Moved Permanently <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>301 Moved Permanently</title> </head><body> <h1>Moved Permanently</h1> <p>The document has moved <a href="https://buddysbeachhouse.my.canva.site/">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.lagmanenterprises.com
2024-09-16 07:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:38:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://lagmanenterprises.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:38:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.sungmanhk.com
2024-09-16 07:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:38:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: bcb_HTTP.200,bcb_HTTP.301 X-Redirect-By: WordPress Location: https://sungmanhk.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.bcz.wbq.mybluehost.me
2024-09-16 07:37
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:37:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.bcz.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.bcz.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · kgpholding.com
2024-09-16 07:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:37:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kgpholding.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kgpholding.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kgpholding.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.xcw.xvx.mybluehost.me
2024-09-16 07:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:37:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: cctraining — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>cctraining — Coming Soon</title> <script src="https://cctraining.ca/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cctraining.ca/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cctraining.ca/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.madisonelitetrackclub.com
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:11 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://madisonelitetrackclub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · test.chipperparts.co.uk
2024-09-16 07:37
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:37:07 GMT Server: Apache Location: https://test.chipperparts.co.uk/cgi-sys/suspendedpage.cgi Content-Length: 241 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://test.chipperparts.co.uk/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · knightwatchpublishing.sirchase.com
2024-09-16 07:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:36:42 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.knightwatchpublishing.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · livinginorderlyfashion.com
2024-09-16 07:36
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 07:36:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Connection: close Transfer-Encoding: chunked Page title: WordPress › Error <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='max-image-preview:large, noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.beautyandthebestie.com
2024-09-16 07:36
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:36:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://www.beautyandthebestie.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.beautyandthebestie.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · soulofcontinuum.still-movement.com
2024-09-16 07:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:36:06 GMT Server: Apache X-Pingback: https://soulofcontinuum.com/xmlrpc.php Link: <https://soulofcontinuum.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://soulofcontinuum.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Soul of Continuum – Inspiring Movement for Body & Soul <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>Soul of Continuum – Inspiring Movement for Body & Soul</title> <link rel='dns-prefetch' href='//soulofcontinuum.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Soul of Continuum » Feed" href="https://soulofcontinuum.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Soul of Continuum » Comments Feed" href="https://soulofcontinuum.com/?feed=comments-rss2" /> <link rel="alternate" type="application/rss+xml" title="Soul of Continuum » Comments Feed" href="https://soulofcontinuum.com/?feed=rss2&page_id=2" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/soulofcontinuum.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.2.21"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://soulofcontinuum.com/wp-includes/css/dist/block-library/style.min.css?ver=5.2.21' type='text/css' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='https://soulofcontinuum.com/wp-includes/css/dist/block-library/theme.min.css?ver=5.2.21' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-style-css' href='https://soulofcontinuum.com/wp-content/themes/twentynineteen/style.css?ver=1.4' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-print-style-css' href='https://soulofcontinuum.com/wp-content/themes/twentynineteen/print.css?ver=1.4' type='text/css' media='print' /> <link rel='https://api.w.org/' href='https://soFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.suzannecleary.com
2024-09-16 07:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:35:23 GMT Server: Apache Link: <https://www.suzannecleary.com/wp-json/>; rel="https://api.w.org/", <https://www.suzannecleary.com/wp-json/wp/v2/pages/2920>; rel="alternate"; title="JSON"; type="application/json", <https://www.suzannecleary.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:40:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ibi.oqk.mybluehost.me
2024-09-16 07:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:34:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://toddschaap.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:34:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · wilken.co.ke
2024-09-16 07:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:34:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: e1d_HTTP.200,e1d_HTTP.301 X-Redirect-By: WordPress Location: https://wilken.co.ke/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:34:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dxs.oui.mybluehost.me
2024-09-16 07:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:33:44 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://xwatchshop.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.mai.hsk.mybluehost.me
2024-09-16 07:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:33:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.mai.hsk.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.mai.hsk.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.eby.wyz.mybluehost.me
2024-09-16 07:32
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:32:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.eby.wyz.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.eby.wyz.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.edencommunitychurch.org
2024-09-16 07:32
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:32:28 GMT Server: Apache Location: https://www.edenchurch.nz/ Content-Length: 210 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.edenchurch.nz/">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.afp.bqu.mybluehost.me
2024-09-16 07:32
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.trudysfoodies.com
2024-09-16 07:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:32:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.trudysfoodies.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/2NC7O>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.rfy.ext.mybluehost.me
2024-09-16 07:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:31:51 GMT Server: Apache Link: <https://quickleaserecover.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://quickleaserecover.com/index.php?rest_route=/wp/v2/pages/791>; rel="alternate"; type="application/json", <https://quickleaserecover.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · onc.rfn.mybluehost.me
2024-09-16 07:31
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:31:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://onc.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://onc.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.aueinc.net
2024-09-16 07:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:31:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aueinc.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:31:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.rmrconsult.com
2024-09-16 07:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:30:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.rmrconsult.com/wp-json/>; rel="https://api.w.org/", <https://www.rmrconsult.com/wp-json/wp/v2/pages/12402>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/P932QG-3e2>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:29:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.yqt.qzx.mybluehost.me
2024-09-16 07:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:29:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.yqt.qzx.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.yqt.qzx.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.website-4d0aa17c.sjl.ztl.mybluehost.me
2024-09-16 07:28
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:28:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 259 Location: http://www.website-4d0aa17c.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.website-4d0aa17c.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-cbc038cc.bza.ttm.mybluehost.me
2024-09-16 07:26
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.mai.hsk.mybluehost.me
2024-09-16 07:26
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:26:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.mai.hsk.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.mai.hsk.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.zqz.jdq.mybluehost.me
2024-09-16 07:25
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:25:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.zqz.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.zqz.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.nlq.ocl.mybluehost.me
2024-09-16 07:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:24:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://visiondefenderpro.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:24:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fvisiondefenderpro.com%2F; expires=Mon, 14 Oct 2024 07:24:40 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · investirbien.com
2024-09-16 07:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:23:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://investirbien.com/wp-json/>; rel="https://api.w.org/", <https://investirbien.com/wp-json/wp/v2/pages/73>; rel="alternate"; title="JSON"; type="application/json", <https://investirbien.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:23:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.jdq.vxg.mybluehost.me
2024-09-16 07:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:23:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://royal-events.ch/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:23:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.jul.wbq.mybluehost.me
2024-09-16 07:23
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:23:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.jul.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.jul.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-56ca12c5.upkeep.ae
2024-09-16 07:22
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:22:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 248 Location: https://www.website-56ca12c5.upkeep.ae/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.website-56ca12c5.upkeep.ae/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.zqz.jdq.mybluehost.me
2024-09-16 07:21
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:21:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.zqz.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.zqz.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · mail.zqz.jdq.mybluehost.me
2024-09-16 07:20
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:20:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://mail.zqz.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.zqz.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.kenaz-est.com
2024-09-16 07:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:19:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://kenaz-est.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://kenaz-est.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://kenaz-est.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.miiapuumala.fingoglobal.fi
2024-09-16 07:19
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:19:06 GMT Server: Apache Location: https://www.miiapuumala.fingoglobal.fi/cgi-sys/suspendedpage.cgi Content-Length: 248 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.miiapuumala.fingoglobal.fi/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.willisfam5adventures.com
2024-09-16 07:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:19:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://willisfam5adventures.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:24:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · jul.wbq.mybluehost.me
2024-09-16 07:18
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:18:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://jul.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://jul.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · aer.qps.mybluehost.me
2024-09-16 07:17
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:17:43 GMT Server: Apache Location: https://aer.qps.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 239 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://aer.qps.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · mail.kleincommunication7.com
2024-09-16 07:17
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:17:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 245 Location: http://mail.kleincommunication7.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.kleincommunication7.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ryusoso.com
2024-09-16 07:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:17:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:17:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Ryusoso — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Ryusoso — Coming Soon</title> <script src="https://ryusoso.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ryusoso.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ryusoso.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · bettyhallshopping.com
2024-09-16 07:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:17:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bettyhallshopping.com/wp-json/>; rel="https://api.w.org/", <https://bettyhallshopping.com/wp-json/wp/v2/pages/100>; rel="alternate"; title="JSON"; type="application/json", <https://bettyhallshopping.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:17:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · simplemarketing.io
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:17:03 GMT Server: Apache Location: https://simplemarketing.io/cgi-sys/suspendedpage.cgi Content-Length: 236 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://simplemarketing.io/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.stbess.com
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 232 Location: https://www.stbess.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.stbess.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · www.ueg.eln.mybluehost.me
2024-09-16 07:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:16:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://helpfulmba.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:16:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.bfc.vhl.mybluehost.me
2024-09-16 07:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:16:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://unusualtesla.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:16:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · tillisholdingsllc.com
2024-09-16 07:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:16:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tillisholdingsllc.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:16:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · dsw.vsb.mybluehost.me
2024-09-16 07:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:16:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://jimmydasilva.com/en/homepage/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · brit-mx.jph.uka.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 246 Location: http://brit-mx.jph.uka.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://brit-mx.jph.uka.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.aer.qps.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:18 GMT Server: Apache Location: https://www.aer.qps.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 243 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.aer.qps.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.aer.qps.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:18 GMT Server: Apache Location: https://mail.aer.qps.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 244 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.aer.qps.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.hny.bhx.mybluehost.me
2024-09-16 07:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:16:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hny.bhx.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:16:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.miriamlynn.co.uk
2024-09-16 07:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:15:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://miriamlynn.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:15:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.jqe.lnr.mybluehost.me
2024-09-16 07:15
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:15:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.jqe.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.jqe.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · maidinatlantacleaning.com
2024-09-16 07:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:15:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://www.maidinatlantacleaning.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · lyferesorts.com
2024-09-16 07:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:15:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.simplemarketing.io
2024-09-16 07:15
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:15:33 GMT Server: Apache Location: https://www.simplemarketing.io/cgi-sys/suspendedpage.cgi Content-Length: 240 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.simplemarketing.io/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ueg.eln.mybluehost.me
2024-09-16 07:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:15:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://helpfulmba.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:15:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · stbess.com
2024-09-16 07:15
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:15:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 227 Location: http://stbess.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://stbess.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · website-1e30f956.mpt.qsp.mybluehost.me
2024-09-16 07:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:14:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://oppmsinaloa.org.mx/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:14:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.taiwan-tourbus.com
2024-09-16 07:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:14:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://taiwan-tourbus.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:14:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.e-memoire.org
2024-09-16 07:14
HTTP/1.1 503 Service Unavailable Date: Mon, 16 Sep 2024 07:14:15 GMT Server: Apache Content-Length: 428 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 503 Service Unavailable <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>503 Service Unavailable</title> </head><body> <h1>Service Unavailable</h1> <p>The server is temporarily unable to service your request due to maintenance downtime or capacity problems. Please try again later.</p> <p>Additionally, a 503 Service Unavailable error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · tmb.bjl.mybluehost.me
2024-09-16 07:14
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:14:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: http://tmb.bjl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://tmb.bjl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ire.nsm.mybluehost.me
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://noriz-tel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:18:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: NorizTel LP – Business Voip <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <meta http-equiv="x-ua-compatible" content="ie=edge"> <title>NorizTel LP – Business Voip</title> <link rel='dns-prefetch' href='//noriz-tel.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Feed" href="https://noriz-tel.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="NorizTel LP » Comments Feed" href="https://noriz-tel.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/noriz-tel.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.26"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='contact-form-7-css' href='https://noriz-tel.com/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.0.4' type='text/css' media='all' /> <link rel='stylesheet' id='dima-take-action-css' href='https://noriz-tel.com/wp-content/plugins/dima-take-action/public/css/dima-take-action-public.css?ver=1.0.5' type='text/css' media='all' /> <link rel='stylesheet' id='rs-plugin-settings-css' href='https://noriz-tel.com/wp-content/plugins/revslider/public/assets/css/settings.css?ver=5.4.8' type='text/css' media='all' /> <style id='rs-plugin-settings-inline-css' type='text/css'> #rs-demo-id {} </style> <link rel='stylesheet' id='woocommerce-layout-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-layout.css?ver=3.4.8' type='text/css' media='all' /> <link rel='stylesheet' id='woocommerce-smallscreen-css' href='https://noriz-tel.com/wp-content/plugins/woocommerce/assets/css/woocommerce-smallscreen.css?ver=3.4.8' type='text/css' media='only screen and (maxFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-1e30f956.mpt.qsp.mybluehost.me
2024-09-16 07:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:13:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://oppmsinaloa.org.mx/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · tripsavior.com
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-cache WPO-Cache-Status: cached Last-Modified: Mon, 16 Sep 2024 01:15:30 GMT Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:18 GMT Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.winstonthetegu.com
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://winstonthetegu.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.kxb.fvs.mybluehost.me
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://crappyjobblog.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · lovehopeandautism.com
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lovehopeandautism.com/wp-json/>; rel="https://api.w.org/", <https://lovehopeandautism.com/wp-json/wp/v2/pages/101>; rel="alternate"; title="JSON"; type="application/json", <https://lovehopeandautism.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:18:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · insuranceshoppe.me
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://insuranceshoppe.me/index.php?rest_route=/>; rel="https://api.w.org/", <https://insuranceshoppe.me/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://insuranceshoppe.me/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.andymanblog.com
2024-09-16 07:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:13:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://andymanblog.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.bynathanbosley.com
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bynathanbosley.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.ruffguidemaps.com
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ruffguidemaps.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · api.e-plagiat.online
2024-09-16 07:12
HTTP/1.1 503 Service Unavailable Date: Mon, 16 Sep 2024 07:12:45 GMT Server: Apache Content-Length: 428 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 503 Service Unavailable <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>503 Service Unavailable</title> </head><body> <h1>Service Unavailable</h1> <p>The server is temporarily unable to service your request due to maintenance downtime or capacity problems. Please try again later.</p> <p>Additionally, a 503 Service Unavailable error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · premiumbeveragesllc.com
2024-09-16 07:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:12:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://premiumbeveragesllc.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://premiumbeveragesllc.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; title="JSON"; type="application/json", <https://premiumbeveragesllc.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:17:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.umm.mtr.mybluehost.me
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bettyhallshopping.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · vjm.ens.mybluehost.me
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://myprojecttutor.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · nlq.ocl.mybluehost.me
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://visiondefenderpro.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fvisiondefenderpro.com%2F; expires=Mon, 14 Oct 2024 07:12:07 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.det.hbq.mybluehost.me
2024-09-16 07:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:12:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://det.hbq.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · sgclmarketing.com
2024-09-16 07:12
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:12:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 234 Location: http://sgclmarketing.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://sgclmarketing.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.wlm.wog.mybluehost.me
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://angiebuyshouses.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.bagsfulloflove.org
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://bagsfulloflove.org/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:15:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.thedeeprootsapothecary.com
2024-09-16 07:10
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.thedeeprootsapothecary.com/wp-json/>; rel="https://api.w.org/", <https://www.thedeeprootsapothecary.com/wp-json/wp/v2/pages/685>; rel="alternate"; title="JSON"; type="application/json", <https://www.thedeeprootsapothecary.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.justontimeservice.com
2024-09-16 07:10
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://justontimeservice.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://justontimeservice.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://justontimeservice.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:80 · hpq.wev.mybluehost.me
2024-09-16 07:10
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:10:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: http://hpq.wev.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://hpq.wev.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · donnagaytyler.com
2024-09-16 07:10
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 07:10:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Page title: The VAST Podcast — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>The VAST Podcast — Coming Soon</title> <script src="https://donnagaytyler.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://donnagaytyler.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://donnagaytyler.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-f6fe3998.sjl.ztl.mybluehost.me
2024-09-16 07:10
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:10:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 260 Location: https://www.website-f6fe3998.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.website-f6fe3998.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.nanutanu.grm.csp.mybluehost.me
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://nanutanu.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.gta.pmc.mybluehost.me
2024-09-16 07:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:01 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 07:10:04 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Yuankun Huang's Blog — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Yuankun Huang's Blog — Coming Soon</title> <script src="https://yuankunhuang.blog/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://yuankunhuang.blog/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://yuankunhuang.blog/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-8159fce1.sjl.ztl.mybluehost.me
2024-09-16 07:09
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:10:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 260 Location: https://www.website-8159fce1.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.website-8159fce1.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-4d0aa17c.sjl.ztl.mybluehost.me
2024-09-16 07:09
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:09:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 260 Location: https://www.website-4d0aa17c.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.website-4d0aa17c.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mjg.rew.mybluehost.me
2024-09-16 07:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:09:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://bapumay.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bapumay.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bapumay.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.junctionroadfp.com.au
2024-09-16 07:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:09:18 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://junctionroadfp.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.bkm4prez.com
2024-09-16 07:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:09:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bkm4prez.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:14:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.hkr.hgn.mybluehost.me
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aliciasharp.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.jaimemedia.com
2024-09-16 07:08
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:08:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 236 Location: https://www.jaimemedia.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.jaimemedia.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · cassenergyhealer.co.uk
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cassenergyhealer.co.uk/wp-json/>; rel="https://api.w.org/", <https://cassenergyhealer.co.uk/wp-json/wp/v2/pages/136>; rel="alternate"; title="JSON"; type="application/json", <https://cassenergyhealer.co.uk/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.techpointsales.com
2024-09-16 07:08
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:08:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 241 Location: https://mail.techpointsales.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.techpointsales.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.fundacionprolongar.org
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 cf-edge-cache: cache,platform=wordpress Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://fundacionprolongar.org/es/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=1eed535576164d240101325225e8057b; path=/ Set-Cookie: pll_language=es; expires=Tue, 16-Sep-2025 07:08:31 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.website-cd47f3df.livewholistic.com
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: d3a_HTTP.200,d3a_HTTP.301 X-Redirect-By: WordPress Location: https://wholisticfertility.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · adonebbbm.store
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://adonebbbm.store/wp-json/>; rel="https://api.w.org/", <https://adonebbbm.store/wp-json/wp/v2/pages/7>; rel="alternate"; type="application/json", <https://adonebbbm.store/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 1 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 07:08:23 GMT; Max-Age=315360000; path=/ Set-Cookie: wp_llms_session_c5a9ef501e000fb40143c7b1d059da40=d3e4c4532293dc1cbba8a70c76ddc002%7C%7C1726492104%7C%7C1726488504%7C%7C5630b2b421e7b01163a0c0bc4da31f04; expires=Mon, 16 Sep 2024 13:08:24 GMT; Max-Age=21600; path=/; secure; HttpOnly Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.deltaprimeconsulting.com
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://deltaprimeconsulting.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · jettprep.com
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jettprep.com/wp-json/>; rel="https://api.w.org/", <https://jettprep.com/wp-json/wp/v2/pages/5008>; rel="alternate"; title="JSON"; type="application/json", <https://jettprep.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: ays_popup_cookie_1=Demo%20Title; expires=Mon, 16 Sep 2024 07:07:20 GMT; Max-Age=0; path=/ Set-Cookie: ays_popup_cookie_2=Contact; expires=Mon, 16 Sep 2024 07:07:20 GMT; Max-Age=0; path=/ Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.hth.hzw.mybluehost.me
2024-09-16 07:08
HTTP/1.1 409 Conflict Date: Mon, 16 Sep 2024 07:08:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 83 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== <script>document.cookie = "humans_21909=1"; document.location.reload(true)</script>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · website-4d0aa17c.sjl.ztl.mybluehost.me
2024-09-16 07:07
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:08:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 256 Location: https://website-4d0aa17c.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://website-4d0aa17c.sjl.ztl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · kyriandrake.sumptuousspoonfuls.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: kyriandrake.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>kyriandrake.com — Coming Soon</title> <script src="https://kyriandrake.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kyriandrake.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kyriandrake.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.deweyread.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://deweyread.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · ndm.yek.mybluehost.me
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://heathergargis.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.hxx.qtw.mybluehost.me
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://hxx.qtw.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hxx.qtw.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hxx.qtw.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · hopsonlaw.courtneysimone.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: The Hopson Firm — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>The Hopson Firm — Coming Soon</title> <script src="https://hopsonlaw.courtneysimone.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hopsonlaw.courtneysimone.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hopsonlaw.courtneysimone.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.thecedarwoodcottage.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thecedarwoodcottage.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · truthseekers.lifestruth.org
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://truthseekers.lifestruth.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.premiumbeveragesllc.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://premiumbeveragesllc.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://premiumbeveragesllc.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; title="JSON"; type="application/json", <https://premiumbeveragesllc.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.tvp.gro.mybluehost.me
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cybridtechnology.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_llms_session_a577a37243d0a941e1494ecfc495c34d=4cb532c6c2f05686293cadec6b795b96%7C%7C1726492054%7C%7C1726488454%7C%7Cbdb5f715a92f4fa0bd966563b67e0cd0; expires=Mon, 16 Sep 2024 13:07:34 GMT; Max-Age=21600; path=/; secure; HttpOnly
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.insuranceladyusa.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://insuranceladyusa.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://insuranceladyusa.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://insuranceladyusa.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · tomikahaynes.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tomikahaynes.com/wp-json/>; rel="https://api.w.org/", <https://tomikahaynes.com/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://tomikahaynes.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.zsl.sco.mybluehost.me
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://formoreinformation.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · darkhorsesleddogs.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.darkhorsesleddogs.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · www.sctplayhouse.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sctplayhouse.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · fairytaletravelguide.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://fairytaletravelguide.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.107:443 · mail.theicingonmycake.com
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: theicingonmycake.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>theicingonmycake.com — Coming Soon</title> <script src="https://theicingonmycake.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://theicingonmycake.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> <div id="subscribe-text"> <p>Be the first to know when we launch, enter your email address and we will let you know when we go live and any future website updates we have.</p> </div> <div id="success" class="status-message"> Thank you, please check your email to confirm your subscription. </div> <div id="error-active" class="status-message"> Your email address is already subscribed to this website. Stay tuned to your inbox for our updates or try a different email address. </div> <div id="error-invalid" class="status-message"> There was an error with your submission and you were not subscribed. Please try again with a valid email address. </div> <form action="" method="post" accept-charset="utf-8" id="subscribe"> <input type="hidden" name="action" value="newfold_coming_soon_subscribe"> <input type="hidden" id="newfold-nonce-coming-soon-subscribe" name="newfold-nonce-coming-soon-subscribe" value="51254abfda" /><input type="hidden" name="_wp_http_referer" value="/" /> <span class="inputs email" id="subscribe-email"> <label id="subscribe-label" for="subscribe-field"> Email </label> <input type="email" name="email" required="required" value="" id="subscribe-field" placeholder="Enter your email address" > </span> <span class="inputs submit" id="subscribe-submit"> <input class="btn" type="submit" value="Subscribe" name="subscriptions_widget"> </span> </form> <script> var ajaxscript = { ajax_url: 'https://theicingonmycake.com/wp-admin/admin-ajax.php' }; jQuery(document).ready(function ($) { $('#subscribe-submFound 19 hours ago by HttpPluginCreate report
autodiscover.sctplayhouse.comcpanel.sctplayhouse.comcpcalendars.sctplayhouse.comcpcontacts.sctplayhouse.commail.sctplayhouse.comsctplayhouse.comsctplayhouse.sctplayhouse.orgwebdisk.sctplayhouse.comwebmail.sctplayhouse.comwww.sctplayhouse.comwww.sctplayhouse.sctplayhouse.org
autodiscover.wildsideworkouts.comcpanel.wildsideworkouts.comcpcalendars.wildsideworkouts.comcpcontacts.wildsideworkouts.commail.wildsideworkouts.comwebdisk.wildsideworkouts.comwebmail.wildsideworkouts.comwildsideworkouts.comwww.wildsideworkouts.com
autodiscover.xcj.cul.mybluehost.mecpanel.xcj.cul.mybluehost.mecpcalendars.xcj.cul.mybluehost.mecpcontacts.xcj.cul.mybluehost.memail.usaworldchampionships.commail.xcj.cul.mybluehost.meusaworldchampionships.comwebdisk.xcj.cul.mybluehost.mewebmail.xcj.cul.mybluehost.mewww.usaworldchampionships.comwww.xcj.cul.mybluehost.mexcj.cul.mybluehost.me
*.bluehost.combluehost.com
autodiscover.svolgere.financecpanel.svolgere.financecpcalendars.svolgere.financecpcontacts.svolgere.financemail.svolgere.financesvolgere.financewebdisk.svolgere.financewebmail.svolgere.financewebsite-ca2828d1.rxy.uqp.mybluehost.mewww.svolgere.financewww.website-ca2828d1.rxy.uqp.mybluehost.me
autodiscover.oweless.taxcpanel.oweless.taxcpcalendars.oweless.taxcpcontacts.oweless.taxmail.oweless.taxoweless-tax.diydebtsolution.comoweless.taxwebdisk.oweless.taxwebmail.oweless.taxwww.oweless-tax.diydebtsolution.comwww.oweless.tax
autodiscover.aza.mhj.mybluehost.meaza.mhj.mybluehost.mecpanel.aza.mhj.mybluehost.mecpcalendars.aza.mhj.mybluehost.mecpcontacts.aza.mhj.mybluehost.memail.aza.mhj.mybluehost.mewebdisk.aza.mhj.mybluehost.mewebmail.aza.mhj.mybluehost.mewww.aza.mhj.mybluehost.me
autodiscover.coloringthemind.comcoloringthemind.comcpanel.coloringthemind.comcpcalendars.coloringthemind.comcpcontacts.coloringthemind.commail.coloringthemind.comwebdisk.coloringthemind.comwebmail.coloringthemind.comwww.coloringthemind.com
autodiscover.cabaninsurance.comautodiscover.insuranceshoppe.mecabaninsurance.comcabaninsurance.havemedicare.comcpanel.cabaninsurance.comcpanel.insuranceshoppe.mecpcalendars.cabaninsurance.comcpcalendars.insuranceshoppe.mecpcontacts.cabaninsurance.comcpcontacts.insuranceshoppe.meinsuranceshoppe-me.havemedicare.cominsuranceshoppe.memail.cabaninsurance.commail.insuranceshoppe.mewebdisk.cabaninsurance.comwebdisk.insuranceshoppe.mewebmail.cabaninsurance.comwebmail.insuranceshoppe.mewww.cabaninsurance.comwww.cabaninsurance.havemedicare.comwww.insuranceshoppe-me.havemedicare.comwww.insuranceshoppe.me
autodiscover.christianityculture.comchristianityculture.comcpanel.christianityculture.comcpcalendars.christianityculture.comcpcontacts.christianityculture.commail.christianityculture.commail.slaveckmoraru.commail.zdb.xgd.mybluehost.meslaveckmoraru.comwebdisk.christianityculture.comwebmail.christianityculture.comwww.christianityculture.comwww.slaveckmoraru.comwww.zdb.xgd.mybluehost.mezdb.xgd.mybluehost.me
autodiscover.uxl.enu.mybluehost.mebloomnbroom.comcpanel.uxl.enu.mybluehost.mecpcalendars.uxl.enu.mybluehost.mecpcontacts.uxl.enu.mybluehost.memail.bloomnbroom.commail.uxl.enu.mybluehost.meuxl.enu.mybluehost.mewebdisk.uxl.enu.mybluehost.mewebmail.uxl.enu.mybluehost.mewww.bloomnbroom.comwww.uxl.enu.mybluehost.me
autodiscover.zot.cex.mybluehost.mecpanel.zot.cex.mybluehost.mecpcalendars.zot.cex.mybluehost.mecpcontacts.zot.cex.mybluehost.memail.ryusoso.commail.zot.cex.mybluehost.meryusoso.comwebdisk.zot.cex.mybluehost.mewebmail.zot.cex.mybluehost.mewww.ryusoso.comwww.zot.cex.mybluehost.mezot.cex.mybluehost.me
abbachildrenhome.orgautodiscover.zzj.boy.mybluehost.mecpanel.zzj.boy.mybluehost.mecpcalendars.zzj.boy.mybluehost.mecpcontacts.zzj.boy.mybluehost.memail.abbachildrenhome.orgmail.zzj.boy.mybluehost.mewebdisk.zzj.boy.mybluehost.mewebmail.zzj.boy.mybluehost.mewww.abbachildrenhome.orgwww.zzj.boy.mybluehost.mezzj.boy.mybluehost.me
autodiscover.vtk.pyw.mybluehost.mebookishgirlsblog.comcpanel.vtk.pyw.mybluehost.mecpcalendars.vtk.pyw.mybluehost.mecpcontacts.vtk.pyw.mybluehost.memail.bookishgirlsblog.commail.vtk.pyw.mybluehost.mevtk.pyw.mybluehost.mewebdisk.vtk.pyw.mybluehost.mewebmail.vtk.pyw.mybluehost.mewww.bookishgirlsblog.comwww.vtk.pyw.mybluehost.me
autodiscover.sofoodtastic.comcpanel.sofoodtastic.comcpcalendars.sofoodtastic.comcpcontacts.sofoodtastic.commail.sofoodtastic.comsofoodtastic.comwebdisk.sofoodtastic.comwebmail.sofoodtastic.comwww.sofoodtastic.com
autodiscover.dsw.vsb.mybluehost.mecpanel.dsw.vsb.mybluehost.mecpcalendars.dsw.vsb.mybluehost.mecpcontacts.dsw.vsb.mybluehost.medsw.vsb.mybluehost.mejimmydasilva.commail.dsw.vsb.mybluehost.mewebdisk.dsw.vsb.mybluehost.mewebmail.dsw.vsb.mybluehost.mewww.dsw.vsb.mybluehost.mewww.jimmydasilva.com
asf.vvo.mybluehost.meautodiscover.asf.vvo.mybluehost.mecpanel.asf.vvo.mybluehost.mecpcalendars.asf.vvo.mybluehost.mecpcontacts.asf.vvo.mybluehost.megym-ergy.commail.asf.vvo.mybluehost.memail.gym-ergy.comwebdisk.asf.vvo.mybluehost.mewebmail.asf.vvo.mybluehost.mewww.asf.vvo.mybluehost.mewww.gym-ergy.com
autodiscover.xsn.dfv.mybluehost.mecpanel.xsn.dfv.mybluehost.mecpcalendars.xsn.dfv.mybluehost.mecpcontacts.xsn.dfv.mybluehost.memail.clarkedonelsonphoto.commail.xsn.dfv.mybluehost.mewebdisk.xsn.dfv.mybluehost.mewebmail.xsn.dfv.mybluehost.mewww.xsn.dfv.mybluehost.mexsn.dfv.mybluehost.me
autodiscover.zki.hju.mybluehost.mecpanel.zki.hju.mybluehost.mecpcalendars.zki.hju.mybluehost.mecpcontacts.zki.hju.mybluehost.mehannahsprague2025.commail.hannahsprague2025.commail.zki.hju.mybluehost.mewebdisk.zki.hju.mybluehost.mewebmail.zki.hju.mybluehost.mewww.hannahsprague2025.comwww.zki.hju.mybluehost.mezki.hju.mybluehost.me
autodiscover.id4.mxautodiscover.irei.com.mxcpanel.id4.mxcpanel.irei.com.mxcpcalendars.id4.mxcpcalendars.irei.com.mxcpcontacts.id4.mxcpcontacts.irei.com.mxid4-mx.grm.csp.mybluehost.meid4.mxirei-com-mx.grm.csp.mybluehost.meirei.com.mxmail.id4.mxmail.irei.com.mxwebdisk.id4.mxwebdisk.irei.com.mxwebmail.id4.mxwebmail.irei.com.mxwww.id4-mx.grm.csp.mybluehost.mewww.id4.mxwww.irei-com-mx.grm.csp.mybluehost.mewww.irei.com.mx
adarsh.theorphic.spacewww.adarsh.theorphic.space
autodiscover.rrd.bow.mybluehost.mecpanel.rrd.bow.mybluehost.mecpcalendars.rrd.bow.mybluehost.mecpcontacts.rrd.bow.mybluehost.megetasafetynet.comgreefinsurance.commail.getasafetynet.commail.greefinsurance.commail.rrd.bow.mybluehost.merrd.bow.mybluehost.mewebdisk.rrd.bow.mybluehost.mewebmail.rrd.bow.mybluehost.mewww.getasafetynet.comwww.greefinsurance.comwww.rrd.bow.mybluehost.me
autodiscover.visimony.comcpanel.visimony.comcpcalendars.visimony.comcpcontacts.visimony.commail.visimony.comvisimony.comwebdisk.visimony.comwebmail.visimony.comwebsite-b445bfff.mkz.tuk.mybluehost.mewww.visimony.comwww.website-b445bfff.mkz.tuk.mybluehost.me
autodiscover.endlessdiscoveries.netcpanel.endlessdiscoveries.netcpcalendars.endlessdiscoveries.netcpcontacts.endlessdiscoveries.netendlessdiscoveries.netmail.endlessdiscoveries.netwebdisk.endlessdiscoveries.netwebmail.endlessdiscoveries.netwww.endlessdiscoveries.net
autodiscover.keratintreatment.hairautodiscover.samysbeauty.comcpanel.keratintreatment.haircpanel.samysbeauty.comcpcalendars.keratintreatment.haircpcalendars.samysbeauty.comcpcontacts.keratintreatment.haircpcontacts.samysbeauty.comkeratintreatment-hair.samysbeauty.comkeratintreatment.hairmail.keratintreatment.hairmail.ozq.wvf.mybluehost.memail.samysbeauty.comozq.wvf.mybluehost.mesamysbeauty.comwebdisk.keratintreatment.hairwebdisk.samysbeauty.comwebmail.keratintreatment.hairwebmail.samysbeauty.comwww.keratintreatment-hair.samysbeauty.comwww.keratintreatment.hairwww.ozq.wvf.mybluehost.mewww.samysbeauty.com
autodiscover.ylz.hgn.mybluehost.mecpanel.ylz.hgn.mybluehost.mecpcalendars.ylz.hgn.mybluehost.mecpcontacts.ylz.hgn.mybluehost.memail.ylz.hgn.mybluehost.mewebdisk.ylz.hgn.mybluehost.mewebmail.ylz.hgn.mybluehost.mewww.ylz.hgn.mybluehost.meylz.hgn.mybluehost.me
autodiscover.lightoflovephotography.comcpanel.lightoflovephotography.comcpcalendars.lightoflovephotography.comcpcontacts.lightoflovephotography.comlightoflovephotography.commail.lightoflovephotography.comwebdisk.lightoflovephotography.comwebmail.lightoflovephotography.comwww.lightoflovephotography.com
autodiscover.faltdyep.comcpanel.faltdyep.comcpcalendars.faltdyep.comcpcontacts.faltdyep.comfaltdyep.commail.faltdyep.comwebdisk.faltdyep.comwebmail.faltdyep.comwww.faltdyep.com
autodiscover.casasanpablo.comcasasanpablo.comcpanel.casasanpablo.comcpcalendars.casasanpablo.comcpcontacts.casasanpablo.commail.casasanpablo.comwebdisk.casasanpablo.comwebmail.casasanpablo.comwww.casasanpablo.com
maidinatlantacleaning.comwww.maidinatlantacleaning.com
autodiscover.zfm.upt.mybluehost.mecpanel.zfm.upt.mybluehost.mecpcalendars.zfm.upt.mybluehost.mecpcontacts.zfm.upt.mybluehost.memail.napa-story.commail.nbd.upt.mybluehost.memail.zfm.upt.mybluehost.menapa-story.comnbd.upt.mybluehost.mewebdisk.zfm.upt.mybluehost.mewebmail.zfm.upt.mybluehost.mewww.napa-story.comwww.nbd.upt.mybluehost.mewww.zfm.upt.mybluehost.me
autodiscover.campinglyfe.comcampinglyfe.comcampinglyfe.viewserendib.comcpanel.campinglyfe.comcpanel.viewserendib.comcpcalendars.campinglyfe.comcpcalendars.viewserendib.comcpcontacts.campinglyfe.comcpcontacts.viewserendib.comkpm.hdv.mybluehost.memail.campinglyfe.commail.kpm.hdv.mybluehost.memail.viewserendib.comwebdisk.campinglyfe.comwebdisk.viewserendib.comwebmail.campinglyfe.comwebmail.viewserendib.comwww.campinglyfe.comwww.campinglyfe.viewserendib.comwww.kpm.hdv.mybluehost.me
autodiscover.ferventforever.comcpanel.ferventforever.comcpcalendars.ferventforever.comcpcontacts.ferventforever.comferventforever.comforeverfervent.commail.ferventforever.commail.foreverfervent.comwebdisk.ferventforever.comwebmail.ferventforever.comwww.ferventforever.comwww.foreverfervent.com
casinsure.comcasinsure.havemedicare.comcpanel.casinsure.comcpanel.palomainsurance.comcpcalendars.casinsure.comcpcalendars.palomainsurance.comcpcontacts.casinsure.comcpcontacts.palomainsurance.commail.casinsure.commail.palomainsurance.compalomainsurance.compalomainsurance.havemedicare.comwebdisk.casinsure.comwebdisk.palomainsurance.comwebmail.casinsure.comwebmail.palomainsurance.comwww.casinsure.comwww.casinsure.havemedicare.comwww.palomainsurance.comwww.palomainsurance.havemedicare.com
autodiscover.hry.qhd.mybluehost.meby-amysue.comcpanel.hry.qhd.mybluehost.mecpcalendars.hry.qhd.mybluehost.mecpcontacts.hry.qhd.mybluehost.mehry.qhd.mybluehost.memail.by-amysue.commail.hry.qhd.mybluehost.mewebdisk.hry.qhd.mybluehost.mewebmail.hry.qhd.mybluehost.mewww.by-amysue.comwww.hry.qhd.mybluehost.me
autodiscover.onc.rfn.mybluehost.mecfoofsaas.comcpanel.onc.rfn.mybluehost.mecpcalendars.onc.rfn.mybluehost.mecpcontacts.onc.rfn.mybluehost.memail.cfoofsaas.commail.onc.rfn.mybluehost.meonc.rfn.mybluehost.mewebdisk.onc.rfn.mybluehost.mewebmail.onc.rfn.mybluehost.mewww.cfoofsaas.comwww.onc.rfn.mybluehost.me
autodiscover.wql.hzh.mybluehost.mecpanel.wql.hzh.mybluehost.mecpcalendars.wql.hzh.mybluehost.mecpcontacts.wql.hzh.mybluehost.medrlindaenoh.commail.drlindaenoh.commail.wql.hzh.mybluehost.mewebdisk.wql.hzh.mybluehost.mewebmail.wql.hzh.mybluehost.mewql.hzh.mybluehost.mewww.drlindaenoh.comwww.wql.hzh.mybluehost.me
autodiscover.realidadciudadana.comcpanel.realidadciudadana.comcpcalendars.realidadciudadana.comcpcontacts.realidadciudadana.commail.realidadciudadana.comrealidadciudadana.bettyhallshopping.comrealidadciudadana.comwebdisk.realidadciudadana.comwebmail.realidadciudadana.comwww.realidadciudadana.bettyhallshopping.comwww.realidadciudadana.com
autodiscover.eby.wyz.mybluehost.mechestnutsweets.comcpanel.eby.wyz.mybluehost.mecpcalendars.eby.wyz.mybluehost.mecpcontacts.eby.wyz.mybluehost.meeby.wyz.mybluehost.memail.chestnutsweets.commail.eby.wyz.mybluehost.mewebdisk.eby.wyz.mybluehost.mewebmail.eby.wyz.mybluehost.mewww.chestnutsweets.comwww.eby.wyz.mybluehost.me
autodiscover.stalledproject.comautodiscover.stalledprojects.comcpanel.stalledproject.comcpanel.stalledprojects.comcpcalendars.stalledproject.comcpcalendars.stalledprojects.comcpcontacts.stalledproject.comcpcontacts.stalledprojects.commail.stalledproject.commail.stalledprojects.comstalledproject.comstalledproject.stalledprojects.comstalledprojects.comwebdisk.stalledproject.comwebdisk.stalledprojects.comwebmail.stalledproject.comwebmail.stalledprojects.comwww.stalledproject.comwww.stalledproject.stalledprojects.comwww.stalledprojects.com
autodiscover.jzi.rmg.mybluehost.mecpanel.jzi.rmg.mybluehost.mecpcalendars.jzi.rmg.mybluehost.mecpcontacts.jzi.rmg.mybluehost.mejzi.rmg.mybluehost.memail.jzi.rmg.mybluehost.metiffryah.comwebdisk.jzi.rmg.mybluehost.mewebmail.jzi.rmg.mybluehost.mewww.jzi.rmg.mybluehost.me
autodiscover.roq.swq.mybluehost.mecpanel.roq.swq.mybluehost.mecpcalendars.roq.swq.mybluehost.mecpcontacts.roq.swq.mybluehost.memail.roq.swq.mybluehost.memail.sungmanhk.comroq.swq.mybluehost.mesungmanhk.comwebdisk.roq.swq.mybluehost.mewebmail.roq.swq.mybluehost.mewww.roq.swq.mybluehost.mewww.sungmanhk.com
autodiscover.tbh.qjv.mybluehost.mecpanel.tbh.qjv.mybluehost.mecpcalendars.tbh.qjv.mybluehost.mecpcontacts.tbh.qjv.mybluehost.meevergreennotebuyer.commail.evergreennotebuyer.commail.tbh.qjv.mybluehost.metbh.qjv.mybluehost.mewebdisk.tbh.qjv.mybluehost.mewebmail.tbh.qjv.mybluehost.mewww.evergreennotebuyer.comwww.tbh.qjv.mybluehost.me
aad.dei.mybluehost.meautodiscover.aad.dei.mybluehost.mebereant.comcpanel.aad.dei.mybluehost.mecpcalendars.aad.dei.mybluehost.mecpcontacts.aad.dei.mybluehost.memail.aad.dei.mybluehost.memail.bereant.comwebdisk.aad.dei.mybluehost.mewebmail.aad.dei.mybluehost.mewww.aad.dei.mybluehost.mewww.bereant.com
autodiscover.eduresourceteam.comautodiscover.recruitfit.netcpanel.eduresourceteam.comcpanel.recruitfit.netcpcalendars.eduresourceteam.comcpcalendars.recruitfit.netcpcontacts.eduresourceteam.comcpcontacts.recruitfit.neteduresourceteam.comilz.fgc.mybluehost.memail.eduresourceteam.commail.ilz.fgc.mybluehost.memail.recruitfit.netrecruitfit.netwebdisk.eduresourceteam.comwebdisk.recruitfit.netwebmail.eduresourceteam.comwebmail.recruitfit.netwebsite-9f122a69.eduresourceteam.comwww.eduresourceteam.comwww.ilz.fgc.mybluehost.mewww.recruitfit.netwww.website-9f122a69.eduresourceteam.com
autodiscover.golddiggermercantile.comcpanel.golddiggermercantile.comcpcalendars.golddiggermercantile.comcpcontacts.golddiggermercantile.comgolddiggermercantile.commail.golddiggermercantile.comshop.golddiggermercantile.comwebdisk.golddiggermercantile.comwebmail.golddiggermercantile.comwebsite-ec9ce09c.rxy.uqp.mybluehost.mewww.golddiggermercantile.comwww.shop.golddiggermercantile.comwww.website-ec9ce09c.rxy.uqp.mybluehost.me
nanutanu.grm.csp.mybluehost.mewww.nanutanu.grm.csp.mybluehost.me
autodiscover.hhh.bow.mybluehost.mecpanel.hhh.bow.mybluehost.mecpcalendars.hhh.bow.mybluehost.mecpcontacts.hhh.bow.mybluehost.mehhh.bow.mybluehost.meiton.storemail.hhh.bow.mybluehost.memail.iton.storewebdisk.hhh.bow.mybluehost.mewebmail.hhh.bow.mybluehost.mewww.hhh.bow.mybluehost.mewww.iton.store
autodiscover.gml.feb.mybluehost.mecpanel.gml.feb.mybluehost.mecpcalendars.gml.feb.mybluehost.mecpcontacts.gml.feb.mybluehost.megml.feb.mybluehost.memail.gml.feb.mybluehost.metripsavior.comwebdisk.gml.feb.mybluehost.mewebmail.gml.feb.mybluehost.mewww.gml.feb.mybluehost.mewww.tripsavior.com
ezd.zcr.mybluehost.me
autodiscover.jaladmissions.comcpanel.jaladmissions.comcpcalendars.jaladmissions.comcpcontacts.jaladmissions.comjaladmissions.commail.jaladmissions.comwebdisk.jaladmissions.comwebmail.jaladmissions.comwww.jaladmissions.com
autodiscover.cyr.fgc.mybluehost.mecpanel.cyr.fgc.mybluehost.mecpcalendars.cyr.fgc.mybluehost.mecpcontacts.cyr.fgc.mybluehost.mecyr.fgc.mybluehost.mediamondmemory.netmail.cyr.fgc.mybluehost.memail.diamondmemory.netwebdisk.cyr.fgc.mybluehost.mewebmail.cyr.fgc.mybluehost.mewww.cyr.fgc.mybluehost.mewww.diamondmemory.net
autodiscover.nlq.ocl.mybluehost.mecpanel.nlq.ocl.mybluehost.mecpcalendars.nlq.ocl.mybluehost.mecpcontacts.nlq.ocl.mybluehost.memail.nlq.ocl.mybluehost.memail.visiondefenderpro.comnlq.ocl.mybluehost.mevisiondefenderpro.comwebdisk.nlq.ocl.mybluehost.mewebmail.nlq.ocl.mybluehost.mewww.nlq.ocl.mybluehost.mewww.visiondefenderpro.com
vitalitymastery.co.ukwww.vitalitymastery.co.uk
selabuildstx.comwww.selabuildstx.com
autodiscover.ourmoments.auautodiscover.ourmoments.com.aucpanel.ourmoments.aucpanel.ourmoments.com.aucpcalendars.ourmoments.aucpcalendars.ourmoments.com.aucpcontacts.ourmoments.aucpcontacts.ourmoments.com.aumail.ourmoments.aumail.ourmoments.com.auourmoments.auourmoments.com.auwebdisk.ourmoments.auwebdisk.ourmoments.com.auwebmail.ourmoments.auwebmail.ourmoments.com.auwebsite-2fb1a1cb.irz.zga.mybluehost.mewebsite-68c0d8d7.irz.zga.mybluehost.mewww.ourmoments.auwww.ourmoments.com.auwww.website-2fb1a1cb.irz.zga.mybluehost.mewww.website-68c0d8d7.irz.zga.mybluehost.me
autodiscover.uuw.rbb.mybluehost.mecpanel.uuw.rbb.mybluehost.mecpcalendars.uuw.rbb.mybluehost.mecpcontacts.uuw.rbb.mybluehost.memail.uuw.rbb.mybluehost.memail.waygookincookin.comuuw.rbb.mybluehost.mewaygookincookin.comwebdisk.uuw.rbb.mybluehost.mewebmail.uuw.rbb.mybluehost.mewww.uuw.rbb.mybluehost.mewww.waygookincookin.com
autodiscover.vhu.vgn.mybluehost.mebibarecateringservices.comcpanel.vhu.vgn.mybluehost.mecpcalendars.vhu.vgn.mybluehost.mecpcontacts.vhu.vgn.mybluehost.memail.bibarecateringservices.commail.vhu.vgn.mybluehost.mevhu.vgn.mybluehost.mewebdisk.vhu.vgn.mybluehost.mewebmail.vhu.vgn.mybluehost.mewww.bibarecateringservices.comwww.vhu.vgn.mybluehost.me
autodiscover.kayeokearny.comautodiscover.notemusings.comcpanel.kayeokearny.comcpanel.notemusings.comcpcalendars.kayeokearny.comcpcalendars.notemusings.comcpcontacts.kayeokearny.comcpcontacts.notemusings.comkayeokearny.comkayeokearny.notemusings.commail.kayeokearny.commail.notemusings.comnotemusings.comwebdisk.kayeokearny.comwebdisk.notemusings.comwebmail.kayeokearny.comwebmail.notemusings.comwww.kayeokearny.comwww.kayeokearny.notemusings.comwww.notemusings.com
autodiscover.byc.dvw.mybluehost.mebyc.dvw.mybluehost.mecpanel.byc.dvw.mybluehost.mecpcalendars.byc.dvw.mybluehost.mecpcontacts.byc.dvw.mybluehost.memail.byc.dvw.mybluehost.memail.theastralmode.comtheastralmode.comwebdisk.byc.dvw.mybluehost.mewebmail.byc.dvw.mybluehost.mewww.byc.dvw.mybluehost.mewww.theastralmode.com
autodiscover.cybridtechnology.comcpanel.cybridtechnology.comcpcalendars.cybridtechnology.comcpcontacts.cybridtechnology.comcybridtechnology.commail.cybridtechnology.commail.tvp.gro.mybluehost.metvp.gro.mybluehost.mewebdisk.cybridtechnology.comwebmail.cybridtechnology.comwww.cybridtechnology.comwww.tvp.gro.mybluehost.me
austinb.xyzaustinbrittain.comautodiscover.austinb.xyzcpanel.austinb.xyzcpcalendars.austinb.xyzcpcontacts.austinb.xyzmail.austinb.xyzmail.austinbrittain.comwebdisk.austinb.xyzwebmail.austinb.xyzwww.austinb.xyzwww.austinbrittain.com
autodiscover.eef.rwz.mybluehost.mecpanel.eef.rwz.mybluehost.mecpcalendars.eef.rwz.mybluehost.mecpcontacts.eef.rwz.mybluehost.meeef.rwz.mybluehost.melfnlafricaine.commail.eef.rwz.mybluehost.memail.lfnlafricaine.comwebdisk.eef.rwz.mybluehost.mewebmail.eef.rwz.mybluehost.mewww.eef.rwz.mybluehost.mewww.lfnlafricaine.com
autodiscover.badrabbitpictures.combadrabbitpictures.comcpanel.badrabbitpictures.comcpcalendars.badrabbitpictures.comcpcontacts.badrabbitpictures.commail.badrabbitpictures.comwebdisk.badrabbitpictures.comwebmail.badrabbitpictures.comwebsite-48879e9a.theanukchronicles.comwww.badrabbitpictures.comwww.website-48879e9a.theanukchronicles.com
autodiscover.stockportsilver.co.ukcpanel.stockportsilver.co.ukcpcalendars.stockportsilver.co.ukcpcontacts.stockportsilver.co.ukmail.stockportsilver.co.ukmail.stockportsilver.orgstockportsilver.co.ukstockportsilver.orgwebdisk.stockportsilver.co.ukwebmail.stockportsilver.co.ukwww.stockportsilver.co.ukwww.stockportsilver.org
autodiscover.ndm.yek.mybluehost.mecpanel.ndm.yek.mybluehost.mecpcalendars.ndm.yek.mybluehost.mecpcontacts.ndm.yek.mybluehost.meheathergargis.commail.heathergargis.commail.ndm.yek.mybluehost.mendm.yek.mybluehost.mewebdisk.ndm.yek.mybluehost.mewebmail.ndm.yek.mybluehost.mewww.heathergargis.comwww.ndm.yek.mybluehost.me
website-aad32b03.nagarajfirstdomainname.comwww.website-aad32b03.nagarajfirstdomainname.com
autodiscover.fromloathingtolove.comautodiscover.yvettegray.comcpanel.fromloathingtolove.comcpanel.yvettegray.comcpcalendars.fromloathingtolove.comcpcalendars.yvettegray.comcpcontacts.fromloathingtolove.comcpcontacts.yvettegray.comfromloathingtolove.comfromloathingtolove.yvettegray.commail.fromloathingtolove.commail.yvettegray.comwebdisk.fromloathingtolove.comwebdisk.yvettegray.comwebmail.fromloathingtolove.comwebmail.yvettegray.comwww.fromloathingtolove.comwww.fromloathingtolove.yvettegray.comwww.yvettegray.comyvettegray.com
autodiscover.kwe.tzg.mybluehost.mecpanel.kwe.tzg.mybluehost.mecpcalendars.kwe.tzg.mybluehost.mecpcontacts.kwe.tzg.mybluehost.mekwe.tzg.mybluehost.memail.kwe.tzg.mybluehost.memail.taiwan-tourbus.comtaiwan-tourbus.comwebdisk.kwe.tzg.mybluehost.mewebmail.kwe.tzg.mybluehost.mewww.kwe.tzg.mybluehost.mewww.taiwan-tourbus.com
autodiscover.dsv.aca.mybluehost.mecmbunlimitedsolutions.comcpanel.dsv.aca.mybluehost.mecpcalendars.dsv.aca.mybluehost.mecpcontacts.dsv.aca.mybluehost.medsv.aca.mybluehost.memail.cmbunlimitedsolutions.commail.dsv.aca.mybluehost.mewebdisk.dsv.aca.mybluehost.mewebmail.dsv.aca.mybluehost.mewww.cmbunlimitedsolutions.comwww.dsv.aca.mybluehost.me
autodiscover.zenarklogistics.comcpanel.zenarklogistics.comcpcalendars.zenarklogistics.comcpcontacts.zenarklogistics.commail.zenarklogistics.comwebdisk.zenarklogistics.comwebmail.zenarklogistics.comwww.zenarklogistics.comzenarklogistics.com
autodiscover.peni.aicpanel.peni.aicpcalendars.peni.aicpcontacts.peni.aimail.peni.aipeni-ai.leny.aipeni.aiwebdisk.peni.aiwebmail.peni.aiwww.peni-ai.leny.aiwww.peni.ai
autodiscover.insurancebydesign.orgautodiscover.youngbloodinsurance.comcpanel.insurancebydesign.orgcpanel.youngbloodinsurance.comcpcalendars.insurancebydesign.orgcpcalendars.youngbloodinsurance.comcpcontacts.insurancebydesign.orgcpcontacts.youngbloodinsurance.cominsurancebydesign.havemedicare.cominsurancebydesign.orgmail.insurancebydesign.orgmail.youngbloodinsurance.comwebdisk.insurancebydesign.orgwebdisk.youngbloodinsurance.comwebmail.insurancebydesign.orgwebmail.youngbloodinsurance.comwww.insurancebydesign.havemedicare.comwww.insurancebydesign.orgwww.youngbloodinsurance.comwww.youngbloodinsurance.havemedicare.comyoungbloodinsurance.comyoungbloodinsurance.havemedicare.com
autodiscover.justinlichter.comcpanel.justinlichter.comcpcalendars.justinlichter.comcpcontacts.justinlichter.comjustinlichter.commail.justinlichter.comwebdisk.justinlichter.comwebmail.justinlichter.comwww.justinlichter.com
alabrepartyrentals.comautodiscover.alabrepartyrentals.comautodiscover.lzf.bqn.mybluehost.mecpanel.alabrepartyrentals.comcpanel.lzf.bqn.mybluehost.mecpcalendars.alabrepartyrentals.comcpcalendars.lzf.bqn.mybluehost.mecpcontacts.alabrepartyrentals.comcpcontacts.lzf.bqn.mybluehost.melzf.bqn.mybluehost.memail.alabrepartyrentals.commail.lzf.bqn.mybluehost.mewebdisk.alabrepartyrentals.comwebdisk.lzf.bqn.mybluehost.mewebmail.alabrepartyrentals.comwebmail.lzf.bqn.mybluehost.mewebsite-fb52022d.lzf.bqn.mybluehost.mewww.alabrepartyrentals.comwww.lzf.bqn.mybluehost.mewww.website-fb52022d.lzf.bqn.mybluehost.me
autodiscover.ritztalladega.comcpanel.ritztalladega.comcpcalendars.ritztalladega.comcpcontacts.ritztalladega.commail.ritztalladega.commail.talladegamardigras.commail.talladegaritz.comritztalladega.comtalladegamardigras.comtalladegaritz.comwebdisk.ritztalladega.comwebmail.ritztalladega.comwww.ritztalladega.comwww.talladegamardigras.comwww.talladegaritz.com
alshabakairaq.comautodiscover.rxp.vvo.mybluehost.mecpanel.rxp.vvo.mybluehost.mecpcalendars.rxp.vvo.mybluehost.mecpcontacts.rxp.vvo.mybluehost.memail.rxp.vvo.mybluehost.merxp.vvo.mybluehost.mewebdisk.rxp.vvo.mybluehost.mewebmail.rxp.vvo.mybluehost.mewww.rxp.vvo.mybluehost.me
autodiscover.selfgrowzone.comcpanel.selfgrowzone.comcpcalendars.selfgrowzone.comcpcontacts.selfgrowzone.commail.selfgrowzone.comselfgrowzone.comwebdisk.selfgrowzone.comwebmail.selfgrowzone.comwww.selfgrowzone.com
autodiscover.pregoworld.comcpanel.pregoworld.comcpcalendars.pregoworld.comcpcontacts.pregoworld.commail.pregoworld.compregoworld.comwebdisk.pregoworld.comwebmail.pregoworld.comwww.pregoworld.com
autodiscover.emptyvessels.mediaautodiscover.lyferesorts.comcpanel.emptyvessels.mediacpanel.lyferesorts.comcpcalendars.emptyvessels.mediacpcalendars.lyferesorts.comcpcontacts.emptyvessels.mediacpcontacts.lyferesorts.comemptyvessels.mediaemptyvessels.viewserendib.comlyferesorts.comlyferesorts.viewserendib.commail.emptyvessels.mediamail.lyferesorts.comwebdisk.emptyvessels.mediawebdisk.lyferesorts.comwebmail.emptyvessels.mediawebmail.lyferesorts.comwindsorgrandtea.viewserendib.comwww.emptyvessels.mediawww.emptyvessels.viewserendib.comwww.lyferesorts.comwww.lyferesorts.viewserendib.comwww.windsorgrandtea.viewserendib.com
autodiscover.hkr.hgn.mybluehost.mecpanel.hkr.hgn.mybluehost.mecpcalendars.hkr.hgn.mybluehost.mecpcontacts.hkr.hgn.mybluehost.mehkr.hgn.mybluehost.memail.hkr.hgn.mybluehost.mewebdisk.hkr.hgn.mybluehost.mewebmail.hkr.hgn.mybluehost.mewww.hkr.hgn.mybluehost.me
autodiscover.eddiejoyce.netcpanel.eddiejoyce.netcpcalendars.eddiejoyce.netcpcontacts.eddiejoyce.neteddiejoyce.netmail.eddiejoyce.netmail.smallmerciesnovel.comsmallmerciesnovel.comwebdisk.eddiejoyce.netwebmail.eddiejoyce.netwww.eddiejoyce.netwww.smallmerciesnovel.com
autodiscover.thd.wxt.mybluehost.mecpanel.thd.wxt.mybluehost.mecpcalendars.thd.wxt.mybluehost.mecpcontacts.thd.wxt.mybluehost.memail.thd.wxt.mybluehost.methd.wxt.mybluehost.mewebdisk.thd.wxt.mybluehost.mewebmail.thd.wxt.mybluehost.mewww.thd.wxt.mybluehost.me
autodiscover.noriz-tel.comcpanel.noriz-tel.comcpcalendars.noriz-tel.comcpcontacts.noriz-tel.comire.nsm.mybluehost.memail.ire.nsm.mybluehost.memail.noriz-tel.comnoriz-tel.comwebdisk.noriz-tel.comwebmail.noriz-tel.comwww.ire.nsm.mybluehost.mewww.noriz-tel.com
babat.sitecpanel.babat.sitewebmail.babat.sitewebsite-db038bf0.ryx.muf.mybluehost.mewww.babat.sitewww.website-db038bf0.ryx.muf.mybluehost.me
autodiscover.corerenovationgroup.comcorerenovationgroup.comcpanel.corerenovationgroup.comcpcalendars.corerenovationgroup.comcpcontacts.corerenovationgroup.commail.corerenovationgroup.comwebdisk.corerenovationgroup.comwebmail.corerenovationgroup.comwww.corerenovationgroup.com
autodiscover.kie.kao.mybluehost.mecpanel.kie.kao.mybluehost.mecpcalendars.kie.kao.mybluehost.mecpcontacts.kie.kao.mybluehost.mekie.kao.mybluehost.memail.kie.kao.mybluehost.memail.troypicturesinc.comtroypicturesinc.comwebdisk.kie.kao.mybluehost.mewebmail.kie.kao.mybluehost.mewww.kie.kao.mybluehost.mewww.troypicturesinc.com
autodiscover.zsk.wvf.mybluehost.mecpanel.zsk.wvf.mybluehost.mecpcalendars.zsk.wvf.mybluehost.mecpcontacts.zsk.wvf.mybluehost.melapa.usmail.lapa.usmail.taprootmgmt.commail.taquerialaparrilla.commail.zsk.wvf.mybluehost.metaprootmgmt.comwebdisk.zsk.wvf.mybluehost.mewebmail.zsk.wvf.mybluehost.mewww.lapa.uswww.taprootmgmt.comwww.zsk.wvf.mybluehost.mezsk.wvf.mybluehost.me
autodiscover.cotique.mediacotique.mediacpanel.cotique.mediacpcalendars.cotique.mediacpcontacts.cotique.mediamail.cotique.mediawebdisk.cotique.mediawebmail.cotique.mediawww.cotique.media
autodiscover.twx.egj.mybluehost.mecpanel.twx.egj.mybluehost.mecpcalendars.twx.egj.mybluehost.mecpcontacts.twx.egj.mybluehost.memail.twx.egj.mybluehost.metwx.egj.mybluehost.mewebdisk.twx.egj.mybluehost.mewebmail.twx.egj.mybluehost.mewww.twx.egj.mybluehost.me
autodiscover.kathygoodkin.comcpanel.kathygoodkin.comcpcalendars.kathygoodkin.comcpcontacts.kathygoodkin.comkathygoodkin.commail.kathygoodkin.comwebdisk.kathygoodkin.comwebmail.kathygoodkin.comwww.kathygoodkin.com
autodiscover.leftlegfirst.comautodiscover.papoulilimitedllc.comcpanel.leftlegfirst.comcpanel.papoulilimitedllc.comcpcalendars.leftlegfirst.comcpcalendars.papoulilimitedllc.comcpcontacts.leftlegfirst.comcpcontacts.papoulilimitedllc.comleftlegfirst.commail.leftlegfirst.commail.papoulilimitedllc.compapoulilimitedllc.compapoulilimitedllc.leftlegfirst.comwebdisk.leftlegfirst.comwebdisk.papoulilimitedllc.comwebmail.leftlegfirst.comwebmail.papoulilimitedllc.comwww.leftlegfirst.comwww.papoulilimitedllc.comwww.papoulilimitedllc.leftlegfirst.com
autodiscover.thecedarwoodcottage.comcpanel.thecedarwoodcottage.comcpcalendars.thecedarwoodcottage.comcpcontacts.thecedarwoodcottage.commail.thecedarwoodcottage.comthecedarwoodcottage.comwebdisk.thecedarwoodcottage.comwebmail.thecedarwoodcottage.comwww.thecedarwoodcottage.com
avant-gardetech.commail.avant-gardetech.comwww.avant-gardetech.com
autodiscover.pdesigngroup.comcpanel.pdesigngroup.comcpcalendars.pdesigngroup.comcpcontacts.pdesigngroup.commail.pdesigngroup.compdesigngroup.artecse.compdesigngroup.comwebdisk.pdesigngroup.comwebmail.pdesigngroup.comwww.pdesigngroup.artecse.comwww.pdesigngroup.com
autodiscover.melfami.comcpanel.melfami.comcpcalendars.melfami.comcpcontacts.melfami.commail.melfami.commelfami.comwebdisk.melfami.comwebmail.melfami.comwww.melfami.com
autodiscover.oxj.zsr.mybluehost.mecpanel.oxj.zsr.mybluehost.mecpcalendars.oxj.zsr.mybluehost.mecpcontacts.oxj.zsr.mybluehost.medaraghjgrant.commail.daraghjgrant.commail.oxj.zsr.mybluehost.meoxj.zsr.mybluehost.mewebdisk.oxj.zsr.mybluehost.mewebmail.oxj.zsr.mybluehost.mewww.daraghjgrant.comwww.oxj.zsr.mybluehost.me
autodiscover.saragazarek.comcpanel.saragazarek.comcpcalendars.saragazarek.comcpcontacts.saragazarek.commail.saragazarek.commail.saragazarekmusic.comsaragazarek.comsaragazarekmusic.comwebdisk.saragazarek.comwebmail.saragazarek.comwww.saragazarek.comwww.saragazarekmusic.com
autodiscover.beddingbathreview.comautodiscover.outdoorgearsx.combeddingbathreview.combeddingbathreview.lifehacksx.comcpanel.beddingbathreview.comcpanel.outdoorgearsx.comcpcalendars.beddingbathreview.comcpcalendars.outdoorgearsx.comcpcontacts.beddingbathreview.comcpcontacts.outdoorgearsx.commail.beddingbathreview.commail.outdoorgearsx.comoutdoorgearsx.comoutdoorgearsx.lifehacksx.comwebdisk.beddingbathreview.comwebdisk.outdoorgearsx.comwebmail.beddingbathreview.comwebmail.outdoorgearsx.comwww.beddingbathreview.comwww.beddingbathreview.lifehacksx.comwww.outdoorgearsx.comwww.outdoorgearsx.lifehacksx.com
dev.crossfitwaterbury.comwww.dev.crossfitwaterbury.com
autodiscover.kindreset.comautodiscover.matthewkoutnik.comcpanel.kindreset.comcpanel.matthewkoutnik.comcpcalendars.kindreset.comcpcalendars.matthewkoutnik.comcpcontacts.kindreset.comcpcontacts.matthewkoutnik.comkindreset.comkindreset.moonandpledge.commail.kindreset.commail.matthewkoutnik.commatthewkoutnik.commatthewkoutnik.moonandpledge.comwebdisk.kindreset.comwebdisk.matthewkoutnik.comwebmail.kindreset.comwebmail.matthewkoutnik.comwww.kindreset.comwww.kindreset.moonandpledge.comwww.matthewkoutnik.comwww.matthewkoutnik.moonandpledge.com
autodiscover.buzzpointllc.combuzzpointllc.combuzzpointllc.lifehacksx.comcpanel.buzzpointllc.comcpcalendars.buzzpointllc.comcpcontacts.buzzpointllc.commail.buzzpointllc.comwebdisk.buzzpointllc.comwebmail.buzzpointllc.comwww.buzzpointllc.comwww.buzzpointllc.lifehacksx.com
autodiscover.wearecousin.orgcpanel.wearecousin.orgcpcalendars.wearecousin.orgcpcontacts.wearecousin.orgmail.wearecousin.orgwearecousin.orgwebdisk.wearecousin.orgwebmail.wearecousin.orgwww.wearecousin.org
website-004ee500.tcc.xjl.mybluehost.mewww.website-004ee500.tcc.xjl.mybluehost.me
autodiscover.uzf.xfn.mybluehost.mecpanel.uzf.xfn.mybluehost.mecpcalendars.uzf.xfn.mybluehost.mecpcontacts.uzf.xfn.mybluehost.memagpieasmartbird.commail.magpieasmartbird.commail.uzf.xfn.mybluehost.meuzf.xfn.mybluehost.mewebdisk.uzf.xfn.mybluehost.mewebmail.uzf.xfn.mybluehost.mewww.magpieasmartbird.comwww.uzf.xfn.mybluehost.me
members.successfactornetwork.comwww.members.successfactornetwork.com
amaall-com.psb.yhn.mybluehost.meamaall.comaradeen.comcpanel.amaall.comcpanel.aradeen.comcpcalendars.amaall.comcpcalendars.aradeen.comcpcontacts.amaall.comcpcontacts.aradeen.commail.amaall.commail.aradeen.comwebdisk.amaall.comwebdisk.aradeen.comwebmail.amaall.comwebmail.aradeen.comwebsite-8af760c6.psb.yhn.mybluehost.mewww.amaall-com.psb.yhn.mybluehost.mewww.amaall.comwww.aradeen.comwww.website-8af760c6.psb.yhn.mybluehost.me
autodiscover.nzm.wlu.mybluehost.mecpanel.nzm.wlu.mybluehost.mecpcalendars.nzm.wlu.mybluehost.mecpcontacts.nzm.wlu.mybluehost.mehabitationsequilibre.commail.habitationsequilibre.commail.nzm.wlu.mybluehost.menzm.wlu.mybluehost.mewebdisk.nzm.wlu.mybluehost.mewebmail.nzm.wlu.mybluehost.mewww.habitationsequilibre.comwww.nzm.wlu.mybluehost.me
autodiscover.ibi.oqk.mybluehost.mecpanel.ibi.oqk.mybluehost.mecpcalendars.ibi.oqk.mybluehost.mecpcontacts.ibi.oqk.mybluehost.meibi.oqk.mybluehost.memail.ibi.oqk.mybluehost.memail.toddschaap.comtoddschaap.comwebdisk.ibi.oqk.mybluehost.mewebmail.ibi.oqk.mybluehost.mewww.ibi.oqk.mybluehost.mewww.toddschaap.com
autodiscover.kwd.chh.mybluehost.mecpanel.kwd.chh.mybluehost.mecpcalendars.kwd.chh.mybluehost.mecpcontacts.kwd.chh.mybluehost.mekwd.chh.mybluehost.memail.kwd.chh.mybluehost.memail.projectbulgingbelly.comprojectbulgingbelly.comwebdisk.kwd.chh.mybluehost.mewebmail.kwd.chh.mybluehost.mewww.kwd.chh.mybluehost.mewww.projectbulgingbelly.com
autodiscover.thedeeprootsapothecary.comcpanel.thedeeprootsapothecary.comcpcalendars.thedeeprootsapothecary.comcpcontacts.thedeeprootsapothecary.commail.thedeeprootsapothecary.comthedeeprootsapothecary.comwebdisk.thedeeprootsapothecary.comwebmail.thedeeprootsapothecary.comwww.thedeeprootsapothecary.com
autodiscover.wfj.zzh.mybluehost.mecpanel.wfj.zzh.mybluehost.mecpcalendars.wfj.zzh.mybluehost.mecpcontacts.wfj.zzh.mybluehost.memail.wfj.zzh.mybluehost.mewebdisk.wfj.zzh.mybluehost.mewebmail.wfj.zzh.mybluehost.mewfj.zzh.mybluehost.mewww.wfj.zzh.mybluehost.me
autodiscover.closeupedition.comcloseupedition.comcpanel.closeupedition.comcpcalendars.closeupedition.comcpcontacts.closeupedition.commail.closeupedition.comwebdisk.closeupedition.comwebmail.closeupedition.comwww.closeupedition.com
autodiscover.walleyewoodfloors.comcpanel.walleyewoodfloors.comcpcalendars.walleyewoodfloors.comcpcontacts.walleyewoodfloors.commail.walleyewoodfloors.comwalleyewoodfloors.comwebdisk.walleyewoodfloors.comwebmail.walleyewoodfloors.comwww.walleyewoodfloors.com
autodiscover.premiumbeveragespdx.comcpcalendars.premiumbeveragespdx.comcpcontacts.premiumbeveragespdx.commail.premiumbeveragespdx.compremiumbeveragespdx.isanskriti.comwebdisk.premiumbeveragespdx.comwww.premiumbeveragespdx.isanskriti.com
autodiscover.ful.fih.mybluehost.mecpanel.ful.fih.mybluehost.mecpcalendars.ful.fih.mybluehost.mecpcontacts.ful.fih.mybluehost.meful.fih.mybluehost.memail.ful.fih.mybluehost.memail.marilynnutter.commarilynnutter.comwebdisk.ful.fih.mybluehost.mewebmail.ful.fih.mybluehost.mewww.ful.fih.mybluehost.mewww.marilynnutter.com
autodiscover.phj.edd.mybluehost.mecpanel.phj.edd.mybluehost.mecpcalendars.phj.edd.mybluehost.mecpcontacts.phj.edd.mybluehost.memail.phj.edd.mybluehost.mephj.edd.mybluehost.meverbiks.comwebdisk.phj.edd.mybluehost.mewebmail.phj.edd.mybluehost.mewww.phj.edd.mybluehost.mewww.verbiks.com
autodiscover.cih.efs.mybluehost.mecih.efs.mybluehost.mecpanel.cih.efs.mybluehost.mecpcalendars.cih.efs.mybluehost.mecpcontacts.cih.efs.mybluehost.memail.cih.efs.mybluehost.memail.rigbyrussell.comrigbyrussell.comwebdisk.cih.efs.mybluehost.mewebmail.cih.efs.mybluehost.mewww.cih.efs.mybluehost.mewww.rigbyrussell.com
autodiscover.mvb.zzh.mybluehost.mecpanel.mvb.zzh.mybluehost.mecpcalendars.mvb.zzh.mybluehost.mecpcontacts.mvb.zzh.mybluehost.memail.mvb.zzh.mybluehost.memail.purplehippotravels.commvb.zzh.mybluehost.mepurplehippotravels.comwebdisk.mvb.zzh.mybluehost.mewebmail.mvb.zzh.mybluehost.mewww.mvb.zzh.mybluehost.mewww.purplehippotravels.com
cassenergyhealer.co.ukcpanel.fbs.bzx.mybluehost.mecpcalendars.fbs.bzx.mybluehost.mecpcontacts.fbs.bzx.mybluehost.mefbs.bzx.mybluehost.memail.fbs.bzx.mybluehost.mewebdisk.fbs.bzx.mybluehost.mewebmail.fbs.bzx.mybluehost.mewww.cassenergyhealer.co.ukwww.fbs.bzx.mybluehost.me
autodiscover.ifo.dvw.mybluehost.mecpanel.ifo.dvw.mybluehost.mecpcalendars.ifo.dvw.mybluehost.mecpcontacts.ifo.dvw.mybluehost.medrowsymind.comifo.dvw.mybluehost.memail.drowsymind.commail.ifo.dvw.mybluehost.mewebdisk.ifo.dvw.mybluehost.mewebmail.ifo.dvw.mybluehost.mewww.drowsymind.comwww.ifo.dvw.mybluehost.me
autodiscover.thebrothersreed.comcpanel.thebrothersreed.comcpcalendars.thebrothersreed.comcpcontacts.thebrothersreed.commail.thebrothersreed.comthebrothersreed.comwebdisk.thebrothersreed.comwebmail.thebrothersreed.comwww.thebrothersreed.com
astekdev.comautodiscover.astekdev.comcpanel.astekdev.comcpcalendars.astekdev.comcpcontacts.astekdev.commail.astekdev.comwebdisk.astekdev.comwebmail.astekdev.comwebsite-2a49a058.xsk.nqg.mybluehost.mewww.astekdev.comwww.website-2a49a058.xsk.nqg.mybluehost.me
assuredag.comcpanel.assuredag.comcpcalendars.assuredag.comcpcontacts.assuredag.commail.assuredag.comwebdisk.assuredag.comwebmail.assuredag.comwww.assuredag.com
autodiscover.timshels.comcpanel.timshels.comcpcalendars.timshels.comcpcontacts.timshels.commail.timshels.comtimshels.comwebdisk.timshels.comwebmail.timshels.comwww.timshels.com
angiebuyshouses.comautodiscover.wlm.wog.mybluehost.mecpanel.wlm.wog.mybluehost.mecpcalendars.wlm.wog.mybluehost.mecpcontacts.wlm.wog.mybluehost.memail.angiebuyshouses.commail.wlm.wog.mybluehost.mewebdisk.wlm.wog.mybluehost.mewebmail.wlm.wog.mybluehost.mewlm.wog.mybluehost.mewww.angiebuyshouses.comwww.wlm.wog.mybluehost.me
autodiscover.pupsandprosecco.comcpanel.pupsandprosecco.comcpcalendars.pupsandprosecco.comcpcontacts.pupsandprosecco.commail.pupsandprosecco.compupsandprosecco.comwebdisk.pupsandprosecco.comwebmail.pupsandprosecco.comwww.pupsandprosecco.com
website-ec847a65.tcc.xjl.mybluehost.mewww.website-ec847a65.tcc.xjl.mybluehost.me
autodiscover.dai.noo.mybluehost.mecpanel.dai.noo.mybluehost.mecpcalendars.dai.noo.mybluehost.mecpcontacts.dai.noo.mybluehost.medai.noo.mybluehost.meinvestirbien.commail.dai.noo.mybluehost.memail.investirbien.comwebdisk.dai.noo.mybluehost.mewebmail.dai.noo.mybluehost.mewww.dai.noo.mybluehost.mewww.investirbien.com
ablecardgame.comablecardgame.moonandpledge.comautodiscover.ablecardgame.comautodiscover.thechesspage.comcpanel.ablecardgame.comcpanel.thechesspage.comcpcalendars.ablecardgame.comcpcalendars.thechesspage.comcpcontacts.ablecardgame.comcpcontacts.thechesspage.commail.ablecardgame.commail.thechesspage.comthechesspage.comthechesspage.moonandpledge.comwebdisk.ablecardgame.comwebdisk.thechesspage.comwebmail.ablecardgame.comwebmail.thechesspage.comwww.ablecardgame.comwww.ablecardgame.moonandpledge.comwww.thechesspage.comwww.thechesspage.moonandpledge.com
autodiscover.opu.nuh.mybluehost.mecpanel.opu.nuh.mybluehost.mecpcalendars.opu.nuh.mybluehost.mecpcontacts.opu.nuh.mybluehost.memail.opu.nuh.mybluehost.meopu.nuh.mybluehost.meteentas.orgwebdisk.opu.nuh.mybluehost.mewebmail.opu.nuh.mybluehost.mewww.opu.nuh.mybluehost.me
website-a87fbc10.grm.csp.mybluehost.mewww.website-a87fbc10.grm.csp.mybluehost.mezona0.mx
autodiscover.treonabateman.comcpanel.treonabateman.comcpcalendars.treonabateman.comcpcontacts.treonabateman.commail.treonabateman.comwebdisk.treonabateman.comwebmail.treonabateman.com
autodiscover.nox.sjd.mybluehost.mecpanel.nox.sjd.mybluehost.mecpcalendars.nox.sjd.mybluehost.mecpcontacts.nox.sjd.mybluehost.memail.nox.sjd.mybluehost.menox.sjd.mybluehost.mewebdisk.nox.sjd.mybluehost.mewebmail.nox.sjd.mybluehost.mewww.nox.sjd.mybluehost.me
autodiscover.vjm.ens.mybluehost.mecpanel.vjm.ens.mybluehost.mecpcalendars.vjm.ens.mybluehost.mecpcontacts.vjm.ens.mybluehost.memail.myprojecttutor.commail.vjm.ens.mybluehost.memyprojecttutor.comvjm.ens.mybluehost.mewebdisk.vjm.ens.mybluehost.mewebmail.vjm.ens.mybluehost.mewww.myprojecttutor.comwww.vjm.ens.mybluehost.me
autodiscover.gkmhs.comcpanel.gkmhs.comcpcalendars.gkmhs.comcpcontacts.gkmhs.comgkmhs.commail.gkmhs.comwebdisk.gkmhs.comwebmail.gkmhs.comwww.gkmhs.com
autodiscover.makeupbycherise.comcpanel.makeupbycherise.comcpcalendars.makeupbycherise.comcpcontacts.makeupbycherise.commail.makeupbycherise.commail.wwk.ebq.mybluehost.memakeupbycherise.comwebdisk.makeupbycherise.comwebmail.makeupbycherise.comwwk.ebq.mybluehost.mewww.makeupbycherise.comwww.wwk.ebq.mybluehost.me
autodiscover.cgi.cno.mybluehost.mecgi.cno.mybluehost.mecpanel.cgi.cno.mybluehost.mecpcalendars.cgi.cno.mybluehost.mecpcontacts.cgi.cno.mybluehost.meculturestrategy.iomail.cgi.cno.mybluehost.mewebdisk.cgi.cno.mybluehost.mewebmail.cgi.cno.mybluehost.mewww.cgi.cno.mybluehost.mewww.culturestrategy.io
autodiscover.preppinglittles.comcpanel.preppinglittles.comcpcalendars.preppinglittles.comcpcontacts.preppinglittles.commail.preppinglittles.commail.wyy.dst.mybluehost.mepreppinglittles.comwebdisk.preppinglittles.comwebmail.preppinglittles.comwww.preppinglittles.comwww.wyy.dst.mybluehost.mewyy.dst.mybluehost.me
autodiscover.freedomhealthministries.comcpanel.freedomhealthministries.comcpcalendars.freedomhealthministries.comcpcontacts.freedomhealthministries.comfreedomhealthministries.comfreedomhealthministries.revelationrevealedtoday.commail.freedomhealthministries.comwebdisk.freedomhealthministries.comwebmail.freedomhealthministries.comwww.freedomhealthministries.comwww.freedomhealthministries.revelationrevealedtoday.com
autodiscover.nag.zca.mybluehost.mecpanel.nag.zca.mybluehost.mecpcalendars.nag.zca.mybluehost.mecpcontacts.nag.zca.mybluehost.meheisong.orgmail.heisong.orgmail.nag.zca.mybluehost.menag.zca.mybluehost.mewebdisk.nag.zca.mybluehost.mewebmail.nag.zca.mybluehost.mewww.heisong.orgwww.nag.zca.mybluehost.me
autodiscover.vjl.mqz.mybluehost.mecpanel.vjl.mqz.mybluehost.mecpcalendars.vjl.mqz.mybluehost.mecpcontacts.vjl.mqz.mybluehost.mekondangsarana.commail.kondangsarana.commail.vjl.mqz.mybluehost.mevjl.mqz.mybluehost.mewebdisk.vjl.mqz.mybluehost.mewebmail.vjl.mqz.mybluehost.mewww.kondangsarana.comwww.vjl.mqz.mybluehost.me
autodiscover.endurancephysio.cacpanel.endurancephysio.cacpcalendars.endurancephysio.cacpcontacts.endurancephysio.caendurancephysio.camail.endurancephysio.cawebdisk.endurancephysio.cawebmail.endurancephysio.cawww.endurancephysio.ca
autodiscover.insuranceladyusa.comautodiscover.medilifeins.comcpanel.insuranceladyusa.comcpanel.medilifeins.comcpcalendars.insuranceladyusa.comcpcalendars.medilifeins.comcpcontacts.insuranceladyusa.comcpcontacts.medilifeins.cominsuranceladyusa.cominsuranceladyusa.havemedicare.commail.insuranceladyusa.commail.medilifeins.commedilifeins.commedilifeins.havemedicare.comwebdisk.insuranceladyusa.comwebdisk.medilifeins.comwebmail.insuranceladyusa.comwebmail.medilifeins.comwww.insuranceladyusa.comwww.insuranceladyusa.havemedicare.comwww.medilifeins.comwww.medilifeins.havemedicare.com
autodiscover.floydvincent.comcpanel.floydvincent.comcpcalendars.floydvincent.comcpcontacts.floydvincent.comfloydvincent.commail.floydvincent.comwebdisk.floydvincent.comwebmail.floydvincent.comwww.floydvincent.com
autodiscover.kan.xeh.mybluehost.mecpanel.kan.xeh.mybluehost.mecpcalendars.kan.xeh.mybluehost.mecpcontacts.kan.xeh.mybluehost.meforeignautospa.comkan.xeh.mybluehost.memail.foreignautospa.commail.kan.xeh.mybluehost.mewebdisk.kan.xeh.mybluehost.mewebmail.kan.xeh.mybluehost.mewww.foreignautospa.comwww.kan.xeh.mybluehost.me
autodiscover.xqq.sco.mybluehost.mecpanel.xqq.sco.mybluehost.mecpcalendars.xqq.sco.mybluehost.mecpcontacts.xqq.sco.mybluehost.memail.xqq.sco.mybluehost.mewebdisk.xqq.sco.mybluehost.mewebmail.xqq.sco.mybluehost.mewww.xqq.sco.mybluehost.mexqq.sco.mybluehost.me
autodiscover.res.oea.mybluehost.mecpanel.res.oea.mybluehost.mecpcalendars.res.oea.mybluehost.mecpcontacts.res.oea.mybluehost.memail.res.oea.mybluehost.memail.stillnavigating.comres.oea.mybluehost.mestillnavigating.comwebdisk.res.oea.mybluehost.mewebmail.res.oea.mybluehost.mewww.res.oea.mybluehost.mewww.stillnavigating.com
ableproductsusa.comableproductsusa.nikcor.comautodiscover.ableproductsusa.comcpanel.ableproductsusa.comcpcalendars.ableproductsusa.comcpcontacts.ableproductsusa.commail.ableproductsusa.comwebdisk.ableproductsusa.comwebmail.ableproductsusa.comwww.ableproductsusa.comwww.ableproductsusa.nikcor.com
autodiscover.tanarosxm.comcpanel.tanarosxm.comcpcalendars.tanarosxm.comcpcontacts.tanarosxm.commail.tanarosxm.comtanarosxm.comwebdisk.tanarosxm.comwebmail.tanarosxm.comwww.tanarosxm.com
autodiscover.fromanotherrealm.comcpanel.fromanotherrealm.comcpcalendars.fromanotherrealm.comcpcontacts.fromanotherrealm.comfromanotherrealm.comfromanotherrealm.marklake.orgmail.fromanotherrealm.comwebdisk.fromanotherrealm.comwebmail.fromanotherrealm.comwww.fromanotherrealm.comwww.fromanotherrealm.marklake.org
autodiscover.fds.lgu.mybluehost.mecpanel.fds.lgu.mybluehost.mecpcalendars.fds.lgu.mybluehost.mecpcontacts.fds.lgu.mybluehost.mefds.lgu.mybluehost.megowomenbeyondborders.commail.fds.lgu.mybluehost.memail.gowomenbeyondborders.comwebdisk.fds.lgu.mybluehost.mewebmail.fds.lgu.mybluehost.mewww.fds.lgu.mybluehost.mewww.gowomenbeyondborders.com
autodiscover.jnq.ytr.mybluehost.mecpanel.jnq.ytr.mybluehost.mecpcalendars.jnq.ytr.mybluehost.mecpcontacts.jnq.ytr.mybluehost.mejnq.ytr.mybluehost.memail.jnq.ytr.mybluehost.memail.wholesumwoman.comwebdisk.jnq.ytr.mybluehost.mewebmail.jnq.ytr.mybluehost.mewholesumwoman.comwww.jnq.ytr.mybluehost.mewww.wholesumwoman.com
cpanel.therestlessrunaway.comcpcalendars.therestlessrunaway.comcpcontacts.therestlessrunaway.commail.therestlessrunaway.comtherestlessrunaway.comwebdisk.therestlessrunaway.comwebmail.therestlessrunaway.comwww.therestlessrunaway.com
autodiscover.beyondmedicinepr.combeyondmedicinepr.comcpanel.beyondmedicinepr.comcpcalendars.beyondmedicinepr.comcpcontacts.beyondmedicinepr.commail.beyondmedicinepr.comwebdisk.beyondmedicinepr.comwebmail.beyondmedicinepr.comwebsite-b519884b.cyb.xjy.mybluehost.mewww.beyondmedicinepr.comwww.website-b519884b.cyb.xjy.mybluehost.me
autodiscover.stephanierupp.netcpanel.stephanierupp.netcpcalendars.stephanierupp.netcpcontacts.stephanierupp.netmail.stephanierupp.netstephanierupp.netwebdisk.stephanierupp.netwebmail.stephanierupp.netwww.stephanierupp.net
autodiscover.dxs.oui.mybluehost.mecpanel.dxs.oui.mybluehost.mecpcalendars.dxs.oui.mybluehost.mecpcontacts.dxs.oui.mybluehost.medxs.oui.mybluehost.memail.dxs.oui.mybluehost.memail.xwatchshop.comwebdisk.dxs.oui.mybluehost.mewebmail.dxs.oui.mybluehost.mewww.dxs.oui.mybluehost.mewww.xwatchshop.comxwatchshop.com
autodiscover.wcy.sgz.mybluehost.mecpanel.wcy.sgz.mybluehost.mecpcalendars.wcy.sgz.mybluehost.mecpcontacts.wcy.sgz.mybluehost.meluxartists.commail.wcy.sgz.mybluehost.mewcy.sgz.mybluehost.mewebdisk.wcy.sgz.mybluehost.mewebmail.wcy.sgz.mybluehost.mewww.luxartists.comwww.wcy.sgz.mybluehost.me
autodiscover.thesmarthomeninja.comcpanel.thesmarthomeninja.comcpcalendars.thesmarthomeninja.comcpcontacts.thesmarthomeninja.commail.thesmarthomeninja.comthesmarthomeninja.comwebdisk.thesmarthomeninja.comwebmail.thesmarthomeninja.comwww.thesmarthomeninja.com
asx.lll.mybluehost.meautodiscover.asx.lll.mybluehost.meavanttechgroup.comcpanel.asx.lll.mybluehost.mecpcalendars.asx.lll.mybluehost.mecpcontacts.asx.lll.mybluehost.memail.asx.lll.mybluehost.mewebdisk.asx.lll.mybluehost.mewebmail.asx.lll.mybluehost.mewww.asx.lll.mybluehost.me
autodiscover.yvm.wid.mybluehost.mecpanel.yvm.wid.mybluehost.mecpcalendars.yvm.wid.mybluehost.mecpcontacts.yvm.wid.mybluehost.memail.yvm.wid.mybluehost.mewebdisk.yvm.wid.mybluehost.mewebmail.yvm.wid.mybluehost.mewww.yvm.wid.mybluehost.meyvm.wid.mybluehost.me
autodiscover.leny.aicpanel.leny.aicpcalendars.leny.aicpcontacts.leny.aileny.aimail.leny.aiwebdisk.leny.aiwebmail.leny.aiwww.leny.ai
autodiscover.zmc.chh.mybluehost.mecpanel.zmc.chh.mybluehost.mecpcalendars.zmc.chh.mybluehost.mecpcontacts.zmc.chh.mybluehost.medivinecaregroup.com.aumail.divinecaregroup.com.aumail.zmc.chh.mybluehost.mewebdisk.zmc.chh.mybluehost.mewebmail.zmc.chh.mybluehost.mewww.divinecaregroup.com.auwww.zmc.chh.mybluehost.mezmc.chh.mybluehost.me
autodiscover.oey.qtb.mybluehost.mecpanel.oey.qtb.mybluehost.mecpcalendars.oey.qtb.mybluehost.mecpcontacts.oey.qtb.mybluehost.memail.oey.qtb.mybluehost.memail.warteg.xyzoey.qtb.mybluehost.mewarteg.xyzwebdisk.oey.qtb.mybluehost.mewebmail.oey.qtb.mybluehost.mewww.oey.qtb.mybluehost.mewww.warteg.xyz
autodiscover.myhoneylist.comautodiscover.pilothouseagency.comcpanel.myhoneylist.comcpanel.pilothouseagency.comcpcalendars.myhoneylist.comcpcalendars.pilothouseagency.comcpcontacts.myhoneylist.comcpcontacts.pilothouseagency.commail.myhoneylist.commail.pilothouseagency.commyhoneylist.compilothouseagency.compilothouseagency.myhoneylist.comwebdisk.myhoneylist.comwebdisk.pilothouseagency.comwebmail.myhoneylist.comwebmail.pilothouseagency.comwww.myhoneylist.comwww.pilothouseagency.comwww.pilothouseagency.myhoneylist.com
autodiscover.fbi.yvm.mybluehost.mecpanel.fbi.yvm.mybluehost.mecpcalendars.fbi.yvm.mybluehost.mecpcontacts.fbi.yvm.mybluehost.mefbi.yvm.mybluehost.memail.fbi.yvm.mybluehost.mewebdisk.fbi.yvm.mybluehost.mewebmail.fbi.yvm.mybluehost.mewww.fbi.yvm.mybluehost.me
mail.w2ah.commail.w2ah.orgmail.wwallianceforthehomeless.orgw2ah.comw2ah.orgwwallianceforthehomeless.orgwww.w2ah.comwww.w2ah.orgwww.wwallianceforthehomeless.org
autodiscover.rooseveltptg.comcpanel.rooseveltptg.comcpcalendars.rooseveltptg.comcpcontacts.rooseveltptg.commail.rooseveltptg.comrooseveltptg.comwebdisk.rooseveltptg.comwebmail.rooseveltptg.comwww.rooseveltptg.com
autodiscover.diydebtsolution.comautodiscover.trustandcorp.comcpanel.diydebtsolution.comcpanel.trustandcorp.comcpcalendars.diydebtsolution.comcpcalendars.trustandcorp.comcpcontacts.diydebtsolution.comcpcontacts.trustandcorp.comdiydebtsolution.comeyg.hgn.mybluehost.memail.diydebtsolution.commail.trustandcorp.comtrustandcorp.comwebdisk.diydebtsolution.comwebdisk.trustandcorp.comwebmail.diydebtsolution.comwebmail.trustandcorp.comwebsite-066788a9.diydebtsolution.comwww.diydebtsolution.comwww.trustandcorp.comwww.website-066788a9.diydebtsolution.com
cochranfirmchicago.courtneysimone.comhopsonlaw.courtneysimone.comwww.cochranfirmchicago.courtneysimone.comwww.hopsonlaw.courtneysimone.com
autodiscover.kostalimitedllc.comautodiscover.macris360.comcpanel.kostalimitedllc.comcpanel.macris360.comcpcalendars.kostalimitedllc.comcpcalendars.macris360.comcpcontacts.kostalimitedllc.comcpcontacts.macris360.comkostalimitedllc.comkostalimitedllc.leftlegfirst.commacris360.commacris360.leftlegfirst.commail.kostalimitedllc.commail.macris360.comwebdisk.kostalimitedllc.comwebdisk.macris360.comwebmail.kostalimitedllc.comwebmail.macris360.comwww.kostalimitedllc.comwww.kostalimitedllc.leftlegfirst.comwww.macris360.comwww.macris360.leftlegfirst.com
autodiscover.muy-i.comcpanel.muy-i.comcpcalendars.muy-i.comcpcontacts.muy-i.commail.muy-i.commuy-i.commuy-i.v0985004622.comwebdisk.muy-i.comwebmail.muy-i.comwww.muy-i.comwww.muy-i.v0985004622.com
autodiscover.ueg.eln.mybluehost.mecpanel.ueg.eln.mybluehost.mecpcalendars.ueg.eln.mybluehost.mecpcontacts.ueg.eln.mybluehost.mehelpfulmba.commail.helpfulmba.commail.ueg.eln.mybluehost.meueg.eln.mybluehost.mewebdisk.ueg.eln.mybluehost.mewebmail.ueg.eln.mybluehost.mewww.helpfulmba.comwww.ueg.eln.mybluehost.me
autodiscover.type1travels.comcpanel.type1travels.comcpcalendars.type1travels.comcpcontacts.type1travels.commail.type1travels.comtype1travels.comwebdisk.type1travels.comwebmail.type1travels.comwww.type1travels.com
autodiscover.otm.bgd.mybluehost.mecpanel.otm.bgd.mybluehost.mecpcalendars.otm.bgd.mybluehost.mecpcontacts.otm.bgd.mybluehost.memail.otm.bgd.mybluehost.meotm.bgd.mybluehost.mewebdisk.otm.bgd.mybluehost.mewebmail.otm.bgd.mybluehost.mewww.otm.bgd.mybluehost.me
autodiscover.groovecity7.comcpanel.groovecity7.comcpcalendars.groovecity7.comcpcontacts.groovecity7.comgroovecity7.commail.groovecity7.comwebdisk.groovecity7.comwebmail.groovecity7.comwww.groovecity7.com
archaeologypod.comarchaeologypod.notemusings.comautodiscover.archaeologypod.comcpanel.archaeologypod.comcpcalendars.archaeologypod.comcpcontacts.archaeologypod.commail.archaeologypod.comwebdisk.archaeologypod.comwebmail.archaeologypod.comwww.archaeologypod.comwww.archaeologypod.notemusings.com
504vintage.markwag.comautodiscover.markwag.comcpanel.markwag.comcpcalendars.markwag.comcpcontacts.markwag.commail.markwag.commarkwag.comsallycaraway.markwag.comwebdisk.markwag.comwebmail.markwag.comwww.504vintage.markwag.comwww.markwag.comwww.sallycaraway.markwag.com
autodiscover.imericlee.comcpanel.imericlee.comcpcalendars.imericlee.comcpcontacts.imericlee.comimericlee.commail.imericlee.comwebdisk.imericlee.comwebmail.imericlee.comwww.imericlee.com
autodiscover.drstenhq.comcpanel.drstenhq.comcpcalendars.drstenhq.comcpcontacts.drstenhq.comdrstenhq.babeslay.comdrstenhq.comistrumpalive.babeslay.commail.drstenhq.comwebdisk.drstenhq.comwebmail.drstenhq.comwww.drstenhq.babeslay.comwww.drstenhq.comwww.istrumpalive.babeslay.com
convenientaccounting.comcpanel.convenientaccounting.comcpcalendars.convenientaccounting.comcpcontacts.convenientaccounting.comwebdisk.convenientaccounting.comwebmail.convenientaccounting.comwww.convenientaccounting.com
bleoz.comhth.hzw.mybluehost.memail.hth.hzw.mybluehost.mewww.bleoz.comwww.hth.hzw.mybluehost.me
autodiscover.coffieldfamilyusa.comcoffieldfamilyusa.comcpanel.coffieldfamilyusa.comcpcalendars.coffieldfamilyusa.comcpcontacts.coffieldfamilyusa.commail.coffieldfamilyusa.comwebdisk.coffieldfamilyusa.comwebmail.coffieldfamilyusa.comwww.coffieldfamilyusa.com
autodiscover.neuenschwandermusicstudio.comcpanel.neuenschwandermusicstudio.comcpcalendars.neuenschwandermusicstudio.comcpcontacts.neuenschwandermusicstudio.commail.neuenschwandermusicstudio.comneuenschwandermusicstudio.comneuenschwandermusicstudio.mycreativepiano.comwebdisk.neuenschwandermusicstudio.comwebmail.neuenschwandermusicstudio.comwww.neuenschwandermusicstudio.comwww.neuenschwandermusicstudio.mycreativepiano.com
autodiscover.eileendrapizapsychotherapy.comcpanel.eileendrapizapsychotherapy.comcpcalendars.eileendrapizapsychotherapy.comcpcontacts.eileendrapizapsychotherapy.comeileendrapizapsychotherapy.commail.eileendrapizapsychotherapy.comwebdisk.eileendrapizapsychotherapy.comwebmail.eileendrapizapsychotherapy.comwww.eileendrapizapsychotherapy.com
autodiscover.ixr.tvautodiscover.metafifa.comcpanel.ixr.tvcpanel.metafifa.comcpcalendars.ixr.tvcpcalendars.metafifa.comcpcontacts.ixr.tvcpcontacts.metafifa.comixr-tv.italyendsracism.comixr.tvmail.ixr.tvmail.metafifa.commetafifa.commetafifa.italyendsracism.comwebdisk.ixr.tvwebdisk.metafifa.comwebmail.ixr.tvwebmail.metafifa.comwww.ixr-tv.italyendsracism.comwww.ixr.tvwww.metafifa.comwww.metafifa.italyendsracism.com
cpanel.glenvilleliving.com.aucpcalendars.glenvilleliving.com.aucpcontacts.glenvilleliving.com.auglenvilleliving-com-au.m10truss.com.auglenvilleliving.com.aumail.glenvilleliving.com.auwebdisk.glenvilleliving.com.auwebmail.glenvilleliving.com.auwww.glenvilleliving-com-au.m10truss.com.auwww.glenvilleliving.com.au
poctechnology.com
autodiscover.xfw.egj.mybluehost.mecpanel.xfw.egj.mybluehost.mecpcalendars.xfw.egj.mybluehost.mecpcontacts.xfw.egj.mybluehost.melaststory-claims.commail.xfw.egj.mybluehost.mewebdisk.xfw.egj.mybluehost.mewebmail.xfw.egj.mybluehost.mewww.laststory-claims.comwww.xfw.egj.mybluehost.mexfw.egj.mybluehost.me
autodiscover.overseasjo.comcpanel.overseasjo.comcpcalendars.overseasjo.comcpcontacts.overseasjo.commail.overseasjo.comwebdisk.overseasjo.comwebmail.overseasjo.com
autodiscover.lyfit.lifecpanel.lyfit.lifecpcalendars.lyfit.lifecpcontacts.lyfit.lifelyfit.lifewebdisk.lyfit.lifewebmail.lyfit.lifewww.lyfit.life
autodiscover.ginathetc.comcpanel.ginathetc.comcpcalendars.ginathetc.comcpcontacts.ginathetc.comginathetc.commail.ginathetc.comwebdisk.ginathetc.comwebmail.ginathetc.comwww.ginathetc.com
autodiscover.marcbelnick.comcpanel.marcbelnick.comcpcalendars.marcbelnick.comcpcontacts.marcbelnick.comdev.marcbelnick.commail.marcbelnick.commarcbelnick.comtest.marcbelnick.comwebdisk.marcbelnick.comwebmail.marcbelnick.comwww.dev.marcbelnick.comwww.marcbelnick.comwww.test.marcbelnick.com
auntbsgiftshop.comautodiscover.mtm.vvw.mybluehost.mecpanel.mtm.vvw.mybluehost.mecpcalendars.mtm.vvw.mybluehost.mecpcontacts.mtm.vvw.mybluehost.memail.auntbsgiftshop.commail.mtm.vvw.mybluehost.memtm.vvw.mybluehost.mewebdisk.mtm.vvw.mybluehost.mewebmail.mtm.vvw.mybluehost.mewww.auntbsgiftshop.comwww.mtm.vvw.mybluehost.me
autodiscover.rxy.uqp.mybluehost.mecpanel.rxy.uqp.mybluehost.mecpcalendars.rxy.uqp.mybluehost.mecpcontacts.rxy.uqp.mybluehost.memail.rxy.uqp.mybluehost.memail.sboccio.storemail.secretpicnicbox.comrxy.uqp.mybluehost.mesboccio.storesecretpicnicbox.comwebdisk.rxy.uqp.mybluehost.mewebmail.rxy.uqp.mybluehost.mewww.rxy.uqp.mybluehost.mewww.sboccio.storewww.secretpicnicbox.com
autodiscover.xsk.nqg.mybluehost.mecpanel.xsk.nqg.mybluehost.mecpcalendars.xsk.nqg.mybluehost.mecpcontacts.xsk.nqg.mybluehost.memail.xsk.nqg.mybluehost.mewebdisk.xsk.nqg.mybluehost.mewebmail.xsk.nqg.mybluehost.mewww.xsk.nqg.mybluehost.mexsk.nqg.mybluehost.me
autodiscover.ccr.dfq.mybluehost.meccr.dfq.mybluehost.mecpanel.ccr.dfq.mybluehost.mecpcalendars.ccr.dfq.mybluehost.mecpcontacts.ccr.dfq.mybluehost.meimmunologicpro.commail.ccr.dfq.mybluehost.memail.immunologicpro.comwebdisk.ccr.dfq.mybluehost.mewebmail.ccr.dfq.mybluehost.mewww.ccr.dfq.mybluehost.mewww.immunologicpro.com
autodiscover.drinkwicks.comcpanel.drinkwicks.comcpcalendars.drinkwicks.comcpcontacts.drinkwicks.comdrinkwicks.commail.drinkwicks.comwebdisk.drinkwicks.comwebmail.drinkwicks.comwww.drinkwicks.com
dev.mdatac.commike.mdatac.comnostophical.portal.mdatac.comportal.mdatac.comportfolio.mdatac.comwww.dev.mdatac.comwww.mike.mdatac.comwww.nostophical.portal.mdatac.comwww.portal.mdatac.comwww.portfolio.mdatac.com
autodiscover.chubbthoughts.comchubbthoughts.babeslay.comchubbthoughts.comcpanel.chubbthoughts.comcpcalendars.chubbthoughts.comcpcontacts.chubbthoughts.commail.chubbthoughts.comwebdisk.chubbthoughts.comwebmail.chubbthoughts.comwww.chubbthoughts.babeslay.comwww.chubbthoughts.com
autodiscover.jwf.zzh.mybluehost.mecpanel.jwf.zzh.mybluehost.mecpcalendars.jwf.zzh.mybluehost.mecpcontacts.jwf.zzh.mybluehost.mefashionbyfa.comjwf.zzh.mybluehost.memail.jwf.zzh.mybluehost.mewebdisk.jwf.zzh.mybluehost.mewebmail.jwf.zzh.mybluehost.mewww.fashionbyfa.comwww.jwf.zzh.mybluehost.me
autodiscover.lafrancerochelle.comcpanel.lafrancerochelle.comcpcalendars.lafrancerochelle.comcpcontacts.lafrancerochelle.comlafrancerochelle.commail.lafrancerochelle.comwebdisk.lafrancerochelle.comwebmail.lafrancerochelle.comwww.lafrancerochelle.com
autodiscover.imagesofvermont.netcpanel.imagesofvermont.netcpcalendars.imagesofvermont.netcpcontacts.imagesofvermont.netimagesofvermont.netmail.imagesofvermont.netwebdisk.imagesofvermont.netwebmail.imagesofvermont.netwww.imagesofvermont.net
autodiscover.dwo.tqp.mybluehost.mecpanel.dwo.tqp.mybluehost.mecpcalendars.dwo.tqp.mybluehost.mecpcontacts.dwo.tqp.mybluehost.medwo.tqp.mybluehost.memail.dwo.tqp.mybluehost.memail.nutrahealthwave.comnutrahealthwave.comwebdisk.dwo.tqp.mybluehost.mewebmail.dwo.tqp.mybluehost.mewww.dwo.tqp.mybluehost.mewww.nutrahealthwave.com
artecse.comcpanel.artecse.comcpcalendars.artecse.comcpcontacts.artecse.commail.artecse.comwebdisk.artecse.comwebmail.artecse.comwww.artecse.com
8dtransformations.com8dtransformations.soulsofvirtue.comautodiscover.8dtransformations.comcpanel.8dtransformations.comcpcalendars.8dtransformations.comcpcontacts.8dtransformations.commail.8dtransformations.comwebdisk.8dtransformations.comwebmail.8dtransformations.comwww.8dtransformations.comwww.8dtransformations.soulsofvirtue.com
autodiscover.tahammondmarketing.comcpanel.tahammondmarketing.comcpcalendars.tahammondmarketing.comcpcontacts.tahammondmarketing.commail.tahammondmarketing.comtahammondmarketing.comwebdisk.tahammondmarketing.comwebmail.tahammondmarketing.comwww.tahammondmarketing.com
authentousapp.comautodiscover.ypa.sfg.mybluehost.mecpanel.ypa.sfg.mybluehost.mecpcalendars.ypa.sfg.mybluehost.mecpcontacts.ypa.sfg.mybluehost.memail.authentousapp.commail.ypa.sfg.mybluehost.mewebdisk.ypa.sfg.mybluehost.mewebmail.ypa.sfg.mybluehost.mewww.authentousapp.comwww.ypa.sfg.mybluehost.meypa.sfg.mybluehost.me
autodiscover.lailasandbaek.comcpanel.lailasandbaek.comcpcalendars.lailasandbaek.comcpcontacts.lailasandbaek.comlailasandbaek.commail.lailasandbaek.comwebdisk.lailasandbaek.comwebmail.lailasandbaek.comwww.lailasandbaek.com
autodiscover.modmoods.comcpanel.modmoods.comcpcalendars.modmoods.comcpcontacts.modmoods.commail.modmoods.commodmoods.comwebdisk.modmoods.comwebmail.modmoods.comwww.modmoods.com
autodiscover.ellisoncartercattle.comcpanel.ellisoncartercattle.comcpcalendars.ellisoncartercattle.comcpcontacts.ellisoncartercattle.comellisoncartercattle.commail.ellisoncartercattle.comwebdisk.ellisoncartercattle.comwebmail.ellisoncartercattle.comwww.ellisoncartercattle.com
autodiscover.doombots.coautodiscover.lauraaaa.comcpanel.doombots.cocpanel.lauraaaa.comcpcalendars.doombots.cocpcalendars.lauraaaa.comcpcontacts.doombots.cocpcontacts.lauraaaa.comdoombots.colauraaaa.comlauraaaa.doombots.comail.doombots.comail.lauraaaa.comwebdisk.doombots.cowebdisk.lauraaaa.comwebmail.doombots.cowebmail.lauraaaa.comwww.doombots.cowww.lauraaaa.comwww.lauraaaa.doombots.co
autodiscover.ukc.feb.mybluehost.mecpanel.ukc.feb.mybluehost.mecpcalendars.ukc.feb.mybluehost.mecpcontacts.ukc.feb.mybluehost.memail.ukc.feb.mybluehost.meukc.feb.mybluehost.mewebdisk.ukc.feb.mybluehost.mewebmail.ukc.feb.mybluehost.mewww.ukc.feb.mybluehost.me
autodiscover.t2rtx.comcpanel.t2rtx.comcpcalendars.t2rtx.comcpcontacts.t2rtx.commail.t2rtx.comt2rtx.comt2rtx.e2waz.comwebdisk.t2rtx.comwebmail.t2rtx.comwww.t2rtx.comwww.t2rtx.e2waz.com
autodiscover.saz.fsx.mybluehost.mecpanel.saz.fsx.mybluehost.mecpcalendars.saz.fsx.mybluehost.mecpcontacts.saz.fsx.mybluehost.memadosamart.commail.saz.fsx.mybluehost.mesaz.fsx.mybluehost.mewebdisk.saz.fsx.mybluehost.mewebmail.saz.fsx.mybluehost.mewww.madosamart.comwww.saz.fsx.mybluehost.me
autodiscover.rubberduckyresort.comcpanel.rubberduckyresort.comcpcalendars.rubberduckyresort.comcpcontacts.rubberduckyresort.commail.rubberduckyresort.comrubberduckyresort.comrubberduckyresort.tcf.puk.mybluehost.mewebdisk.rubberduckyresort.comwebmail.rubberduckyresort.comwww.rubberduckyresort.comwww.rubberduckyresort.tcf.puk.mybluehost.me
autodiscover.bubbachat.auautodiscover.bubbachat.comautodiscover.bubbachat.com.aububbachat.aububbachat.combubbachat.com.aucpanel.bubbachat.aucpanel.bubbachat.comcpanel.bubbachat.com.aucpcalendars.bubbachat.aucpcalendars.bubbachat.comcpcalendars.bubbachat.com.aucpcontacts.bubbachat.aucpcontacts.bubbachat.comcpcontacts.bubbachat.com.aumail.bubbachat.aumail.bubbachat.commail.bubbachat.com.auwebdisk.bubbachat.auwebdisk.bubbachat.comwebdisk.bubbachat.com.auwebmail.bubbachat.auwebmail.bubbachat.comwebmail.bubbachat.com.auwebsite-0153daa3.irz.zga.mybluehost.mewww.bubbachat.auwww.bubbachat.comwww.bubbachat.com.auwww.website-0153daa3.irz.zga.mybluehost.me
megsmedicareandmore.havemedicare.comwww.megsmedicareandmore.havemedicare.com
autodiscover.pdl.jfc.mybluehost.mecpanel.pdl.jfc.mybluehost.mecpcalendars.pdl.jfc.mybluehost.mecpcontacts.pdl.jfc.mybluehost.meeg.pdl.jfc.mybluehost.meenvirogreen.aeenvirogreen.pdl.jfc.mybluehost.memail.pdl.jfc.mybluehost.mepdl.jfc.mybluehost.mewebdisk.pdl.jfc.mybluehost.mewebmail.pdl.jfc.mybluehost.mewww.eg.pdl.jfc.mybluehost.mewww.envirogreen.aewww.envirogreen.pdl.jfc.mybluehost.mewww.pdl.jfc.mybluehost.me
autodiscover.wxa.aca.mybluehost.mecpanel.wxa.aca.mybluehost.mecpcalendars.wxa.aca.mybluehost.mecpcontacts.wxa.aca.mybluehost.memail.schneider-et.commail.schneider-et.netmail.wxa.aca.mybluehost.meschneider-et.comschneider-et.netwebdisk.wxa.aca.mybluehost.mewebmail.wxa.aca.mybluehost.mewww.schneider-et.comwww.schneider-et.netwww.wxa.aca.mybluehost.mewxa.aca.mybluehost.me
autodiscover.filmnoirfile.comautodiscover.spectorsoul.comcpanel.filmnoirfile.comcpanel.spectorsoul.comcpcalendars.filmnoirfile.comcpcalendars.spectorsoul.comcpcontacts.filmnoirfile.comcpcontacts.spectorsoul.comfilmnoirfile.comfilmnoirfile.spectorsoul.commail.filmnoirfile.commail.spectorsoul.comspectorsoul.comwebdisk.filmnoirfile.comwebdisk.spectorsoul.comwebmail.filmnoirfile.comwebmail.spectorsoul.comwww.filmnoirfile.comwww.filmnoirfile.spectorsoul.comwww.spectorsoul.com
autodiscover.palomponleyte.gov.phcpanel.palomponleyte.gov.phcpcalendars.palomponleyte.gov.phcpcontacts.palomponleyte.gov.phmail.palomponleyte.gov.phpalomponleyte-gov-ph.triconnsolutions.compalomponleyte.gov.phwebdisk.palomponleyte.gov.phwebmail.palomponleyte.gov.phwww.palomponleyte-gov-ph.triconnsolutions.comwww.palomponleyte.gov.ph
autodiscover.galaherlaw.comcpanel.galaherlaw.comcpcalendars.galaherlaw.comcpcontacts.galaherlaw.comgalaherlaw.commail.galaherlaw.comwebdisk.galaherlaw.comwebmail.galaherlaw.comwww.galaherlaw.com
autodiscover.wyb.lsw.mybluehost.meclearvisiondefend.comcpanel.wyb.lsw.mybluehost.mecpcalendars.wyb.lsw.mybluehost.mecpcontacts.wyb.lsw.mybluehost.memail.clearvisiondefend.commail.wyb.lsw.mybluehost.mewebdisk.wyb.lsw.mybluehost.mewebmail.wyb.lsw.mybluehost.mewww.clearvisiondefend.comwww.wyb.lsw.mybluehost.mewyb.lsw.mybluehost.me
joannlee.me
cristinamarie.cowww.cristinamarie.co
1migrationworldwide.comautodiscover.1migrationworldwide.comcpanel.1migrationworldwide.comcpcalendars.1migrationworldwide.comcpcontacts.1migrationworldwide.commail.1migrationworldwide.comwebdisk.1migrationworldwide.comwebmail.1migrationworldwide.comwww.1migrationworldwide.com
augustgarrett.comautodiscover.augustgarrett.comcpanel.augustgarrett.comcpcalendars.augustgarrett.comcpcontacts.augustgarrett.commail.augustgarrett.comwebdisk.augustgarrett.comwebmail.augustgarrett.comwww.augustgarrett.com
autodiscover.sym.bli.mybluehost.mecpanel.sym.bli.mybluehost.mecpcalendars.sym.bli.mybluehost.mecpcontacts.sym.bli.mybluehost.memail.sym.bli.mybluehost.memail.treedownservices.comsym.bli.mybluehost.metreedownservices.comwebdisk.sym.bli.mybluehost.mewebmail.sym.bli.mybluehost.mewww.sym.bli.mybluehost.mewww.treedownservices.com
autodiscover.qgt.nsm.mybluehost.mecpanel.qgt.nsm.mybluehost.mecpcalendars.qgt.nsm.mybluehost.mecpcontacts.qgt.nsm.mybluehost.memail.qgt.nsm.mybluehost.memail.tillisholdingsllc.comqgt.nsm.mybluehost.metillisholdingsllc.comwebdisk.qgt.nsm.mybluehost.mewebmail.qgt.nsm.mybluehost.mewww.qgt.nsm.mybluehost.mewww.tillisholdingsllc.com
autodiscover.cosmaxnbtusa.comcosmaxnbtusa.comcpanel.cosmaxnbtusa.comcpcalendars.cosmaxnbtusa.comcpcontacts.cosmaxnbtusa.commail.cosmaxnbtusa.comwebdisk.cosmaxnbtusa.comwebmail.cosmaxnbtusa.comwebsite-eeda54a2.lcs.gqj.mybluehost.mewww.cosmaxnbtusa.comwww.website-eeda54a2.lcs.gqj.mybluehost.me
apexusaenterpriseinc.comautodiscover.apexusaenterpriseinc.comcpanel.apexusaenterpriseinc.comcpcalendars.apexusaenterpriseinc.comcpcontacts.apexusaenterpriseinc.commail.apexusaenterpriseinc.comwebdisk.apexusaenterpriseinc.comwebmail.apexusaenterpriseinc.comwebsite-099b56d3.cvr.jzw.mybluehost.mewww.apexusaenterpriseinc.comwww.website-099b56d3.cvr.jzw.mybluehost.me
autodiscover.hny.bhx.mybluehost.mecpanel.hny.bhx.mybluehost.mecpcalendars.hny.bhx.mybluehost.mecpcontacts.hny.bhx.mybluehost.mehny.bhx.mybluehost.memail.hny.bhx.mybluehost.mewebdisk.hny.bhx.mybluehost.mewebmail.hny.bhx.mybluehost.mewww.hny.bhx.mybluehost.me
autodiscover.fields-fowler.comcpanel.fields-fowler.comcpcalendars.fields-fowler.comcpcontacts.fields-fowler.comfields-fowler.commail.fields-fowler.comwebdisk.fields-fowler.comwebmail.fields-fowler.comwebsite-b42a782f.zsk.wvf.mybluehost.mewww.fields-fowler.comwww.website-b42a782f.zsk.wvf.mybluehost.me
autodiscover.jacksontel.comcpanel.jacksontel.comcpcalendars.jacksontel.comcpcontacts.jacksontel.comjacksontel.comjacksontel.kenmoreavenuebooks.commail.jacksontel.comwebdisk.jacksontel.comwebmail.jacksontel.comwww.jacksontel.comwww.jacksontel.kenmoreavenuebooks.com
adultingtoo.comautodiscover.adultingtoo.comcpanel.adultingtoo.comcpcalendars.adultingtoo.comcpcontacts.adultingtoo.commail.adultingtoo.comwebdisk.adultingtoo.comwebmail.adultingtoo.comwww.adultingtoo.com
autodiscover.yho.rdx.mybluehost.mecpanel.yho.rdx.mybluehost.mecpcalendars.yho.rdx.mybluehost.mecpcontacts.yho.rdx.mybluehost.memail.yho.rdx.mybluehost.mewebdisk.yho.rdx.mybluehost.mewebmail.yho.rdx.mybluehost.mewww.yho.rdx.mybluehost.meyho.rdx.mybluehost.me
devotedfmo.havemedicare.comwww.devotedfmo.havemedicare.com
autodiscover.dfz.eln.mybluehost.mecpanel.dfz.eln.mybluehost.mecpcalendars.dfz.eln.mybluehost.mecpcontacts.dfz.eln.mybluehost.medfz.eln.mybluehost.meeuromontpvc.netmail.dfz.eln.mybluehost.memail.euromontpvc.netwebdisk.dfz.eln.mybluehost.mewebmail.dfz.eln.mybluehost.mewww.dfz.eln.mybluehost.mewww.euromontpvc.net
autodiscover.denyseforoc.comautodiscover.jessebuss.comcpanel.denyseforoc.comcpanel.jessebuss.comcpcalendars.denyseforoc.comcpcalendars.jessebuss.comcpcontacts.denyseforoc.comcpcontacts.jessebuss.comdenyseforoc.comdenyseforoc.jessebuss.comjessebuss.commail.denyseforoc.commail.jessebuss.commail.wlgpnw.comwebdisk.denyseforoc.comwebdisk.jessebuss.comwebmail.denyseforoc.comwebmail.jessebuss.comwlgpnw.comwww.denyseforoc.comwww.denyseforoc.jessebuss.comwww.jessebuss.comwww.wlgpnw.com
autodiscover.otl.bjl.mybluehost.mecpanel.otl.bjl.mybluehost.mecpcalendars.otl.bjl.mybluehost.mecpcontacts.otl.bjl.mybluehost.memail.opexanswers.commail.otl.bjl.mybluehost.meopexanswers.comotl.bjl.mybluehost.mewebdisk.otl.bjl.mybluehost.mewebmail.otl.bjl.mybluehost.mewww.opexanswers.comwww.otl.bjl.mybluehost.me
autodiscover.kayecoaching.comcpanel.kayecoaching.comcpcalendars.kayecoaching.comcpcontacts.kayecoaching.comkayecoaching.comkayecoaching.notemusings.commail.kayecoaching.comwebdisk.kayecoaching.comwebmail.kayecoaching.comwww.kayecoaching.comwww.kayecoaching.notemusings.com
autodiscover.xrl.oui.mybluehost.mecpanel.xrl.oui.mybluehost.mecpcalendars.xrl.oui.mybluehost.mecpcontacts.xrl.oui.mybluehost.memail.stonedloverboy.commail.xrl.oui.mybluehost.mestonedloverboy.comwebdisk.xrl.oui.mybluehost.mewebmail.xrl.oui.mybluehost.mewww.stonedloverboy.comwww.xrl.oui.mybluehost.mexrl.oui.mybluehost.me
website-f69fa513.samysbeauty.comwww.website-f69fa513.samysbeauty.com
akn.wyt.mybluehost.meautodiscover.akn.wyt.mybluehost.meautodiscover.mymedicaresol.comcpanel.akn.wyt.mybluehost.mecpanel.mymedicaresol.comcpcalendars.akn.wyt.mybluehost.mecpcalendars.mymedicaresol.comcpcontacts.akn.wyt.mybluehost.mecpcontacts.mymedicaresol.commail.akn.wyt.mybluehost.memail.mymedicaresol.commymedicaresol.akn.wyt.mybluehost.memymedicaresol.comwebdisk.akn.wyt.mybluehost.mewebdisk.mymedicaresol.comwebmail.akn.wyt.mybluehost.mewebmail.mymedicaresol.comwww.akn.wyt.mybluehost.mewww.mymedicaresol.akn.wyt.mybluehost.mewww.mymedicaresol.com
autodiscover.dve.uxb.mybluehost.mecpanel.dve.uxb.mybluehost.mecpcalendars.dve.uxb.mybluehost.mecpcontacts.dve.uxb.mybluehost.medve.uxb.mybluehost.memail.dve.uxb.mybluehost.memail.mamaliciously.commamaliciously.comwebdisk.dve.uxb.mybluehost.mewebmail.dve.uxb.mybluehost.mewww.dve.uxb.mybluehost.mewww.mamaliciously.com
autodiscover.dcglobejotters.orgcpanel.dcglobejotters.orgcpcalendars.dcglobejotters.orgcpcontacts.dcglobejotters.orgdcglobejotters.orgmail.dcglobejotters.orgwebdisk.dcglobejotters.orgwebmail.dcglobejotters.orgwww.dcglobejotters.org
autodiscover.dhm.wxt.mybluehost.mecpanel.dhm.wxt.mybluehost.mecpcalendars.dhm.wxt.mybluehost.mecpcontacts.dhm.wxt.mybluehost.medaniyaal.cadhm.wxt.mybluehost.memail.daniyaal.camail.dhm.wxt.mybluehost.mewebdisk.dhm.wxt.mybluehost.mewebmail.dhm.wxt.mybluehost.mewww.daniyaal.cawww.dhm.wxt.mybluehost.me
apis.flamalama.comauderias-art.flamalama.comauderias.artautodiscover.auderias.artautodiscover.papelypoli.clcpanel.auderias.artcpanel.papelypoli.clcpcalendars.auderias.artcpcalendars.papelypoli.clcpcontacts.auderias.artcpcontacts.papelypoli.clmail.auderias.artmail.papelypoli.clpapelypoli-cl.flamalama.compapelypoli.clwebdisk.auderias.artwebdisk.papelypoli.clwebmail.auderias.artwebmail.papelypoli.clwww.apis.flamalama.comwww.auderias-art.flamalama.comwww.auderias.artwww.papelypoli-cl.flamalama.comwww.papelypoli.cl
autodiscover.startuparabia.comcpanel.startuparabia.comcpcalendars.startuparabia.comcpcontacts.startuparabia.commail.startuparabia.comstartuparabia.comstartuparabia.subzeroblue.comwebdisk.startuparabia.comwebmail.startuparabia.comwww.startuparabia.comwww.startuparabia.subzeroblue.com
autodiscover.ugs.cup.mybluehost.mecpanel.ugs.cup.mybluehost.mecpcalendars.ugs.cup.mybluehost.mecpcontacts.ugs.cup.mybluehost.mefairytaletravelguide.commail.fairytaletravelguide.commail.ugs.cup.mybluehost.meugs.cup.mybluehost.mewebdisk.ugs.cup.mybluehost.mewebmail.ugs.cup.mybluehost.mewww.fairytaletravelguide.comwww.ugs.cup.mybluehost.me
autodiscover.tcc.xjl.mybluehost.mecpanel.tcc.xjl.mybluehost.mecpcalendars.tcc.xjl.mybluehost.mecpcontacts.tcc.xjl.mybluehost.memail.prettywyld.commail.tcc.xjl.mybluehost.meprettywyld.comtcc.xjl.mybluehost.mewebdisk.tcc.xjl.mybluehost.mewebmail.tcc.xjl.mybluehost.mewww.prettywyld.comwww.tcc.xjl.mybluehost.me
autodiscover.solicitymedia.comcpanel.solicitymedia.comcpcalendars.solicitymedia.comcpcontacts.solicitymedia.commail.solicitymedia.comsolicitymedia.comwebdisk.solicitymedia.comwebmail.solicitymedia.comwww.solicitymedia.com
afp.zyv.mybluehost.meautodiscover.afp.zyv.mybluehost.mecpanel.afp.zyv.mybluehost.mecpcalendars.afp.zyv.mybluehost.mecpcontacts.afp.zyv.mybluehost.memail.afp.zyv.mybluehost.memail.nexo-motors.comnexo-motors.comwebdisk.afp.zyv.mybluehost.mewebmail.afp.zyv.mybluehost.mewww.afp.zyv.mybluehost.mewww.nexo-motors.com
idiomas.uas.edu.mxwebsite-6dfc558e.mpt.qsp.mybluehost.mewww.website-6dfc558e.mpt.qsp.mybluehost.me
autodiscover.sunnybrookefootball.caautodiscover.sunnybrookefootball.comcpanel.sunnybrookefootball.cacpanel.sunnybrookefootball.comcpcalendars.sunnybrookefootball.cacpcalendars.sunnybrookefootball.comcpcontacts.sunnybrookefootball.cacpcontacts.sunnybrookefootball.commail.sunnybrookefootball.camail.sunnybrookefootball.comsunnybrookefootball-ca.sunnybrookefootball.comsunnybrookefootball.casunnybrookefootball.comwebdisk.sunnybrookefootball.cawebdisk.sunnybrookefootball.comwebmail.sunnybrookefootball.cawebmail.sunnybrookefootball.comwww.sunnybrookefootball-ca.sunnybrookefootball.comwww.sunnybrookefootball.cawww.sunnybrookefootball.com
website-9c4cb59f.hny.bhx.mybluehost.mewebsite-cc21065f.hny.bhx.mybluehost.mewww.website-9c4cb59f.hny.bhx.mybluehost.mewww.website-cc21065f.hny.bhx.mybluehost.me
autodiscover.uncageyourinnerlioness.comcpanel.uncageyourinnerlioness.comcpcalendars.uncageyourinnerlioness.comcpcontacts.uncageyourinnerlioness.commail.uncageyourinnerlioness.comuncageyourinnerlioness.comuncageyourinnerlioness.livewholistic.comwebdisk.uncageyourinnerlioness.comwebmail.uncageyourinnerlioness.comwww.uncageyourinnerlioness.comwww.uncageyourinnerlioness.livewholistic.com
autodiscover.playitforwardsportstherapy.comcpanel.playitforwardsportstherapy.comcpcalendars.playitforwardsportstherapy.comcpcontacts.playitforwardsportstherapy.commail.playitforwardsportstherapy.commail.playitforwardtherapy.complayitforwardsportstherapy.complayitforwardtherapy.comwebdisk.playitforwardsportstherapy.comwebmail.playitforwardsportstherapy.comwww.playitforwardsportstherapy.comwww.playitforwardtherapy.com
autodiscover.estessparkles.comcpanel.estessparkles.comcpcalendars.estessparkles.comcpcontacts.estessparkles.comestessparkles.commail.estessparkles.comwebdisk.estessparkles.comwebmail.estessparkles.comwww.estessparkles.com
website-e10ff660.sxm.wyy.mybluehost.mewww.website-e10ff660.sxm.wyy.mybluehost.me
autodiscover.jgw.gro.mybluehost.mecpanel.jgw.gro.mybluehost.mecpcalendars.jgw.gro.mybluehost.mecpcontacts.jgw.gro.mybluehost.mejgw.gro.mybluehost.memail.jgw.gro.mybluehost.mewebdisk.jgw.gro.mybluehost.mewebmail.jgw.gro.mybluehost.mewww.jgw.gro.mybluehost.me
autodiscover.pfcontractorsteam.comcpanel.pfcontractorsteam.comcpcalendars.pfcontractorsteam.comcpcontacts.pfcontractorsteam.commail.pfcontractorsteam.compfcontractorsteam.comwebdisk.pfcontractorsteam.comwebmail.pfcontractorsteam.comwww.pfcontractorsteam.com
autodiscover.evergreennote.comcpanel.evergreennote.comcpcalendars.evergreennote.comcpcontacts.evergreennote.comevergreennote.commail.evergreennote.comwebdisk.evergreennote.comwebmail.evergreennote.comwebsite-1d0d0b00.tbh.qjv.mybluehost.mewww.evergreennote.comwww.website-1d0d0b00.tbh.qjv.mybluehost.me
autodiscover.edyukation.comcpanel.edyukation.comcpcalendars.edyukation.comcpcontacts.edyukation.comedyukation.comedyukation.isanskriti.commail.edyukation.comwebdisk.edyukation.comwebmail.edyukation.comwww.edyukation.comwww.edyukation.isanskriti.com
autodiscover.marinvest.cvcpanel.marinvest.cvcpcalendars.marinvest.cvcpcontacts.marinvest.cvmail.marinvest.cvmarinvest.cvwebdisk.marinvest.cvwebmail.marinvest.cvwww.marinvest.cv
autodiscover.findingataraxia.comcpanel.findingataraxia.comcpcalendars.findingataraxia.comcpcontacts.findingataraxia.comfindingataraxia.commail.findingataraxia.comwebdisk.findingataraxia.comwebmail.findingataraxia.comwww.findingataraxia.com
autodiscover.kst.ths.mybluehost.meawakencentre.comcpanel.kst.ths.mybluehost.mecpcalendars.kst.ths.mybluehost.mecpcontacts.kst.ths.mybluehost.mekst.ths.mybluehost.memail.awakencentre.commail.kst.ths.mybluehost.mewebdisk.kst.ths.mybluehost.mewebmail.kst.ths.mybluehost.mewww.awakencentre.comwww.kst.ths.mybluehost.me
autodiscover.fabianinsurance.comcpanel.fabianinsurance.comcpcalendars.fabianinsurance.comcpcontacts.fabianinsurance.comfabianinsurance.comfabianinsurance.havemedicare.commail.fabianinsurance.comtengomedicare.havemedicare.comwebdisk.fabianinsurance.comwebmail.fabianinsurance.comwww.fabianinsurance.comwww.fabianinsurance.havemedicare.comwww.tengomedicare.havemedicare.com
website-27017e92.rmp.uqp.mybluehost.mewww.website-27017e92.rmp.uqp.mybluehost.me
autodiscover.isanskriti.comautodiscover.premiumbeveragesllc.comcpanel.isanskriti.comcpanel.premiumbeveragesllc.comcpcalendars.isanskriti.comcpcalendars.premiumbeveragesllc.comcpcontacts.isanskriti.comcpcontacts.premiumbeveragesllc.comgurudwara.isanskriti.comisanskriti.commail.isanskriti.commail.premiumbeveragesllc.compremiumbeveragesllc.compremiumbeveragesllc.isanskriti.comwebdisk.isanskriti.comwebdisk.premiumbeveragesllc.comwebmail.isanskriti.comwebmail.premiumbeveragesllc.comwww.gurudwara.isanskriti.comwww.isanskriti.comwww.premiumbeveragesllc.comwww.premiumbeveragesllc.isanskriti.com
autodiscover.rgb.peu.mybluehost.mecpanel.rgb.peu.mybluehost.mecpcalendars.rgb.peu.mybluehost.mecpcontacts.rgb.peu.mybluehost.memail.rgb.peu.mybluehost.mepriorityyou.netrgb.peu.mybluehost.mewebdisk.rgb.peu.mybluehost.mewebmail.rgb.peu.mybluehost.mewww.rgb.peu.mybluehost.me
autodiscover.rbs.fih.mybluehost.mecpanel.rbs.fih.mybluehost.mecpcalendars.rbs.fih.mybluehost.mecpcontacts.rbs.fih.mybluehost.meelectrofos.commail.electrofos.commail.rbs.fih.mybluehost.merbs.fih.mybluehost.mewebdisk.rbs.fih.mybluehost.mewebmail.rbs.fih.mybluehost.mewww.electrofos.comwww.rbs.fih.mybluehost.me
members.rocketyourcontent.comwww.members.rocketyourcontent.com
autodiscover.mkz.tuk.mybluehost.mecpanel.mkz.tuk.mybluehost.mecpcalendars.mkz.tuk.mybluehost.mecpcontacts.mkz.tuk.mybluehost.memail.mkz.tuk.mybluehost.memkz.tuk.mybluehost.mewebdisk.mkz.tuk.mybluehost.mewebmail.mkz.tuk.mybluehost.mewww.mkz.tuk.mybluehost.me
autodiscover.ljq.ygs.mybluehost.mecpanel.ljq.ygs.mybluehost.mecpcalendars.ljq.ygs.mybluehost.mecpcontacts.ljq.ygs.mybluehost.megetbettersleeptoday.comljq.ygs.mybluehost.memail.getbettersleeptoday.commail.ljq.ygs.mybluehost.mewebdisk.ljq.ygs.mybluehost.mewebmail.ljq.ygs.mybluehost.mewww.getbettersleeptoday.comwww.ljq.ygs.mybluehost.me
autodiscover.workerx.com.aucpanel.workerx.com.aucpcalendars.workerx.com.aucpcontacts.workerx.com.aumail.workerx.com.auwebdisk.workerx.com.auwebmail.workerx.com.auwebsite-d15f2dd6.irz.zga.mybluehost.meworkerx.com.auwww.website-d15f2dd6.irz.zga.mybluehost.mewww.workerx.com.au
autodiscover.kix.feb.mybluehost.mecpanel.kix.feb.mybluehost.mecpcalendars.kix.feb.mybluehost.mecpcontacts.kix.feb.mybluehost.mekix.feb.mybluehost.memail.kix.feb.mybluehost.memail.tchnoweb.comtchnoweb.comwebdisk.kix.feb.mybluehost.mewebmail.kix.feb.mybluehost.mewww.kix.feb.mybluehost.mewww.tchnoweb.com
autodiscover.bhf.bma.mybluehost.mebhf.bma.mybluehost.mecpanel.bhf.bma.mybluehost.mecpcalendars.bhf.bma.mybluehost.mecpcontacts.bhf.bma.mybluehost.memail.bhf.bma.mybluehost.memail.prjelectric.comprjelectric.comwebdisk.bhf.bma.mybluehost.mewebmail.bhf.bma.mybluehost.mewww.bhf.bma.mybluehost.mewww.prjelectric.com
autodiscover.markpevsner.comcpanel.markpevsner.comcpcalendars.markpevsner.comcpcontacts.markpevsner.commail.markpevsner.commail.psduo.commarkpevsner.compsduo.comwebdisk.markpevsner.comwebmail.markpevsner.comwww.markpevsner.comwww.psduo.com
autodiscover.integritydatamanagement.comcpanel.integritydatamanagement.comcpcalendars.integritydatamanagement.comcpcontacts.integritydatamanagement.comintegritydatamanagement.commail.integritydatamanagement.commail.oidm.comoidm.comwebdisk.integritydatamanagement.comwebmail.integritydatamanagement.comwww.integritydatamanagement.comwww.oidm.com
autodiscover.lvq.mjj.mybluehost.mecpanel.lvq.mjj.mybluehost.mecpcalendars.lvq.mjj.mybluehost.mecpcontacts.lvq.mjj.mybluehost.melvq.mjj.mybluehost.memail.lvq.mjj.mybluehost.mewebdisk.lvq.mjj.mybluehost.mewebmail.lvq.mjj.mybluehost.mewww.lvq.mjj.mybluehost.me
autodiscover.ups.zsr.mybluehost.mecpanel.ups.zsr.mybluehost.mecpcalendars.ups.zsr.mybluehost.mecpcontacts.ups.zsr.mybluehost.meferestrecontainere.commail.ferestrecontainere.commail.ups.zsr.mybluehost.metamplariecontainere.comups.zsr.mybluehost.mewebdisk.ups.zsr.mybluehost.mewebmail.ups.zsr.mybluehost.mewww.ferestrecontainere.comwww.ups.zsr.mybluehost.me
autodiscover.teamwcoaching.comcpanel.teamwcoaching.comcpcalendars.teamwcoaching.comcpcontacts.teamwcoaching.commail.teamwcoaching.comstaging.teamwcoaching.comteamwcoaching.comwebdisk.teamwcoaching.comwebmail.teamwcoaching.comwww.staging.teamwcoaching.comwww.teamwcoaching.com
autodiscover.onii-corp.comcpanel.onii-corp.comcpcalendars.onii-corp.comcpcontacts.onii-corp.commail.onii-corp.comonii-corp.comwebdisk.onii-corp.comwebmail.onii-corp.comwww.onii-corp.com
2hrdwrkrs.comautodiscover.mxy.oea.mybluehost.mecpanel.mxy.oea.mybluehost.mecpcalendars.mxy.oea.mybluehost.mecpcontacts.mxy.oea.mybluehost.memail.2hrdwrkrs.commail.mxy.oea.mybluehost.memxy.oea.mybluehost.mewebdisk.mxy.oea.mybluehost.mewebmail.mxy.oea.mybluehost.mewww.2hrdwrkrs.comwww.mxy.oea.mybluehost.me
autodiscover.fanhorror.comcpanel.fanhorror.comcpcalendars.fanhorror.comcpcontacts.fanhorror.comfanhorror.comfanhorror.penthousedog.commail.fanhorror.comwebdisk.fanhorror.comwebmail.fanhorror.comwww.fanhorror.comwww.fanhorror.penthousedog.com
autodiscover.debhartmandigital.comautodiscover.lewiselc.orgcpanel.debhartmandigital.comcpanel.lewiselc.orgcpcalendars.debhartmandigital.comcpcalendars.lewiselc.orgcpcontacts.debhartmandigital.comcpcontacts.lewiselc.orgdebhartmandigital.comlewiselc-org.debhartmandigital.comlewiselc.orgmail.debhartmandigital.commail.lewiselc.orgwebdisk.debhartmandigital.comwebdisk.lewiselc.orgwebmail.debhartmandigital.comwebmail.lewiselc.orgwww.debhartmandigital.comwww.lewiselc-org.debhartmandigital.comwww.lewiselc.org
autodiscover.xcw.xvx.mybluehost.mecctraining.cacpanel.xcw.xvx.mybluehost.mecpcalendars.xcw.xvx.mybluehost.mecpcontacts.xcw.xvx.mybluehost.memail.cctraining.camail.xcw.xvx.mybluehost.mewebdisk.xcw.xvx.mybluehost.mewebmail.xcw.xvx.mybluehost.mewww.cctraining.cawww.xcw.xvx.mybluehost.mexcw.xvx.mybluehost.me
autodiscover.dsb.sco.mybluehost.mecpanel.dsb.sco.mybluehost.mecpcalendars.dsb.sco.mybluehost.mecpcontacts.dsb.sco.mybluehost.medsb.sco.mybluehost.memail.dsb.sco.mybluehost.memail.newideasservices.comnewideasservices.comwebdisk.dsb.sco.mybluehost.mewebmail.dsb.sco.mybluehost.mewww.dsb.sco.mybluehost.mewww.newideasservices.com
abcgomedicare.havemedicare.comautodiscover.gbc.kkt.mybluehost.mecpanel.gbc.kkt.mybluehost.mecpcalendars.gbc.kkt.mybluehost.mecpcontacts.gbc.kkt.mybluehost.megbc.kkt.mybluehost.megbckktmybluehostme.havemedicare.commail.gbc.kkt.mybluehost.mewebdisk.gbc.kkt.mybluehost.mewebmail.gbc.kkt.mybluehost.mewww.abcgomedicare.havemedicare.comwww.gbc.kkt.mybluehost.mewww.gbckktmybluehostme.havemedicare.com
autodiscover.dik.hsk.mybluehost.mecpanel.dik.hsk.mybluehost.mecpcalendars.dik.hsk.mybluehost.mecpcontacts.dik.hsk.mybluehost.medik.hsk.mybluehost.memail.dik.hsk.mybluehost.mewebdisk.dik.hsk.mybluehost.mewebmail.dik.hsk.mybluehost.mewww.dik.hsk.mybluehost.me
autodiscover.feliztips.comcpanel.feliztips.comcpcalendars.feliztips.comcpcontacts.feliztips.comfeliztips.commail.feliztips.comwebdisk.feliztips.comwebmail.feliztips.comwww.feliztips.com
autodiscover.kristinmacdermott.comcpanel.kristinmacdermott.comcpcalendars.kristinmacdermott.comcpcontacts.kristinmacdermott.comkristinmacdermott.commail.kristinmacdermott.comwebdisk.kristinmacdermott.comwebmail.kristinmacdermott.comwww.kristinmacdermott.com
autodiscover.ghr.hgs.mybluehost.mecpanel.ghr.hgs.mybluehost.mecpcalendars.ghr.hgs.mybluehost.mecpcontacts.ghr.hgs.mybluehost.meghr.hgs.mybluehost.memail.ghr.hgs.mybluehost.merubberint.comwebdisk.ghr.hgs.mybluehost.mewebmail.ghr.hgs.mybluehost.mewww.ghr.hgs.mybluehost.mewww.rubberint.com
autodiscover.yzg.ccw.mybluehost.mecpanel.yzg.ccw.mybluehost.mecpcalendars.yzg.ccw.mybluehost.mecpcontacts.yzg.ccw.mybluehost.meiwantittoday.netmail.iwantittoday.netmail.yzg.ccw.mybluehost.mewebdisk.yzg.ccw.mybluehost.mewebmail.yzg.ccw.mybluehost.mewww.iwantittoday.netwww.yzg.ccw.mybluehost.meyzg.ccw.mybluehost.me
autodiscover.zbv.ujd.mybluehost.mecpanel.zbv.ujd.mybluehost.mecpcalendars.zbv.ujd.mybluehost.mecpcontacts.zbv.ujd.mybluehost.memail.zbv.ujd.mybluehost.mewebdisk.zbv.ujd.mybluehost.mewebmail.zbv.ujd.mybluehost.mewww.zbv.ujd.mybluehost.mezbv.ujd.mybluehost.me
rmkm.rmrc.sitewww.rmkm.rmrc.site
revassistant.lifehacksx.comwww.revassistant.lifehacksx.com
antonioefratellizappa.comcpanel.zappamacchine.comcpcalendars.zappamacchine.comcpcontacts.zappamacchine.commail.antonioefratellizappa.commail.zappamacchine.comwebdisk.zappamacchine.comwebmail.zappamacchine.comwww.antonioefratellizappa.comwww.zappamacchine.comzappamacchine.com
autodiscover.caosventura.comcaosventura.comcaosventura.flamalama.comcpanel.caosventura.comcpcalendars.caosventura.comcpcontacts.caosventura.commail.caosventura.comwebdisk.caosventura.comwebmail.caosventura.comwww.caosventura.comwww.caosventura.flamalama.com
blog.overseasjo.comwww.blog.overseasjo.com
maithri.varshavg.comwww.maithri.varshavg.com
autodiscover.tessandtrix.comautodiscover.theheartofsurrender.comcpanel.tessandtrix.comcpanel.theheartofsurrender.comcpcalendars.tessandtrix.comcpcalendars.theheartofsurrender.comcpcontacts.tessandtrix.comcpcontacts.theheartofsurrender.commail.tessandtrix.commail.theheartofsurrender.comtessandtrix.comtessandtrix.theheartofsurrender.comtheheartofsurrender.comwebdisk.tessandtrix.comwebdisk.theheartofsurrender.comwebmail.tessandtrix.comwebmail.theheartofsurrender.comwww.tessandtrix.comwww.tessandtrix.theheartofsurrender.comwww.theheartofsurrender.com
autodiscover.theartoflivin.comautodiscover.theartoflivin.netcpanel.theartoflivin.comcpanel.theartoflivin.netcpcalendars.theartoflivin.comcpcalendars.theartoflivin.netcpcontacts.theartoflivin.comcpcontacts.theartoflivin.netmail.theartoflivin.commail.theartoflivin.nettheartoflivin-net.theartoflivin.comtheartoflivin.comtheartoflivin.netwebdisk.theartoflivin.comwebdisk.theartoflivin.netwebmail.theartoflivin.comwebmail.theartoflivin.netwww.theartoflivin-net.theartoflivin.comwww.theartoflivin.comwww.theartoflivin.net
hoskia.walisng.comwww.hoskia.walisng.com
autodiscover.electricalgeelong.comautodiscover.electricalgeelong.com.aucpanel.electricalgeelong.comcpanel.electricalgeelong.com.aucpcalendars.electricalgeelong.comcpcalendars.electricalgeelong.com.aucpcontacts.electricalgeelong.comcpcontacts.electricalgeelong.com.auelectricalgeelong-com.irz.zga.mybluehost.meelectricalgeelong.comelectricalgeelong.com.aumail.electricalgeelong.commail.electricalgeelong.com.auwebdisk.electricalgeelong.comwebdisk.electricalgeelong.com.auwebmail.electricalgeelong.comwebmail.electricalgeelong.com.auwebsite-0297fc62.irz.zga.mybluehost.mewww.electricalgeelong-com.irz.zga.mybluehost.mewww.electricalgeelong.comwww.electricalgeelong.com.auwww.website-0297fc62.irz.zga.mybluehost.me
autodiscover.brkujima.combrkujima.comcpanel.brkujima.comcpcalendars.brkujima.comcpcontacts.brkujima.commail.brkujima.comwebdisk.brkujima.comwebmail.brkujima.comwww.brkujima.com
autodiscover.vmw.hgn.mybluehost.mecpanel.vmw.hgn.mybluehost.mecpcalendars.vmw.hgn.mybluehost.mecpcontacts.vmw.hgn.mybluehost.memail.vmw.hgn.mybluehost.memakerofthehome.blogvmw.hgn.mybluehost.mewebdisk.vmw.hgn.mybluehost.mewebmail.vmw.hgn.mybluehost.mewww.makerofthehome.blogwww.vmw.hgn.mybluehost.me
autodiscover.allenrussell.orgcpanel.allenrussell.orgcpcalendars.allenrussell.orgcpcontacts.allenrussell.orgmail.allenrussell.orgwebdisk.allenrussell.orgwebmail.allenrussell.org
autodiscover.plt.sfw.mybluehost.mecpanel.plt.sfw.mybluehost.mecpcalendars.plt.sfw.mybluehost.mecpcontacts.plt.sfw.mybluehost.memail.miriamlynn.co.ukmail.plt.sfw.mybluehost.memiriamlynn.co.ukplt.sfw.mybluehost.mewebdisk.plt.sfw.mybluehost.mewebmail.plt.sfw.mybluehost.mewww.miriamlynn.co.ukwww.plt.sfw.mybluehost.me
altonbranch.comaltonbranch.dickspeer.comautodiscover.altonbranch.comcpanel.altonbranch.comcpcalendars.altonbranch.comcpcontacts.altonbranch.commail.altonbranch.comwebdisk.altonbranch.comwebmail.altonbranch.comwww.altonbranch.comwww.altonbranch.dickspeer.com
autodiscover.melissalynportraits.comcpanel.melissalynportraits.comcpcalendars.melissalynportraits.comcpcontacts.melissalynportraits.commail.melissalynportraits.commelissalynportraits.comwebdisk.melissalynportraits.comwebmail.melissalynportraits.comwww.melissalynportraits.com
amontit.comautodiscover.amontit.comcpanel.amontit.comcpcalendars.amontit.comcpcontacts.amontit.commail.amontit.comtraining.amontit.comwebdisk.amontit.comwebmail.amontit.comwww.amontit.comwww.training.amontit.com
autodiscover.tky.rfl.mybluehost.mecpanel.tky.rfl.mybluehost.mecpcalendars.tky.rfl.mybluehost.mecpcontacts.tky.rfl.mybluehost.melunametallic.commail.lunametallic.commail.tky.rfl.mybluehost.metky.rfl.mybluehost.mewebdisk.tky.rfl.mybluehost.mewebmail.tky.rfl.mybluehost.mewww.lunametallic.comwww.tky.rfl.mybluehost.me
autodiscover.lumigeek.comcpanel.lumigeek.comcpcalendars.lumigeek.comcpcontacts.lumigeek.comlumigeek.comwebdisk.lumigeek.comwebmail.lumigeek.comwww.lumigeek.com
autodiscover.qds.yfm.mybluehost.mecpanel.qds.yfm.mybluehost.mecpcalendars.qds.yfm.mybluehost.mecpcontacts.qds.yfm.mybluehost.meinmotiontransit.commail.inmotiontransit.commail.qds.yfm.mybluehost.meqds.yfm.mybluehost.mewebdisk.qds.yfm.mybluehost.mewebmail.qds.yfm.mybluehost.mewww.inmotiontransit.comwww.qds.yfm.mybluehost.me
website-e6cfe59a.sailwildair.comwww.website-e6cfe59a.sailwildair.com
autodiscover.initialservicescorp.comcpanel.initialservicescorp.comcpcalendars.initialservicescorp.comcpcontacts.initialservicescorp.cominitialservicescorp.commail.initialservicescorp.comwebdisk.initialservicescorp.comwebmail.initialservicescorp.comwebsite-542cc209.growmybusinessquick.comwww.initialservicescorp.comwww.website-542cc209.growmybusinessquick.com
website-869d8761.wgy.nst.mybluehost.mewoodworkingbug.comwww.website-869d8761.wgy.nst.mybluehost.mewww.woodworkingbug.com
autodiscover.theanukchronicles.comcpanel.theanukchronicles.comcpcalendars.theanukchronicles.comcpcontacts.theanukchronicles.commail.theanukchronicles.commail.yeq.twj.mybluehost.metheanukchronicles.comwebdisk.theanukchronicles.comwebmail.theanukchronicles.comwww.theanukchronicles.comwww.yeq.twj.mybluehost.meyeq.twj.mybluehost.me
autodiscover.bergennaacp.orgbergennaacp.orgcpanel.bergennaacp.orgcpcalendars.bergennaacp.orgcpcontacts.bergennaacp.orgmail.bergennaacp.orgwebdisk.bergennaacp.orgwebmail.bergennaacp.orgwww.bergennaacp.org
autodiscover.lbs.uxb.mybluehost.mecpanel.lbs.uxb.mybluehost.mecpcalendars.lbs.uxb.mybluehost.mecpcontacts.lbs.uxb.mybluehost.meengconcepts.techlbs.uxb.mybluehost.memail.lbs.uxb.mybluehost.mewebdisk.lbs.uxb.mybluehost.mewebmail.lbs.uxb.mybluehost.mewww.engconcepts.techwww.lbs.uxb.mybluehost.me
autodiscover.tyr.mqz.mybluehost.mecpanel.tyr.mqz.mybluehost.mecpcalendars.tyr.mqz.mybluehost.mecpcontacts.tyr.mqz.mybluehost.memail.tyr.mqz.mybluehost.metyr.mqz.mybluehost.mewebdisk.tyr.mqz.mybluehost.mewebmail.tyr.mqz.mybluehost.mewww.tyr.mqz.mybluehost.me
autodiscover.financialexamacademy.comautodiscover.tlfindependence.comcpanel.financialexamacademy.comcpanel.tlfindependence.comcpcalendars.financialexamacademy.comcpcalendars.tlfindependence.comcpcontacts.financialexamacademy.comcpcontacts.tlfindependence.comfinancialexamacademy.commail.financialexamacademy.commail.tlfindependence.comtlfindependence.comtlfindependence.financialexamacademy.comwebdisk.financialexamacademy.comwebdisk.tlfindependence.comwebmail.financialexamacademy.comwebmail.tlfindependence.comwww.financialexamacademy.comwww.tlfindependence.comwww.tlfindependence.financialexamacademy.com
autodiscover.reca.uscpanel.reca.uscpcalendars.reca.uscpcontacts.reca.usmail.reca.usreca.uswebdisk.reca.uswebmail.reca.uswww.reca.us
autodiscover.herewme.comcpanel.herewme.comcpcalendars.herewme.comcpcontacts.herewme.comherewme.commail.herewme.comwebdisk.herewme.comwebmail.herewme.comwww.herewme.com
autodiscover.sashashulmanlaw.comcpanel.sashashulmanlaw.comcpcalendars.sashashulmanlaw.comcpcontacts.sashashulmanlaw.commail.sashashulmanlaw.comsashashulmanlaw.comwebdisk.sashashulmanlaw.comwebmail.sashashulmanlaw.comwww.sashashulmanlaw.com
autodiscover.joshbrede.comautodiscover.stainedvelvet.comcpanel.joshbrede.comcpanel.stainedvelvet.comcpcalendars.joshbrede.comcpcalendars.stainedvelvet.comcpcontacts.joshbrede.comcpcontacts.stainedvelvet.comjkbvideo.commail.jkbvideo.commail.joshbrede.commail.stainedvelvet.comstainedvelvet.comstainedvelvet.joshbrede.comwebdisk.joshbrede.comwebdisk.stainedvelvet.comwebmail.joshbrede.comwebmail.stainedvelvet.comwww.jkbvideo.comwww.stainedvelvet.comwww.stainedvelvet.joshbrede.com
autodiscover.ericksontattoo.comcpanel.ericksontattoo.comcpcalendars.ericksontattoo.comcpcontacts.ericksontattoo.commail.ericksontattoo.comwebdisk.ericksontattoo.comwebmail.ericksontattoo.com
autodiscover.hpq.wev.mybluehost.mecpanel.hpq.wev.mybluehost.mecpcalendars.hpq.wev.mybluehost.mecpcontacts.hpq.wev.mybluehost.mehpq.wev.mybluehost.memail.hpq.wev.mybluehost.mewebdisk.hpq.wev.mybluehost.mewebmail.hpq.wev.mybluehost.mewww.hpq.wev.mybluehost.me
autodiscover.wetarted.comcpanel.wetarted.comcpcalendars.wetarted.comcpcontacts.wetarted.commail.wetarted.comwebdisk.wetarted.comwebmail.wetarted.comwebsite-c5ae4c83.growmybusinessquick.comwetarted.comwww.website-c5ae4c83.growmybusinessquick.comwww.wetarted.com
autodiscover.destinationhabit.comcpanel.destinationhabit.comcpcalendars.destinationhabit.comcpcontacts.destinationhabit.comdestination.financialexamacademy.comdestinationhabit.commail.destinationhabit.comwebdisk.destinationhabit.comwebmail.destinationhabit.comwww.destination.financialexamacademy.comwww.destinationhabit.com
autodiscover.kosidesigns.com.aucpanel.kosidesigns.com.aucpcalendars.kosidesigns.com.aucpcontacts.kosidesigns.com.aukosidesigns.com.aumail.kosidesigns.com.auwebdisk.kosidesigns.com.auwebmail.kosidesigns.com.auwww.kosidesigns.com.au
autodiscover.bisbeejoe.combisbeejoe.comcpanel.bisbeejoe.comcpcalendars.bisbeejoe.comcpcontacts.bisbeejoe.commail.bisbeejoe.comwebdisk.bisbeejoe.comwebmail.bisbeejoe.comwww.bisbeejoe.com
autodiscover.thebankinglady.comcpanel.thebankinglady.comcpcalendars.thebankinglady.comcpcontacts.thebankinglady.commail.thebankinglady.comthebankinglady.comwebdisk.thebankinglady.comwebmail.thebankinglady.comwww.thebankinglady.com
autodiscover.guardianmedtransport.comcpanel.guardianmedtransport.comcpcalendars.guardianmedtransport.comcpcontacts.guardianmedtransport.comguardianmedtransport.commail.guardianmedtransport.comwebdisk.guardianmedtransport.comwebmail.guardianmedtransport.comwww.guardianmedtransport.com
autodiscover.bkm4prez.comautodiscover.freedomfootage.combkm4prez.babeslay.combkm4prez.comcpanel.bkm4prez.comcpanel.freedomfootage.comcpcalendars.bkm4prez.comcpcalendars.freedomfootage.comcpcontacts.bkm4prez.comcpcontacts.freedomfootage.comfreedomfootage.babeslay.comfreedomfootage.commail.bkm4prez.commail.freedomfootage.comwebdisk.bkm4prez.comwebdisk.freedomfootage.comwebmail.bkm4prez.comwebmail.freedomfootage.comwww.bkm4prez.babeslay.comwww.bkm4prez.comwww.freedomfootage.babeslay.comwww.freedomfootage.com
autodiscover.lzv.mqz.mybluehost.mecpanel.lzv.mqz.mybluehost.mecpcalendars.lzv.mqz.mybluehost.mecpcontacts.lzv.mqz.mybluehost.mekredytyplusminus.comlzv.mqz.mybluehost.memail.kredytyplusminus.commail.lzv.mqz.mybluehost.mewebdisk.lzv.mqz.mybluehost.mewebmail.lzv.mqz.mybluehost.mewww.kredytyplusminus.comwww.lzv.mqz.mybluehost.me
autodiscover.olivardecardenas.comautodiscover.rnsfonts.comcpanel.olivardecardenas.comcpanel.rnsfonts.comcpcalendars.olivardecardenas.comcpcalendars.rnsfonts.comcpcontacts.olivardecardenas.comcpcontacts.rnsfonts.commail.olivardecardenas.commail.rnsfonts.commariacardenas.rnsfonts.comolivardecardenas.comolivardecardenas.rnsfonts.comrnsfonts.comwebdisk.olivardecardenas.comwebdisk.rnsfonts.comwebmail.olivardecardenas.comwebmail.rnsfonts.comwww.mariacardenas.rnsfonts.comwww.olivardecardenas.comwww.olivardecardenas.rnsfonts.comwww.rnsfonts.com
autodiscover.pcy.frl.mybluehost.mebuddysbh.comcpanel.pcy.frl.mybluehost.mecpcalendars.pcy.frl.mybluehost.mecpcontacts.pcy.frl.mybluehost.memail.buddysbh.commail.pcy.frl.mybluehost.mepcy.frl.mybluehost.mewebdisk.pcy.frl.mybluehost.mewebmail.pcy.frl.mybluehost.mewebsite-0244fb6e.pcy.frl.mybluehost.mewww.buddysbh.comwww.pcy.frl.mybluehost.mewww.website-0244fb6e.pcy.frl.mybluehost.me
lagmanenterprises.comwww.lagmanenterprises.com
autodiscover.bcz.wbq.mybluehost.mebcz.wbq.mybluehost.mebiancaandthegirls.comcpanel.bcz.wbq.mybluehost.mecpcalendars.bcz.wbq.mybluehost.mecpcontacts.bcz.wbq.mybluehost.memail.bcz.wbq.mybluehost.memail.biancaandthegirls.comwebdisk.bcz.wbq.mybluehost.mewebmail.bcz.wbq.mybluehost.mewww.bcz.wbq.mybluehost.mewww.biancaandthegirls.com
cpanel.kgpholding.comcpcalendars.kgpholding.comcpcontacts.kgpholding.comkgpholding.commail.kgpholding.comwebdisk.kgpholding.comwebmail.kgpholding.comwww.kgpholding.com
cpanel.madisonelitetrackclub.comcpcalendars.madisonelitetrackclub.commadisonelitetrackclub.comwww.madisonelitetrackclub.com
test.chipperparts.co.ukwww.test.chipperparts.co.uk
autodiscover.knightwatchpublishing.comautodiscover.sirchase.comcpanel.knightwatchpublishing.comcpanel.sirchase.comcpcalendars.knightwatchpublishing.comcpcalendars.sirchase.comcpcontacts.knightwatchpublishing.comcpcontacts.sirchase.comknightwatchpublishing.comknightwatchpublishing.sirchase.commail.knightwatchpublishing.commail.sirchase.comsirchase.comwebdisk.knightwatchpublishing.comwebdisk.sirchase.comwebmail.knightwatchpublishing.comwebmail.sirchase.comwww.knightwatchpublishing.comwww.knightwatchpublishing.sirchase.comwww.sirchase.com
autodiscover.ujq.aqd.mybluehost.mecpanel.ujq.aqd.mybluehost.mecpcalendars.ujq.aqd.mybluehost.mecpcontacts.ujq.aqd.mybluehost.melivinginorderlyfashion.commail.livinginorderlyfashion.commail.ujq.aqd.mybluehost.meujq.aqd.mybluehost.mewebdisk.ujq.aqd.mybluehost.mewebmail.ujq.aqd.mybluehost.mewww.livinginorderlyfashion.comwww.ujq.aqd.mybluehost.me
autodiscover.beautyandthebestie.comautodiscover.freckledflair.combeautyandthebestie.combeautyandthebestie.freckledflair.comcpanel.beautyandthebestie.comcpanel.freckledflair.comcpcalendars.beautyandthebestie.comcpcalendars.freckledflair.comcpcontacts.beautyandthebestie.comcpcontacts.freckledflair.comfreckledflair.commail.beautyandthebestie.commail.freckledflair.comwebdisk.beautyandthebestie.comwebdisk.freckledflair.comwebmail.beautyandthebestie.comwebmail.freckledflair.comwww.beautyandthebestie.comwww.beautyandthebestie.freckledflair.comwww.freckledflair.com
autodiscover.soulofcontinuum.comautodiscover.still-movement.comcpanel.soulofcontinuum.comcpanel.still-movement.comcpcalendars.soulofcontinuum.comcpcalendars.still-movement.comcpcontacts.soulofcontinuum.comcpcontacts.still-movement.commail.soulofcontinuum.commail.still-movement.comsoulofcontinuum.still-movement.comstill-movement.comwebdisk.soulofcontinuum.comwebdisk.still-movement.comwebmail.soulofcontinuum.comwebmail.still-movement.comwww.soulofcontinuum.still-movement.comwww.still-movement.com
autodiscover.suzannecleary.comcpanel.suzannecleary.comcpcalendars.suzannecleary.comcpcontacts.suzannecleary.commail.suzannecleary.comsuzannecleary.comsuzannecleary.theheartofsurrender.comwebdisk.suzannecleary.comwebmail.suzannecleary.comwww.suzannecleary.comwww.suzannecleary.theheartofsurrender.com
cpanel.edencommunitychurch.orgcpcalendars.edencommunitychurch.orgcpcontacts.edencommunitychurch.orgedencommunitychurch.orgmail.edencommunitychurch.orgwebdisk.edencommunitychurch.orgwww.edencommunitychurch.org
afp.bqu.mybluehost.meautodiscover.afp.bqu.mybluehost.mecpanel.afp.bqu.mybluehost.mecpcalendars.afp.bqu.mybluehost.mecpcontacts.afp.bqu.mybluehost.memail.afp.bqu.mybluehost.memail.salpubl.comsalpubl.comwebdisk.afp.bqu.mybluehost.mewebmail.afp.bqu.mybluehost.mewww.afp.bqu.mybluehost.mewww.salpubl.com
autodiscover.trudysfoodies.comcpanel.trudysfoodies.comcpcalendars.trudysfoodies.comcpcontacts.trudysfoodies.commail.trudysfoodies.comtrudysfoodies.comwebdisk.trudysfoodies.comwebmail.trudysfoodies.comwww.trudysfoodies.com
autodiscover.rfy.ext.mybluehost.mecpanel.rfy.ext.mybluehost.mecpcalendars.rfy.ext.mybluehost.mecpcontacts.rfy.ext.mybluehost.memail.rfy.ext.mybluehost.merfy.ext.mybluehost.mewebdisk.rfy.ext.mybluehost.mewebmail.rfy.ext.mybluehost.mewww.rfy.ext.mybluehost.me
aueinc.netautodiscover.cvr.jzw.mybluehost.mecpanel.cvr.jzw.mybluehost.mecpcalendars.cvr.jzw.mybluehost.mecpcontacts.cvr.jzw.mybluehost.mecvr.jzw.mybluehost.memail.aueinc.netmail.cvr.jzw.mybluehost.mewebdisk.cvr.jzw.mybluehost.mewebmail.cvr.jzw.mybluehost.mewww.aueinc.netwww.cvr.jzw.mybluehost.me
autodiscover.rmrconsult.comcpanel.rmrconsult.comcpcalendars.rmrconsult.comcpcontacts.rmrconsult.commail.rmrconsult.comrmrconsult.comwebdisk.rmrconsult.comwebmail.rmrconsult.comwww.rmrconsult.com
autodiscover.yqt.qzx.mybluehost.mecpanel.yqt.qzx.mybluehost.mecpcalendars.yqt.qzx.mybluehost.mecpcontacts.yqt.qzx.mybluehost.memail.yqt.qzx.mybluehost.mewebdisk.yqt.qzx.mybluehost.mewebmail.yqt.qzx.mybluehost.mewww.yqt.qzx.mybluehost.meyqt.qzx.mybluehost.me
autodiscover.healthyagingwithheather.comcpanel.healthyagingwithheather.comcpcalendars.healthyagingwithheather.comcpcontacts.healthyagingwithheather.comhealthyagingwithheather.commail.healthyagingwithheather.comwebdisk.healthyagingwithheather.comwebmail.healthyagingwithheather.comwebsite-cbc038cc.bza.ttm.mybluehost.mewww.healthyagingwithheather.comwww.website-cbc038cc.bza.ttm.mybluehost.me
autodiscover.mai.hsk.mybluehost.mecpanel.mai.hsk.mybluehost.mecpcalendars.mai.hsk.mybluehost.mecpcontacts.mai.hsk.mybluehost.memai.hsk.mybluehost.memail.mai.hsk.mybluehost.mewebdisk.mai.hsk.mybluehost.mewebmail.mai.hsk.mybluehost.mewww.mai.hsk.mybluehost.me
autodiscover.zqz.jdq.mybluehost.mecpanel.zqz.jdq.mybluehost.mecpcalendars.zqz.jdq.mybluehost.mecpcontacts.zqz.jdq.mybluehost.memail.zqz.jdq.mybluehost.mewebdisk.zqz.jdq.mybluehost.mewebmail.zqz.jdq.mybluehost.mewww.zqz.jdq.mybluehost.mezqz.jdq.mybluehost.me
autodiscover.jdq.vxg.mybluehost.mecpanel.jdq.vxg.mybluehost.mecpcalendars.jdq.vxg.mybluehost.mecpcontacts.jdq.vxg.mybluehost.mejdq.vxg.mybluehost.memail.jdq.vxg.mybluehost.mewebdisk.jdq.vxg.mybluehost.mewebmail.jdq.vxg.mybluehost.mewww.jdq.vxg.mybluehost.me
autodiscover.smarthomedubai.netcpanel.smarthomedubai.netcpcalendars.smarthomedubai.netcpcontacts.smarthomedubai.netmail.smarthomedubai.netsmarthomedubai.netwebdisk.smarthomedubai.netwebmail.smarthomedubai.netwebsite-56ca12c5.upkeep.aewww.smarthomedubai.netwww.website-56ca12c5.upkeep.ae
autodiscover.kenaz-est.comcpanel.kenaz-est.comcpcalendars.kenaz-est.comcpcontacts.kenaz-est.comkenaz-est.commail.kenaz-est.comwebdisk.kenaz-est.comwebmail.kenaz-est.comwww.kenaz-est.com
autodiscover.miiapuumala.comcpanel.miiapuumala.comcpcalendars.miiapuumala.comcpcontacts.miiapuumala.commail.miiapuumala.commiiapuumala.commiiapuumala.fingoglobal.fiwebdisk.miiapuumala.comwebmail.miiapuumala.comwww.miiapuumala.comwww.miiapuumala.fingoglobal.fi
autodiscover.willisfam5adventures.comcpanel.willisfam5adventures.comcpcalendars.willisfam5adventures.comcpcontacts.willisfam5adventures.commail.willisfam5adventures.comwebdisk.willisfam5adventures.comwebmail.willisfam5adventures.comwillisfam5adventures.comwww.willisfam5adventures.com
autodiscover.jul.wbq.mybluehost.mecpanel.jul.wbq.mybluehost.mecpcalendars.jul.wbq.mybluehost.mecpcontacts.jul.wbq.mybluehost.mejul.wbq.mybluehost.memail.jul.wbq.mybluehost.mestbess.comwebdisk.jul.wbq.mybluehost.mewebmail.jul.wbq.mybluehost.mewww.jul.wbq.mybluehost.mewww.stbess.com
aer.qps.mybluehost.meautodiscover.aer.qps.mybluehost.mecpanel.aer.qps.mybluehost.mecpcalendars.aer.qps.mybluehost.mecpcontacts.aer.qps.mybluehost.memail.aer.qps.mybluehost.mewebdisk.aer.qps.mybluehost.mewebmail.aer.qps.mybluehost.mewww.aer.qps.mybluehost.me
autodiscover.bettyhallshopping.comautodiscover.odha-ecuador.orgbettyhallshopping.comcpanel.bettyhallshopping.comcpanel.odha-ecuador.orgcpcalendars.bettyhallshopping.comcpcalendars.odha-ecuador.orgcpcontacts.bettyhallshopping.comcpcontacts.odha-ecuador.orgmail.bettyhallshopping.commail.odha-ecuador.orgmail.umm.mtr.mybluehost.meodha-ecuador.orgumm.mtr.mybluehost.mewebdisk.bettyhallshopping.comwebdisk.odha-ecuador.orgwebmail.bettyhallshopping.comwebmail.odha-ecuador.orgwebsite-0024edb2.bettyhallshopping.comwww.bettyhallshopping.comwww.odha-ecuador.orgwww.umm.mtr.mybluehost.mewww.website-0024edb2.bettyhallshopping.com
mail.simplemarketing.iosimplemarketing.iowww.simplemarketing.io
autodiscover.bfc.vhl.mybluehost.mebfc.vhl.mybluehost.mecpanel.bfc.vhl.mybluehost.mecpcalendars.bfc.vhl.mybluehost.mecpcontacts.bfc.vhl.mybluehost.memail.bfc.vhl.mybluehost.memail.unusualtesla.comunusualtesla.comwebdisk.bfc.vhl.mybluehost.mewebmail.bfc.vhl.mybluehost.mewww.bfc.vhl.mybluehost.mewww.unusualtesla.com
autodiscover.e-memoire.orgcpanel.e-memoire.orgcpcalendars.e-memoire.orgcpcontacts.e-memoire.orge-memoire.orgkoh.tor.mybluehost.memail.e-memoire.orgmail.koh.tor.mybluehost.mewebdisk.e-memoire.orgwebmail.e-memoire.orgwww.e-memoire.orgwww.koh.tor.mybluehost.me
autodiscover.oppmsinaloa.org.mxcpanel.oppmsinaloa.org.mxcpcalendars.oppmsinaloa.org.mxcpcontacts.oppmsinaloa.org.mxmail.oppmsinaloa.org.mxoppmsinaloa.org.mxwebdisk.oppmsinaloa.org.mxwebmail.oppmsinaloa.org.mxwebsite-1e30f956.mpt.qsp.mybluehost.mewww.oppmsinaloa.org.mxwww.website-1e30f956.mpt.qsp.mybluehost.me
autodiscover.winstonthetegu.comcpanel.winstonthetegu.comcpcalendars.winstonthetegu.comcpcontacts.winstonthetegu.commail.winstonthetegu.comwebdisk.winstonthetegu.comwebmail.winstonthetegu.comwinstonthetegu.comwww.winstonthetegu.com
autodiscover.kxb.fvs.mybluehost.mecpanel.kxb.fvs.mybluehost.mecpcalendars.kxb.fvs.mybluehost.mecpcontacts.kxb.fvs.mybluehost.mecrappyjobblog.comkxb.fvs.mybluehost.memail.crappyjobblog.commail.kxb.fvs.mybluehost.mewebdisk.kxb.fvs.mybluehost.mewebmail.kxb.fvs.mybluehost.mewww.crappyjobblog.comwww.kxb.fvs.mybluehost.me
autodiscover.lovehopeandautism.comcpanel.lovehopeandautism.comcpcalendars.lovehopeandautism.comcpcontacts.lovehopeandautism.comlovehopeandautism.commail.lovehopeandautism.comwebdisk.lovehopeandautism.comwebmail.lovehopeandautism.comwww.lovehopeandautism.com
andymanblog.comautodiscover.rtm.mtk.mybluehost.mecpanel.rtm.mtk.mybluehost.mecpcalendars.rtm.mtk.mybluehost.mecpcontacts.rtm.mtk.mybluehost.memail.andymanblog.commail.rtm.mtk.mybluehost.mertm.mtk.mybluehost.mewebdisk.rtm.mtk.mybluehost.mewebmail.rtm.mtk.mybluehost.mewww.andymanblog.comwww.rtm.mtk.mybluehost.me
autodiscover.bynathanbosley.combynathanbosley.comcpanel.bynathanbosley.comcpcalendars.bynathanbosley.comcpcontacts.bynathanbosley.commail.bynathanbosley.comwebdisk.bynathanbosley.comwebmail.bynathanbosley.comwww.bynathanbosley.com
autodiscover.ruffguidemaps.comcpanel.ruffguidemaps.comcpcalendars.ruffguidemaps.comcpcontacts.ruffguidemaps.commail.ruffguidemaps.comruffguidemaps.comwebdisk.ruffguidemaps.comwebmail.ruffguidemaps.comwww.ruffguidemaps.com
api.e-plagiat.onlinewww.api.e-plagiat.online
autodiscover.det.hbq.mybluehost.mecpanel.det.hbq.mybluehost.mecpcalendars.det.hbq.mybluehost.mecpcontacts.det.hbq.mybluehost.medet.hbq.mybluehost.memail.det.hbq.mybluehost.mewebdisk.det.hbq.mybluehost.mewebmail.det.hbq.mybluehost.mewww.det.hbq.mybluehost.me
autodiscover.bagsfulloflove.orgbagsfulloflove.orgcpanel.bagsfulloflove.orgcpcalendars.bagsfulloflove.orgcpcontacts.bagsfulloflove.orgmail.bagsfulloflove.orgwebdisk.bagsfulloflove.orgwebmail.bagsfulloflove.orgwww.bagsfulloflove.org
autodiscover.cza.cul.mybluehost.mecpanel.cza.cul.mybluehost.mecpcalendars.cza.cul.mybluehost.mecpcontacts.cza.cul.mybluehost.mecza.cul.mybluehost.mejustontimeservice.commail.cza.cul.mybluehost.memail.justontimeservice.comwebdisk.cza.cul.mybluehost.mewebmail.cza.cul.mybluehost.mewww.cza.cul.mybluehost.mewww.justontimeservice.com
autodiscover.donnagaytyler.comcpanel.donnagaytyler.comcpcalendars.donnagaytyler.comcpcontacts.donnagaytyler.comdonnagaytyler.commail.donnagaytyler.comwebdisk.donnagaytyler.comwebmail.donnagaytyler.comwww.donnagaytyler.com
autodiscover.kleincommunication7.comcpanel.kleincommunication7.comcpcalendars.kleincommunication7.comcpcontacts.kleincommunication7.comkleincommunication7.commail.kleincommunication7.comwebdisk.kleincommunication7.comwebmail.kleincommunication7.comwebsite-f6fe3998.sjl.ztl.mybluehost.mewebsite-fa85f623.sjl.ztl.mybluehost.mewww.kleincommunication7.comwww.website-f6fe3998.sjl.ztl.mybluehost.mewww.website-fa85f623.sjl.ztl.mybluehost.me
autodiscover.gta.pmc.mybluehost.mecpanel.gta.pmc.mybluehost.mecpcalendars.gta.pmc.mybluehost.mecpcontacts.gta.pmc.mybluehost.megta.pmc.mybluehost.memail.gta.pmc.mybluehost.mewebdisk.gta.pmc.mybluehost.mewebmail.gta.pmc.mybluehost.mewww.gta.pmc.mybluehost.me
autodiscover.indypremiere.comcpanel.indypremiere.comcpcalendars.indypremiere.comcpcontacts.indypremiere.comindypremiere.commail.indypremiere.comwebdisk.indypremiere.comwebmail.indypremiere.comwebsite-8159fce1.sjl.ztl.mybluehost.mewww.indypremiere.comwww.website-8159fce1.sjl.ztl.mybluehost.me
autodiscover.indypremier.comcpanel.indypremier.comcpcalendars.indypremier.comcpcontacts.indypremier.comindypremier.commail.indypremier.comwebdisk.indypremier.comwebmail.indypremier.comwebsite-4d0aa17c.sjl.ztl.mybluehost.mewww.indypremier.comwww.website-4d0aa17c.sjl.ztl.mybluehost.me
autodiscover.mjg.rew.mybluehost.mecpanel.mjg.rew.mybluehost.mecpcalendars.mjg.rew.mybluehost.mecpcontacts.mjg.rew.mybluehost.memail.mjg.rew.mybluehost.memjg.rew.mybluehost.mewebdisk.mjg.rew.mybluehost.mewebmail.mjg.rew.mybluehost.mewww.mjg.rew.mybluehost.me
cpanel.junctionroadfp.comcpcalendars.junctionroadfp.comcpcontacts.junctionroadfp.comjunctionroadfp.com.aumail.junctionroadfp.commail.junctionroadfp.com.auwebdisk.junctionroadfp.comwebmail.junctionroadfp.comwww.junctionroadfp.com.au
autodiscover.jaimemedia.comcpanel.jaimemedia.comcpcalendars.jaimemedia.comcpcontacts.jaimemedia.comjaimemedia.comjaimemedia.pathscentral.commail.jaimemedia.comwebdisk.jaimemedia.comwebmail.jaimemedia.comwww.jaimemedia.comwww.jaimemedia.pathscentral.com
autowaterpro.commail.techpointsales.comtechpointsales.comwww.autowaterpro.comwww.techpointsales.com
autodiscover.fundacionprolongar.orgcpanel.fundacionprolongar.orgcpcalendars.fundacionprolongar.orgcpcontacts.fundacionprolongar.orgfundacionprolongar.orgmail.fundacionprolongar.orgwebdisk.fundacionprolongar.orgwebmail.fundacionprolongar.orgwww.fundacionprolongar.org
autodiscover.livewholistic.comautodiscover.wholisticfertility.comcpanel.livewholistic.comcpanel.wholisticfertility.comcpcalendars.livewholistic.comcpcalendars.wholisticfertility.comcpcontacts.livewholistic.comcpcontacts.wholisticfertility.comdou.mtr.mybluehost.melivewholistic.commail.dou.mtr.mybluehost.memail.livewholistic.commail.wholisticfertility.comwebdisk.livewholistic.comwebdisk.wholisticfertility.comwebmail.livewholistic.comwebmail.wholisticfertility.comwebsite-cd47f3df.livewholistic.comwholisticfertility.comwww.dou.mtr.mybluehost.mewww.livewholistic.comwww.website-cd47f3df.livewholistic.comwww.wholisticfertility.com
cpanel.deltaprimeconsulting.comcpcalendars.deltaprimeconsulting.comcpcontacts.deltaprimeconsulting.comdeltaprimeconsulting.commail.deltaprimeconsulting.comwebdisk.deltaprimeconsulting.comwebmail.deltaprimeconsulting.comwww.deltaprimeconsulting.com
cpanel.jettprep.comcpcalendars.jettprep.comcpcontacts.jettprep.comjettprep.comwebdisk.jettprep.comwww.jettprep.com
autodiscover.kyriandrake.comcpanel.kyriandrake.comcpcalendars.kyriandrake.comcpcontacts.kyriandrake.comkyriandrake.comkyriandrake.sumptuousspoonfuls.comwebdisk.kyriandrake.comwebmail.kyriandrake.comwww.kyriandrake.comwww.kyriandrake.sumptuousspoonfuls.com
autodiscover.hxx.qtw.mybluehost.mecpanel.hxx.qtw.mybluehost.mecpcalendars.hxx.qtw.mybluehost.mecpcontacts.hxx.qtw.mybluehost.mehxx.qtw.mybluehost.memail.hxx.qtw.mybluehost.mewebdisk.hxx.qtw.mybluehost.mewebmail.hxx.qtw.mybluehost.mewww.hxx.qtw.mybluehost.me
truthseekers.lifestruth.orgwww.truthseekers.lifestruth.org
autodiscover.tomikahaynes.comcpanel.tomikahaynes.comcpcalendars.tomikahaynes.comcpcontacts.tomikahaynes.commail.tomikahaynes.comtomikahaynes.comtomikahaynes.soulsofvirtue.comwebdisk.tomikahaynes.comwebmail.tomikahaynes.comwww.tomikahaynes.comwww.tomikahaynes.soulsofvirtue.com
autodiscover.zsl.sco.mybluehost.mecpanel.zsl.sco.mybluehost.mecpcalendars.zsl.sco.mybluehost.mecpcontacts.zsl.sco.mybluehost.meformoreinformation.orgmail.formoreinformation.orgmail.zsl.sco.mybluehost.mewebdisk.zsl.sco.mybluehost.mewebmail.zsl.sco.mybluehost.mewww.formoreinformation.orgwww.zsl.sco.mybluehost.mezsl.sco.mybluehost.me
autodiscover.darkhorsesleddogs.comcpanel.darkhorsesleddogs.comcpcalendars.darkhorsesleddogs.comcpcontacts.darkhorsesleddogs.comdarkhorsesleddogs.commail.darkhorsesleddogs.comwebdisk.darkhorsesleddogs.comwebmail.darkhorsesleddogs.comwww.darkhorsesleddogs.com
autodiscover.theicingonmycake.comcpanel.theicingonmycake.comcpcalendars.theicingonmycake.comcpcontacts.theicingonmycake.commail.theicingonmycake.comtheicingonmycake.comwebdisk.theicingonmycake.comwebmail.theicingonmycake.comwww.theicingonmycake.com
Domain summary
lumigeek.com 10 www.ezreviewcenter.triconnsolutions.com 9 mail.ezreviewcenter.com 9 ezreviewcenter.triconnsolutions.com 7 www.lumigeek.com 9 ezreviewcenter.com 7 www.ezreviewcenter.com 6 www.amaall-com.psb.yhn.mybluehost.me 5 tsplatforms.com 4 amaall.com 4 mail.amaall.com 4 mail.tsplatforms.com 4 amaall-com.psb.yhn.mybluehost.me 4 www.tsplatforms.com 4 www.debhartmandigital.com 3 mail.carlottadejulio.com 3 mail.reddiamondgroup.ae 3 www.reddiamondgroup.ae 3 mail.vce.ygs.mybluehost.me 3 live.e-memoire.org 3 www.live.e-memoire.org 3 staging.lumigeek.com 3 www.carlottadejulio.com 3 www.carlottadejulio.dejuliocarpetcleaning.com 3 carlottadejulio.dejuliocarpetcleaning.com 3 carlottadejulio.com 3 mail.debhartmandigital.com 3 www.amaall.com 3 debhartmandigital.com 4 www.nasugbutransport.com 2 www.brightbeginnings.ae 2 mail.nasugbutransport.com 2 nasugbutransport.com 2 www.natc.triconnsolutions.com 2 mail.orangesodafilms.com 2 www.orangesodafilms.com 2 orangesodafilms.com 2 be-empowered.net 2 www.dev.crossfitwaterbury.com 2 nasugbutransportcorp.com 2 www.nasugbutransportcorp.com 2 www.jenniferlake.me 2 palomponleyte-gov-ph.triconnsolutions.com 2 mail.theuartists.com 2 mail.be-empowered.net 2 vintage504.markwag.com 2 www.vintage504.markwag.com 2 vintage504.com 2 mail.vintage504.com 2 www.vintage504.com 2 mail.tillybalfour.com 2 www.tillybalfour.com 2 www.palomponleyte-gov-ph.triconnsolutions.com 2 www.staging.lumigeek.com 2 fjf.oha.mybluehost.me 2 sul.pdc.mybluehost.me 2 www.needaura.com 2 mail.fjf.oha.mybluehost.me 2 www.cames.dpay.online 2 cames.dpay.online 2 mail.nasugbutransportcorp.com 2 www.nasugbutransportcorp.triconnsolutions.com 2 mail.palomponleyte.gov.ph 2 www.palomponleyte.gov.ph 2 www.vce.ygs.mybluehost.me 2 powergents.triconnsolutions.com 2 www.test.e-memoire.org 2 test.e-memoire.org 2 www.powergents.triconnsolutions.com 2 valentinlechat.com 2 dev.crossfitwaterbury.com 2 www.tsplatforms.rudybanks.com 2 tsplatforms.rudybanks.com 2 powergents.com 2 mail.sul.pdc.mybluehost.me 2 www.triconnsolutions.com 2 beautyservice.beautyvil.com 2 www.beautyservice.beautyvil.com 2 www.sul.pdc.mybluehost.me 2 www.tingeylaw.tingeyconsulting.com 2 tingeylaw.tingeyconsulting.com 2 nasugbutransportcorp.triconnsolutions.com 2 chargertrucksales.chargerspecialized.com 2 tillybalfour.com 2 mail.triconnsolutions.com 2 www.valentinlechat.com 2 milleniumcosmetics.com 2 www.powergents.com 2 brightbeginnings.ae 2 theuartists.com 2 jenniferlake-me.marklake.org 2 dev.philpearlman.com 2 www.catherinerussodocumentaries.com 2 jenniferlake.me 2 catherinerussodocumentaries.com 2 mail.brightbeginnings.ae 2 504vintage.markwag.com 2 mail.powergents.com 2 mail.jenniferlake.me 2 cfu.twr.mybluehost.me 2 www.cfu.twr.mybluehost.me 2 www.504vintage.markwag.com 2 natc.triconnsolutions.com 2 www.chargertrucksales.chargerspecialized.com 2 triconnsolutions.com 2 mail.valentinlechat.com 2 www.dev.philpearlman.com 2 mail.cfu.twr.mybluehost.me 2 palomponleyte.gov.ph 2 www.theuartists.com 2 www.jenniferlake-me.marklake.org 2 mail.needaura.com 1 mail.milleniumcosmetics.com 1 needaura.com 1 www.fjf.oha.mybluehost.me 1 xyzzy.michaelgeatz.com 1 www.xyzzy.michaelgeatz.com 1 www.temp.hockeystatz.com 1 temp.hockeystatz.com 1 www.be-empowered.net 1 money.restepro.com 1 www.money.restepro.com 1 mail.watchertravel.com 1 www.watchertravel.text-trader.com 1 watchertravel.com 1 www.milleniumcosmetics.com 1 www.watchertravel.com 1 watchertravel.text-trader.com 1 mail.catherinerussodocumentaries.com 1 mail.ginathetc.com 0 www.maithri.varshavg.com 0 mail.outdoorgearsx.com 0 kindreset.com 0 www.buzzpointllc.com 0 justinlichter.com 0 mail.wearecousin.org 0 website-004ee500.tcc.xjl.mybluehost.me 0 magpieasmartbird.com 0 www.members.successfactornetwork.com 0 www.nbd.upt.mybluehost.me 0 habitationsequilibre.com 0 mail.toddschaap.com 0 mail.projectbulgingbelly.com 0 mail.thedeeprootsapothecary.com 0 mail.wfj.zzh.mybluehost.me 0 www.closeupedition.com 0 walleyewoodfloors.com 0 www.premiumbeveragespdx.com 0 www.marilynnutter.com 0 bloomnbroom.com 0 www.phj.edd.mybluehost.me 0 mail.cih.efs.mybluehost.me 0 insuranceshoppe.me 1 thd.wxt.mybluehost.me 0 www.knightwatchpublishing.sirchase.com 0 www.mvb.zzh.mybluehost.me 0 mail.fbs.bzx.mybluehost.me 0 mail.drowsymind.com 0 thebrothersreed.com 0 mail.astekdev.com 0 assuredag.com 0 mail.timshels.com 0 angiebuyshouses.com 0 mail.vhu.vgn.mybluehost.me 0 mail.pupsandprosecco.com 0 www.website-ec847a65.tcc.xjl.mybluehost.me 0 www.dai.noo.mybluehost.me 0 www.thechesspage.com 0 mail.bloomnbroom.com 0 www.opu.nuh.mybluehost.me 0 www.website-a87fbc10.grm.csp.mybluehost.me 0 mail.treonabateman.com 0 mail.nox.sjd.mybluehost.me 0 mail.aad.dei.mybluehost.me 0 myprojecttutor.com 0 gkmhs.com 0 mail.makeupbycherise.com 0 www.cgi.cno.mybluehost.me 0 wyy.dst.mybluehost.me 0 freedomhealthministries.revelationrevealedtoday.com 0 mail.noriz-tel.com 0 mail.visiondefenderpro.com 0 mail.heisong.org 0 www.visiondefenderpro.com 0 mail.beddingbathreview.com 0 mail.vjl.mqz.mybluehost.me 0 www.endurancephysio.ca 0 www.insuranceladyusa.havemedicare.com 0 getasafetynet.com 0 www.floydvincent.com 0 mail.foreignautospa.com 0 www.xqq.sco.mybluehost.me 0 mail.res.oea.mybluehost.me 0 mail.ableproductsusa.com 0 www.tanarosxm.com 0 fromanotherrealm.marklake.org 0 mail.diamondmemory.net 0 mail.fds.lgu.mybluehost.me 0 www.jnq.ytr.mybluehost.me 0 therestlessrunaway.com 0 www.website-b519884b.cyb.xjy.mybluehost.me 0 www.stephanierupp.net 0 www.dxs.oui.mybluehost.me 0 wcy.sgz.mybluehost.me 0 mail.thesmarthomeninja.com 0 asx.lll.mybluehost.me 0 www.yvm.wid.mybluehost.me 0 gym-ergy.com 0 leny.ai 0 divinecaregroup.com.au 0 mail.warteg.xyz 0 www.pilothouseagency.myhoneylist.com 0 www.babat.site 0 www.fbi.yvm.mybluehost.me 0 mail.yvm.wid.mybluehost.me 0 wwallianceforthehomeless.org 0 mail.rooseveltptg.com 0 www.wwallianceforthehomeless.org 0 mail.nag.zca.mybluehost.me 0 mail.trustandcorp.com 0 cochranfirmchicago.courtneysimone.com 0 www.macris360.com 0 www.muy-i.v0985004622.com 0 www.ueg.eln.mybluehost.me 1 opu.nuh.mybluehost.me 0 mail.type1travels.com 0 www.otm.bgd.mybluehost.me 0 www.kelley-bean.com 0 www.groovecity7.com 0 www.archaeologypod.com 0 mail.markwag.com 0 imericlee.com 0 www.preppinglittles.com 0 istrumpalive.babeslay.com 0 convenientaccounting.com 0 hth.hzw.mybluehost.me 0 www.leny.ai 0 drstenhq.com 0 coffieldfamilyusa.com 0 www.neuenschwandermusicstudio.com 0 www.coffieldfamilyusa.com 0 mail.eileendrapizapsychotherapy.com 0 metafifa.com 0 glenvilleliving-com-au.m10truss.com.au 0 poctechnology.com 0 www.kan.xeh.mybluehost.me 0 mail.laststory-claims.com 0 mail.overseasjo.com 0 lyfit.life 0 www.ginathetc.com 0 website-2fb1a1cb.irz.zga.mybluehost.me 0 dev.marcbelnick.com 0 www.neuenschwandermusicstudio.mycreativepiano.com 0 xcj.cul.mybluehost.me 0 mail.byc.dvw.mybluehost.me 0 mail.auntbsgiftshop.com 0 mail.tanarosxm.com 0 kelley-bean.com 0 mail.secretpicnicbox.com 0 xsk.nqg.mybluehost.me 0 drowsymind.com 0 www.ccr.dfq.mybluehost.me 0 www.xsk.nqg.mybluehost.me 0 mail.drinkwicks.com 0 nostophical.portal.mdatac.com 0 chubbthoughts.com 0 insuranceladyusa.havemedicare.com 0 fashionbyfa.com 0 mail.lafrancerochelle.com 0 imagesofvermont.net 0 mail.habitationsequilibre.com 0 www.nzm.wlu.mybluehost.me 0 mail.dwo.tqp.mybluehost.me 0 mail.artecse.com 0 www.8dtransformations.soulsofvirtue.com 0 mail.tahammondmarketing.com 0 www.luxartists.com 0 ypa.sfg.mybluehost.me 0 rmrconsult.com 0 mail.lailasandbaek.com 0 mail.modmoods.com 0 www.ellisoncartercattle.com 0 www.doombots.co 0 ukc.feb.mybluehost.me 0 www.t2rtx.com 0 xqq.sco.mybluehost.me 0 mail.madosamart.com 0 mail.rubberduckyresort.com 0 bubbachat.au 0 megsmedicareandmore.havemedicare.com 0 www.dsv.aca.mybluehost.me 0 www.youngbloodinsurance.havemedicare.com 0 envirogreen.pdl.jfc.mybluehost.me 0 pdl.jfc.mybluehost.me 0 campinglyfe.com 0 mail.wxa.aca.mybluehost.me 0 mail.lightoflovephotography.com 0 artecse.com 0 www.drstenhq.babeslay.com 0 filmnoirfile.spectorsoul.com 0 mail.culturestrategy.io 0 www.galaherlaw.com 0 www.clearvisiondefend.com 0 joannlee.me 0 edyukation.com 1 chubbthoughts.babeslay.com 0 cristinamarie.co 0 mail.1migrationworldwide.com 0 augustgarrett.com 0 www.treedownservices.com 0 mail.qgt.nsm.mybluehost.me 0 www.cosmaxnbtusa.com 0 website-099b56d3.cvr.jzw.mybluehost.me 0 dai.noo.mybluehost.me 0 mail.hny.bhx.mybluehost.me 0 www.website-b42a782f.zsk.wvf.mybluehost.me 0 mail.jacksontel.com 0 mail.divinecaregroup.com.au 0 www.adultingtoo.com 0 mail.mwprintingllc.com 0 www.devotedfmo.havemedicare.com 0 mail.euromontpvc.net 0 denyseforoc.com 0 by-amysue.com 1 mail.opexanswers.com 0 www.kayecoaching.com 0 mail.stonedloverboy.com 0 website-f69fa513.samysbeauty.com 0 www.kindreset.moonandpledge.com 0 akn.wyt.mybluehost.me 0 mail.schneider-et.net 0 website-b445bfff.mkz.tuk.mybluehost.me 0 dve.uxb.mybluehost.me 0 mail.sctplayhouse.com 0 dcglobejotters.org 0 dhm.wxt.mybluehost.me 0 www.apis.flamalama.com 0 www.website-099b56d3.cvr.jzw.mybluehost.me 0 roq.swq.mybluehost.me 0 startuparabia.com 0 ugs.cup.mybluehost.me 0 mail.tcc.xjl.mybluehost.me 0 mail.solicitymedia.com 0 mail.afp.zyv.mybluehost.me 0 website-6dfc558e.mpt.qsp.mybluehost.me 0 sunnybrookefootball-ca.sunnybrookefootball.com 0 website-cc21065f.hny.bhx.mybluehost.me 0 uncageyourinnerlioness.livewholistic.com 0 mail.selabuildstx.com 0 playitforwardsportstherapy.com 0 www.realidadciudadana.bettyhallshopping.com 0 mail.estessparkles.com 0 website-e10ff660.sxm.wyy.mybluehost.me 0 drstenhq.babeslay.com 0 appraisenet.com 0 jgw.gro.mybluehost.me 0 mail.stillnavigating.com 0 mail.stephanierupp.net 0 www.pfcontractorsteam.com 0 vjl.mqz.mybluehost.me 0 evergreennote.com 0 marinvest.cv 0 findingataraxia.com 0 www.stockportsilver.co.uk 0 adarsh.theorphic.space 0 www.kst.ths.mybluehost.me 0 tengomedicare.havemedicare.com 0 website-27017e92.rmp.uqp.mybluehost.me 0 www.premiumbeveragesllc.com 0 www.megsmedicareandmore.havemedicare.com 0 priorityyou.net 0 rbs.fih.mybluehost.me 0 www.ableproductsusa.com 0 mail.lauraaaa.com 0 www.ozq.wvf.mybluehost.me 0 www.members.rocketyourcontent.com 0 www.schneider-et.net 0 www.mkz.tuk.mybluehost.me 0 mail.getbettersleeptoday.com 0 website-d15f2dd6.irz.zga.mybluehost.me 0 www.tchnoweb.com 0 opexanswers.com 0 bhf.bma.mybluehost.me 0 mail.markpevsner.com 0 mail.oidm.com 0 www.timshels.com 0 lvq.mjj.mybluehost.me 0 www.dve.uxb.mybluehost.me 0 mail.ups.zsr.mybluehost.me 0 teamwcoaching.com 0 mail.ugs.cup.mybluehost.me 0 mail.onii-corp.com 0 mail.mxy.oea.mybluehost.me 0 fanhorror.penthousedog.com 0 mail.stalledprojects.com 0 mail.filmnoirfile.com 0 website-9f122a69.eduresourceteam.com 0 cctraining.ca 0 mail.helpfulmba.com 0 lzf.bqn.mybluehost.me 0 bubbachat.com.au 0 www.ire.nsm.mybluehost.me 0 mail.newideasservices.com 0 abcgomedicare.havemedicare.com 0 mail.dik.hsk.mybluehost.me 0 feliztips.com 0 www.kristinmacdermott.com 0 mail.ghr.hgs.mybluehost.me 0 www.iwantittoday.net 0 mail.jwf.zzh.mybluehost.me 0 mail.zbv.ujd.mybluehost.me 0 rmkm.rmrc.site 0 www.buzzpointllc.lifehacksx.com 0 revassistant.lifehacksx.com 0 zappamacchine.com 0 tbh.qjv.mybluehost.me 0 caosventura.com 0 blog.overseasjo.com 0 mail.saragazarekmusic.com 0 www.tessandtrix.theheartofsurrender.com 0 www.psduo.com 0 mail.theartoflivin.com 0 hoskia.walisng.com 0 www.electricalgeelong-com.irz.zga.mybluehost.me 0 www.brkujima.com 0 www.makerofthehome.blog 0 mail.allenrussell.org 0 jwf.zzh.mybluehost.me 0 eddiejoyce.net 0 mail.plt.sfw.mybluehost.me 0 www.altonbranch.com 0 www.melissalynportraits.com 0 twx.egj.mybluehost.me 0 mail.marcbelnick.com 0 www.amontit.com 0 mail.tky.rfl.mybluehost.me 0 www.drowsymind.com 0 maithri.varshavg.com 0 daraghjgrant.com 0 www.qds.yfm.mybluehost.me 0 www.website-e6cfe59a.sailwildair.com 0 website-542cc209.growmybusinessquick.com 0 woodworkingbug.com 0 www.yeq.twj.mybluehost.me 0 bergennaacp.org 0 www.engconcepts.tech 0 mail.tyr.mqz.mybluehost.me 0 www.melfami.com 0 www.financialexamacademy.com 0 www.reca.us 0 www.herewme.com 0 mail.sashashulmanlaw.com 0 mail.jkbvideo.com 0 mail.ericksontattoo.com 0 www.hpq.wev.mybluehost.me 0 www.wetarted.com 0 www.otl.bjl.mybluehost.me 0 www.destinationhabit.com 0 mail.kosidesigns.com.au 0 stephanierupp.net 0 www.pdesigngroup.artecse.com 0 bisbeejoe.com 0 thebankinglady.com 0 guardianmedtransport.com 0 www.freedomfootage.babeslay.com 0 mail.oweless.tax 0 www.lzv.mqz.mybluehost.me 0 www.olivardecardenas.rnsfonts.com 0 mail.sunnybrookefootball.ca 0 mail.pcy.frl.mybluehost.me 0 www.lagmanenterprises.com 0 mail.sungmanhk.com 0 mail.bcz.wbq.mybluehost.me 0 kgpholding.com 0 www.xcw.xvx.mybluehost.me 0 www.madisonelitetrackclub.com 0 test.chipperparts.co.uk 0 knightwatchpublishing.sirchase.com 0 livinginorderlyfashion.com 0 www.beautyandthebestie.com 0 soulofcontinuum.still-movement.com 0 www.suzannecleary.com 0 mail.ibi.oqk.mybluehost.me 0 wilken.co.ke 0 dxs.oui.mybluehost.me 0 www.mai.hsk.mybluehost.me 0 mail.eby.wyz.mybluehost.me 0 www.edencommunitychurch.org 0 www.afp.bqu.mybluehost.me 0 www.trudysfoodies.com 0 mail.rfy.ext.mybluehost.me 0 onc.rfn.mybluehost.me 0 www.aueinc.net 0 www.yqt.qzx.mybluehost.me 0 www.website-4d0aa17c.sjl.ztl.mybluehost.me 1 website-cbc038cc.bza.ttm.mybluehost.me 0 mail.mai.hsk.mybluehost.me 0 mail.zqz.jdq.mybluehost.me 1 www.nlq.ocl.mybluehost.me 0 investirbien.com 0 www.jdq.vxg.mybluehost.me 0 www.jul.wbq.mybluehost.me 0 www.website-56ca12c5.upkeep.ae 0 www.zqz.jdq.mybluehost.me 0 mail.kenaz-est.com 0 www.miiapuumala.fingoglobal.fi 0 mail.willisfam5adventures.com 0 jul.wbq.mybluehost.me 0 aer.qps.mybluehost.me 0 mail.kleincommunication7.com 0 mail.ryusoso.com 0 bettyhallshopping.com 0 simplemarketing.io 0 www.stbess.com 0 www.bfc.vhl.mybluehost.me 0 tillisholdingsllc.com 0 dsw.vsb.mybluehost.me 0 brit-mx.jph.uka.mybluehost.me 0 www.aer.qps.mybluehost.me 0 mail.aer.qps.mybluehost.me 0 www.hny.bhx.mybluehost.me 0 mail.miriamlynn.co.uk 0 mail.jqe.lnr.mybluehost.me 0 maidinatlantacleaning.com 0 lyferesorts.com 0 www.simplemarketing.io 0 ueg.eln.mybluehost.me 0 stbess.com 0 website-1e30f956.mpt.qsp.mybluehost.me 0 mail.taiwan-tourbus.com 0 www.e-memoire.org 0 tmb.bjl.mybluehost.me 0 mail.ire.nsm.mybluehost.me 0 www.website-1e30f956.mpt.qsp.mybluehost.me 0 tripsavior.com 0 mail.winstonthetegu.com 0 mail.kxb.fvs.mybluehost.me 0 lovehopeandautism.com 0 www.andymanblog.com 0 mail.bynathanbosley.com 0 mail.ruffguidemaps.com 0 api.e-plagiat.online 0 premiumbeveragesllc.com 0 www.umm.mtr.mybluehost.me 0 vjm.ens.mybluehost.me 0 nlq.ocl.mybluehost.me 0 mail.det.hbq.mybluehost.me 0 sgclmarketing.com 0 www.wlm.wog.mybluehost.me 0 mail.bagsfulloflove.org 0 www.thedeeprootsapothecary.com 0 mail.justontimeservice.com 0 hpq.wev.mybluehost.me 0 donnagaytyler.com 0 www.website-f6fe3998.sjl.ztl.mybluehost.me 0 www.nanutanu.grm.csp.mybluehost.me 0 mail.gta.pmc.mybluehost.me 0 www.website-8159fce1.sjl.ztl.mybluehost.me 0 mjg.rew.mybluehost.me 0 mail.junctionroadfp.com.au 0 mail.bkm4prez.com 0 mail.hkr.hgn.mybluehost.me 0 www.jaimemedia.com 0 cassenergyhealer.co.uk 0 mail.techpointsales.com 0 mail.fundacionprolongar.org 0 www.website-cd47f3df.livewholistic.com 0 adonebbbm.store 0 mail.deltaprimeconsulting.com 0 jettprep.com 0 www.hth.hzw.mybluehost.me 0 website-4d0aa17c.sjl.ztl.mybluehost.me 0 kyriandrake.sumptuousspoonfuls.com 0 www.deweyread.com 0 ndm.yek.mybluehost.me 0 mail.hxx.qtw.mybluehost.me 0 hopsonlaw.courtneysimone.com 0 mail.thecedarwoodcottage.com 0 truthseekers.lifestruth.org 0 mail.premiumbeveragesllc.com 0 mail.tvp.gro.mybluehost.me 0 mail.insuranceladyusa.com 0 tomikahaynes.com 0 mail.zsl.sco.mybluehost.me 0 darkhorsesleddogs.com 0 www.sctplayhouse.com 0 fairytaletravelguide.com 0 mail.theicingonmycake.com 0 www.avant-gardetech.com 0 www.thecedarwoodcottage.com 0 leftlegfirst.com 0 mail.kathygoodkin.com 0 www.twx.egj.mybluehost.me 0 cotique.media 0 zsk.wvf.mybluehost.me 0 mail.kie.kao.mybluehost.me 0 www.rmrconsult.com 1 mail.corerenovationgroup.com 0 corerenovationgroup.com 0 babat.site 0 ire.nsm.mybluehost.me 0 mail.thd.wxt.mybluehost.me 0 austinb.xyz 0 mail.eddiejoyce.net 0 hkr.hgn.mybluehost.me 0 www.kayeokearny.notemusings.com 0 www.emptyvessels.media 0 mail.pregoworld.com 0 www.selfgrowzone.com 0 rxp.vvo.mybluehost.me 0 www.talladegaritz.com 0 mail.alabrepartyrentals.com 0 uuw.rbb.mybluehost.me 0 mail.afghanroyalsaffron.com 0 mail.justinlichter.com 0 www.youngbloodinsurance.com 0 www.vjl.mqz.mybluehost.me 0 peni-ai.leny.ai 0 mail.zenarklogistics.com 0 dsv.aca.mybluehost.me 0 www.kwe.tzg.mybluehost.me 0 mail.fromloathingtolove.com 0 website-aad32b03.nagarajfirstdomainname.com 0 www.heathergargis.com 0 www.cabaninsurance.havemedicare.com 0 mail.jzi.rmg.mybluehost.me 0 www.vip.adventureinblack.com 0 mail.stockportsilver.org 0 mail.badrabbitpictures.com 0 mail.eef.rwz.mybluehost.me 0 mail.austinb.xyz 0 www.cybridtechnology.com 0 www.qgf.bsd.mybluehost.me 0 mail.theastralmode.com 0 www.kayeokearny.com 0 www.bibarecateringservices.com 0 mail.waygookincookin.com 0 ourmoments.au 0 mail.qgf.bsd.mybluehost.me 0 www.iton.store 0 mail.by-amysue.com 0 www.jqe.lnr.mybluehost.me 0 visiondefenderpro.com 0 www.cyr.fgc.mybluehost.me 0 jaladmissions.com 0 mail.deweyread.com 0 gml.feb.mybluehost.me 0 www.casinsure.havemedicare.com 0 www.sungmanhk.com 0 waqfbaghlafalzafer.com 0 mail.hhh.bow.mybluehost.me 0 nanutanu.grm.csp.mybluehost.me 0 shop.golddiggermercantile.com 0 mail.recruitfit.net 0 www.insurancebydesign.org 1 www.bereant.com 0 mail.evergreennotebuyer.com 0 sungmanhk.com 0 jzi.rmg.mybluehost.me 0 www.stalledprojects.com 0 freedomhealthministries.com 0 www.eby.wyz.mybluehost.me 0 www.realidadciudadana.com 0 mail.drlindaenoh.com 0 www.cfoofsaas.com 0 hry.qhd.mybluehost.me 0 mail.zzj.boy.mybluehost.me 1 www.waqfbaghlafalzafer.com 0 mail.opu.nuh.mybluehost.me 0 cfoofsaas.com 0 www.casinsure.com 0 foreverfervent.com 0 mail.campinglyfe.com 0 mail.nbd.upt.mybluehost.me 0 www.maidinatlantacleaning.com 0 casasanpablo.com 0 www.faltdyep.com 0 lightoflovephotography.com 0 ylz.hgn.mybluehost.me 0 ozq.wvf.mybluehost.me 0 www.endlessdiscoveries.net 0 mail.visimony.com 0 mail.getasafetynet.com 0 www.adarsh.theorphic.space 0 mail.irei.com.mx 0 mail.ypa.sfg.mybluehost.me 0 mail.zki.hju.mybluehost.me 0 clarkedonelsonphoto.com 0 mail.asf.vvo.mybluehost.me 0 www.dsw.vsb.mybluehost.me 0 sofoodtastic.com 0 www.bookishgirlsblog.com 0 afghanroyalsaffron.com 0 www.zzj.boy.mybluehost.me 0 mail.zot.cex.mybluehost.me 0 mail.uxl.enu.mybluehost.me 0 slaveckmoraru.com 0 mail.bubbachat.com 0 www.thinkelevate-tech.viewserendib.com 0 insuranceshoppe-me.havemedicare.com 0 coloringthemind.com 0 aza.mhj.mybluehost.me 0 oweless-tax.diydebtsolution.com 0 mail.svolgere.finance 0 daniyaal.ca 0 www.afghanroyalsaffron.com 0 usaworldchampionships.com 0 www.wildsideworkouts.com 0 www.sctplayhouse.sctplayhouse.org 0