Domain amaroo.ai
United States
AUTOMATTIC
Software information

nginx nginx

tcp/443 tcp/80

  • Open service 192.0.79.164:443 · amaroo.ai

    2026-01-09 16:37

    HTTP/1.1 410 Gone
    Server: nginx
    Date: Fri, 09 Jan 2026 16:37:57 GMT
    Content-Type: text/html
    Content-Length: 1086
    Connection: close
    Strict-Transport-Security: max-age=31536000
    ETag: "62291f3d-43e"
    X-ac: 3.lhr _atomic_ams MISS
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=lhr, cache;desc=MISS;dur=165.0
    
    Page title: 410 Gone
    
    <!DOCTYPE html>
    <html lang="en">
    	<head>
    		<meta charset="utf-8">
    		<title>410 Gone</title>
    		<meta name="description" content="">
    		<meta name="author" content="">
    
    		<style>
    		body {
    			background-color: #f8f8f8;
    			font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;
    			color: #333;
    			padding-top: 20px;
    		}
    		div {
    			display: block;
    		}
    		.container {
    			width: 1100px;
    			padding-top: 50px;
    			margin-left: auto;
    			margin-right: auto;
    		}
    		.error-msg, .support-msg {
    			text-align: center;
    		}
    		.error-msg {
    			margin-bottom: 40px;
    		}
    		.error-msg h1 {
    			font-size: 52px;
    			display: block;
    			margin: 0px;
    		}
    		.error-msg p {
    			font-size: 20px;
    			display: block;
    			margin: 10px 0;
    		}
    		.support-msg p {
    			font-size: 14px;
    			color: #888;
    		}
    		</style>
    	</head>
    
    	<body>
    		<div class="container">
    			<div class="error-msg">
    				<h1>410 Gone</h1>
    				<p>This site is disabled.</p>
    			</div>
    			<div class="support-msg">
    				<p>Website owner? If you think you have reached this message in error, please contact support.</p>
    			</div>
    		</div>
    	</body>
    </html>
    
    Found 2026-01-09 by HttpPlugin
    Create report
  • Open service 192.0.79.143:443 · amaroo.ai

    2026-01-06 22:06

    HTTP/1.1 410 Gone
    Server: nginx
    Date: Tue, 06 Jan 2026 22:06:11 GMT
    Content-Type: text/html
    Content-Length: 1086
    Connection: close
    Strict-Transport-Security: max-age=31536000
    ETag: "62291f3d-43e"
    X-ac: 1.yyz _atomic_dca MISS
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=yyz, cache;desc=MISS;dur=80.0
    
    Page title: 410 Gone
    
    <!DOCTYPE html>
    <html lang="en">
    	<head>
    		<meta charset="utf-8">
    		<title>410 Gone</title>
    		<meta name="description" content="">
    		<meta name="author" content="">
    
    		<style>
    		body {
    			background-color: #f8f8f8;
    			font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;
    			color: #333;
    			padding-top: 20px;
    		}
    		div {
    			display: block;
    		}
    		.container {
    			width: 1100px;
    			padding-top: 50px;
    			margin-left: auto;
    			margin-right: auto;
    		}
    		.error-msg, .support-msg {
    			text-align: center;
    		}
    		.error-msg {
    			margin-bottom: 40px;
    		}
    		.error-msg h1 {
    			font-size: 52px;
    			display: block;
    			margin: 0px;
    		}
    		.error-msg p {
    			font-size: 20px;
    			display: block;
    			margin: 10px 0;
    		}
    		.support-msg p {
    			font-size: 14px;
    			color: #888;
    		}
    		</style>
    	</head>
    
    	<body>
    		<div class="container">
    			<div class="error-msg">
    				<h1>410 Gone</h1>
    				<p>This site is disabled.</p>
    			</div>
    			<div class="support-msg">
    				<p>Website owner? If you think you have reached this message in error, please contact support.</p>
    			</div>
    		</div>
    	</body>
    </html>
    
    Found 2026-01-06 by HttpPlugin
    Create report
  • Open service 192.0.79.164:443 · amaroo.ai

    2026-01-06 22:06

    HTTP/1.1 410 Gone
    Server: nginx
    Date: Tue, 06 Jan 2026 22:06:11 GMT
    Content-Type: text/html
    Content-Length: 1086
    Connection: close
    Strict-Transport-Security: max-age=31536000
    ETag: "62291f3d-43e"
    X-ac: 1.yyz _atomic_dca MISS
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=yyz, cache;desc=MISS;dur=80.0
    
    Page title: 410 Gone
    
    <!DOCTYPE html>
    <html lang="en">
    	<head>
    		<meta charset="utf-8">
    		<title>410 Gone</title>
    		<meta name="description" content="">
    		<meta name="author" content="">
    
    		<style>
    		body {
    			background-color: #f8f8f8;
    			font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;
    			color: #333;
    			padding-top: 20px;
    		}
    		div {
    			display: block;
    		}
    		.container {
    			width: 1100px;
    			padding-top: 50px;
    			margin-left: auto;
    			margin-right: auto;
    		}
    		.error-msg, .support-msg {
    			text-align: center;
    		}
    		.error-msg {
    			margin-bottom: 40px;
    		}
    		.error-msg h1 {
    			font-size: 52px;
    			display: block;
    			margin: 0px;
    		}
    		.error-msg p {
    			font-size: 20px;
    			display: block;
    			margin: 10px 0;
    		}
    		.support-msg p {
    			font-size: 14px;
    			color: #888;
    		}
    		</style>
    	</head>
    
    	<body>
    		<div class="container">
    			<div class="error-msg">
    				<h1>410 Gone</h1>
    				<p>This site is disabled.</p>
    			</div>
    			<div class="support-msg">
    				<p>Website owner? If you think you have reached this message in error, please contact support.</p>
    			</div>
    		</div>
    	</body>
    </html>
    
    Found 2026-01-06 by HttpPlugin
    Create report
  • Open service 192.0.79.143:80 · amaroo.ai

    2026-01-06 22:06

    HTTP/1.1 301 Moved Permanently
    Server: nginx
    Date: Tue, 06 Jan 2026 22:06:11 GMT
    Content-Type: text/html
    Content-Length: 162
    Connection: close
    Location: https://amaroo.ai/
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=sjc, cache;desc=BYPASS;dur=0.0
    
    Page title: 301 Moved Permanently
    
    <html>
    <head><title>301 Moved Permanently</title></head>
    <body>
    <center><h1>301 Moved Permanently</h1></center>
    <hr><center>nginx</center>
    </body>
    </html>
    
    Found 2026-01-06 by HttpPlugin
    Create report
  • Open service 192.0.79.164:80 · amaroo.ai

    2026-01-06 22:06

    HTTP/1.1 301 Moved Permanently
    Server: nginx
    Date: Tue, 06 Jan 2026 22:06:11 GMT
    Content-Type: text/html
    Content-Length: 162
    Connection: close
    Location: https://amaroo.ai/
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=yyz, cache;desc=BYPASS;dur=0.0
    
    Page title: 301 Moved Permanently
    
    <html>
    <head><title>301 Moved Permanently</title></head>
    <body>
    <center><h1>301 Moved Permanently</h1></center>
    <hr><center>nginx</center>
    </body>
    </html>
    
    Found 2026-01-06 by HttpPlugin
    Create report
  • Open service 192.0.79.164:443 · amaroo.ai

    2026-01-02 16:15

    HTTP/1.1 410 Gone
    Server: nginx
    Date: Fri, 02 Jan 2026 16:15:16 GMT
    Content-Type: text/html
    Content-Length: 1086
    Connection: close
    Strict-Transport-Security: max-age=31536000
    ETag: "62291f3d-43e"
    X-ac: 3.bom _atomic_dca MISS
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=bom, cache;desc=MISS;dur=360.0
    
    Page title: 410 Gone
    
    <!DOCTYPE html>
    <html lang="en">
    	<head>
    		<meta charset="utf-8">
    		<title>410 Gone</title>
    		<meta name="description" content="">
    		<meta name="author" content="">
    
    		<style>
    		body {
    			background-color: #f8f8f8;
    			font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;
    			color: #333;
    			padding-top: 20px;
    		}
    		div {
    			display: block;
    		}
    		.container {
    			width: 1100px;
    			padding-top: 50px;
    			margin-left: auto;
    			margin-right: auto;
    		}
    		.error-msg, .support-msg {
    			text-align: center;
    		}
    		.error-msg {
    			margin-bottom: 40px;
    		}
    		.error-msg h1 {
    			font-size: 52px;
    			display: block;
    			margin: 0px;
    		}
    		.error-msg p {
    			font-size: 20px;
    			display: block;
    			margin: 10px 0;
    		}
    		.support-msg p {
    			font-size: 14px;
    			color: #888;
    		}
    		</style>
    	</head>
    
    	<body>
    		<div class="container">
    			<div class="error-msg">
    				<h1>410 Gone</h1>
    				<p>This site is disabled.</p>
    			</div>
    			<div class="support-msg">
    				<p>Website owner? If you think you have reached this message in error, please contact support.</p>
    			</div>
    		</div>
    	</body>
    </html>
    
    Found 2026-01-02 by HttpPlugin
    Create report
  • Open service 192.0.79.164:443 · amaroo.ai

    2026-01-02 14:09

    HTTP/1.1 410 Gone
    Server: nginx
    Date: Fri, 02 Jan 2026 14:09:24 GMT
    Content-Type: text/html
    Content-Length: 1086
    Connection: close
    Strict-Transport-Security: max-age=31536000
    ETag: "62291f3d-43e"
    X-ac: 1.sjc _atomic_bur MISS
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=sjc, cache;desc=MISS;dur=14.0
    
    Page title: 410 Gone
    
    <!DOCTYPE html>
    <html lang="en">
    	<head>
    		<meta charset="utf-8">
    		<title>410 Gone</title>
    		<meta name="description" content="">
    		<meta name="author" content="">
    
    		<style>
    		body {
    			background-color: #f8f8f8;
    			font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;
    			color: #333;
    			padding-top: 20px;
    		}
    		div {
    			display: block;
    		}
    		.container {
    			width: 1100px;
    			padding-top: 50px;
    			margin-left: auto;
    			margin-right: auto;
    		}
    		.error-msg, .support-msg {
    			text-align: center;
    		}
    		.error-msg {
    			margin-bottom: 40px;
    		}
    		.error-msg h1 {
    			font-size: 52px;
    			display: block;
    			margin: 0px;
    		}
    		.error-msg p {
    			font-size: 20px;
    			display: block;
    			margin: 10px 0;
    		}
    		.support-msg p {
    			font-size: 14px;
    			color: #888;
    		}
    		</style>
    	</head>
    
    	<body>
    		<div class="container">
    			<div class="error-msg">
    				<h1>410 Gone</h1>
    				<p>This site is disabled.</p>
    			</div>
    			<div class="support-msg">
    				<p>Website owner? If you think you have reached this message in error, please contact support.</p>
    			</div>
    		</div>
    	</body>
    </html>
    
    Found 2026-01-02 by HttpPlugin
    Create report
  • Open service 192.0.79.143:443 · amaroo.ai

    2026-01-02 14:09

    HTTP/1.1 410 Gone
    Server: nginx
    Date: Fri, 02 Jan 2026 14:09:25 GMT
    Content-Type: text/html
    Content-Length: 1086
    Connection: close
    Strict-Transport-Security: max-age=31536000
    ETag: "62291f3d-43e"
    X-ac: 23.hhn _atomic_ams MISS
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=hhn, cache;desc=MISS;dur=326.0
    
    Page title: 410 Gone
    
    <!DOCTYPE html>
    <html lang="en">
    	<head>
    		<meta charset="utf-8">
    		<title>410 Gone</title>
    		<meta name="description" content="">
    		<meta name="author" content="">
    
    		<style>
    		body {
    			background-color: #f8f8f8;
    			font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;
    			color: #333;
    			padding-top: 20px;
    		}
    		div {
    			display: block;
    		}
    		.container {
    			width: 1100px;
    			padding-top: 50px;
    			margin-left: auto;
    			margin-right: auto;
    		}
    		.error-msg, .support-msg {
    			text-align: center;
    		}
    		.error-msg {
    			margin-bottom: 40px;
    		}
    		.error-msg h1 {
    			font-size: 52px;
    			display: block;
    			margin: 0px;
    		}
    		.error-msg p {
    			font-size: 20px;
    			display: block;
    			margin: 10px 0;
    		}
    		.support-msg p {
    			font-size: 14px;
    			color: #888;
    		}
    		</style>
    	</head>
    
    	<body>
    		<div class="container">
    			<div class="error-msg">
    				<h1>410 Gone</h1>
    				<p>This site is disabled.</p>
    			</div>
    			<div class="support-msg">
    				<p>Website owner? If you think you have reached this message in error, please contact support.</p>
    			</div>
    		</div>
    	</body>
    </html>
    
    Found 2026-01-02 by HttpPlugin
    Create report
  • Open service 192.0.79.143:80 · amaroo.ai

    2026-01-02 14:09

    HTTP/1.1 301 Moved Permanently
    Server: nginx
    Date: Fri, 02 Jan 2026 14:09:24 GMT
    Content-Type: text/html
    Content-Length: 162
    Connection: close
    Location: https://amaroo.ai/
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=yyz, cache;desc=BYPASS;dur=0.0
    
    Page title: 301 Moved Permanently
    
    <html>
    <head><title>301 Moved Permanently</title></head>
    <body>
    <center><h1>301 Moved Permanently</h1></center>
    <hr><center>nginx</center>
    </body>
    </html>
    
    Found 2026-01-02 by HttpPlugin
    Create report
  • Open service 192.0.79.164:80 · amaroo.ai

    2026-01-02 14:09

    HTTP/1.1 301 Moved Permanently
    Server: nginx
    Date: Fri, 02 Jan 2026 14:09:24 GMT
    Content-Type: text/html
    Content-Length: 162
    Connection: close
    Location: https://amaroo.ai/
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=jfk, cache;desc=BYPASS;dur=47.0
    
    Page title: 301 Moved Permanently
    
    <html>
    <head><title>301 Moved Permanently</title></head>
    <body>
    <center><h1>301 Moved Permanently</h1></center>
    <hr><center>nginx</center>
    </body>
    </html>
    
    Found 2026-01-02 by HttpPlugin
    Create report
  • Open service 192.0.79.164:80 · www.amaroo.ai

    2026-01-02 14:09

    HTTP/1.1 301 Moved Permanently
    Server: nginx
    Date: Fri, 02 Jan 2026 14:09:07 GMT
    Content-Type: text/html
    Content-Length: 162
    Connection: close
    Location: https://www.amaroo.ai/
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=ams, cache;desc=BYPASS;dur=0.0
    
    Page title: 301 Moved Permanently
    
    <html>
    <head><title>301 Moved Permanently</title></head>
    <body>
    <center><h1>301 Moved Permanently</h1></center>
    <hr><center>nginx</center>
    </body>
    </html>
    
    Found 2026-01-02 by HttpPlugin
    Create report
  • Open service 192.0.79.164:443 · amaroo.ai

    2025-12-20 23:25

    HTTP/1.1 200 OK
    Server: nginx
    Date: Sat, 20 Dec 2025 23:25:17 GMT
    Content-Type: text/html; charset=UTF-8
    Transfer-Encoding: chunked
    Connection: close
    Strict-Transport-Security: max-age=31536000
    Vary: Accept-Encoding
    Vary: Cookie
    Link: <https://amaroo.ai/index.php?rest_route=/>; rel="https://api.w.org/"
    X-ac: 23.hhn _atomic_ams UPDATING
    Alt-Svc: h3=":443"; ma=86400
    Server-Timing: a8c-cdn, dc;desc=hhn, cache;desc=UPDATING;dur=2.0
    
    Found 2025-12-20 by HttpPlugin
    Create report
acadianacomfort.comamaroo.aiathensbudo.comchampagneathletics.code.blogchiropractor.music.blogchristins-tierbetreuung.comdentistinn.family.blogfernandopintoadv.comfoolishlyhappy.comfzcc.comhomesteadlandscapinginc.comhoo-atelier.frjuststreaming.movie.bloglapaellaeventos.com.brmadiandtv.movie.blogmakanmakan.music.blogmatihealth.commeisinger-interior.commusicmaykers.linkmyfamilytraveladventures.comorganizedbooksco.caparaglidingsuppliesireland.ieslot.movie.blogtedal.family.blogtls.automattic.comtoptiertc.comtravel-with-sag-itt-a-aurea.comundefeatedfaith.comwww.acadianacomfort.comwww.athensbudo.comwww.champagneathletics.code.blogwww.chiropractor.music.blogwww.dearkids.family.blogwww.dentistinn.family.blogwww.fernandopintoadv.comwww.foolishlyhappy.comwww.hoo-atelier.frwww.juststreaming.movie.blogwww.lapaellaeventos.com.brwww.madiandtv.movie.blogwww.meisinger-interior.comwww.musicmaykers.linkwww.myfamilytraveladventures.comwww.organizedbooksco.cawww.paraglidingsuppliesireland.iewww.slot.movie.blogwww.tedal.family.blogwww.travel-with-sag-itt-a-aurea.com
CN:
tls.automattic.com
Key:
ECDSA-256
Issuer:
E7
Not before:
2026-01-02 13:09
Not after:
2026-04-02 13:09
acadianacomfort.comamaroo.aiathensbudo.comchampagneathletics.code.blogchiropractor.music.blogchristins-tierbetreuung.comdentistinn.family.blogfernandopintoadv.comfoolishlyhappy.comfzcc.comhomesteadlandscapinginc.comhoo-atelier.frjuststreaming.movie.bloglapaellaeventos.com.brmadiandtv.movie.blogmakanmakan.music.blogmatihealth.commeisinger-interior.commusicmaykers.linkmyfamilytraveladventures.comorganizedbooksco.caparaglidingsuppliesireland.ieslot.movie.blogtechnischeuebersetzung.frtedal.family.blogtls.automattic.comtoptiertc.comtravel-with-sag-itt-a-aurea.comundefeatedfaith.comwww.acadianacomfort.comwww.athensbudo.comwww.champagneathletics.code.blogwww.chiropractor.music.blogwww.dearkids.family.blogwww.dentistinn.family.blogwww.fernandopintoadv.comwww.foolishlyhappy.comwww.hoo-atelier.frwww.incpill.comwww.juststreaming.movie.blogwww.lapaellaeventos.com.brwww.madiandtv.movie.blogwww.meisinger-interior.comwww.musicmaykers.linkwww.myfamilytraveladventures.comwww.organizedbooksco.cawww.paraglidingsuppliesireland.iewww.slot.movie.blogwww.technicaltranslation.frwww.tedal.family.blogwww.travel-with-sag-itt-a-aurea.com
CN:
tls.automattic.com
Key:
ECDSA-256
Issuer:
E8
Not before:
2025-11-01 14:07
Not after:
2026-01-30 14:07
Domain summary
IP summary