Host 112.15.89.250
China
China Mobile communications corporation
Win32 AMD64
  • Open SMB file sharing detected
    IP: 112.15.89.250
    Port: 445
    First seen 2023-01-12 23:39
    Last seen 2024-06-01 03:03
    Open for 505 days
  • MySQL is publicly available
    IP: 112.15.89.250
    Port: 3308
    First seen 2023-07-27 05:10
    • Severity: high
      Fingerprint: cf350410ecceb5fd3e040cc6af76d0fcee85783e6f4adc646a0b3cfa528a04bb

      Databases: 186, row count: 222846, size: 94.8 MB
      No or default MySQL authentication found.Found table mysql.columns_priv with 0 records
      Found table mysql.db with 2 records
      Found table mysql.engine_cost with 2 records
      Found table mysql.event with 0 records
      Found table mysql.func with 0 records
      Found table mysql.general_log with 2 records
      Found table mysql.gtid_executed with 0 records
      Found table mysql.help_category with 41 records
      Found table mysql.help_keyword with 798 records
      Found table mysql.help_relation with 1060 records
      Found table mysql.help_topic with 481 records
      Found table mysql.innodb_index_stats with 1949 records
      Found table mysql.innodb_table_stats with 157 records
      Found table mysql.ndb_binlog_index with 0 records
      Found table mysql.plugin with 0 records
      Found table mysql.proc with 48 records
      Found table mysql.procs_priv with 0 records
      Found table mysql.proxies_priv with 1 records
      Found table mysql.server_cost with 6 records
      Found table mysql.servers with 0 records
      Found table mysql.slave_master_info with 0 records
      Found table mysql.slave_relay_log_info with 0 records
      Found table mysql.slave_worker_info with 0 records
      Found table mysql.slow_log with 2 records
      Found table mysql.tables_priv with 2 records
      Found table mysql.time_zone with 0 records
      Found table mysql.time_zone_leap_second with 0 records
      Found table mysql.time_zone_name with 0 records
      Found table mysql.time_zone_transition with 0 records
      Found table mysql.time_zone_transition_type with 0 records
      Found table mysql.user with 3 records
      Found table smartsystem.advanceparking with 0 records
      Found table smartsystem.ali_apiconfig with 0 records
      Found table smartsystem.alipaysubmerchantconfig with 0 records
      Found table smartsystem.amattendancereport with 0 records
      Found table smartsystem.amovertime with 0 records
      Found table smartsystem.ampostinfo with 0 records
      Found table smartsystem.amscheduling with 0 records
      Found table smartsystem.amshift with 0 records
      Found table smartsystem.amshiftdate with 0 records
      Found table smartsystem.amshiftdetail with 0 records
      Found table smartsystem.amsigncard with 0 records
      Found table smartsystem.basecity with 0 records
      Found table smartsystem.basecompany with 0 records
      Found table smartsystem.basedept with 0 records
      Found table smartsystem.baseemployee with 509 records
      Found table smartsystem.baseparkinfo with 1 records
      Found table smartsystem.baseparkinfoexpand with 0 records
      Found table smartsystem.basepassremark with 0 records
      Found table smartsystem.baseprovince with 0 records
      Found table smartsystem.basevillage with 0 records
      Found table smartsystem.box_upparkcarderate with 0 records
      Found table smartsystem.box_upparkchangeshiftrecord with 0 records
      Found table smartsystem.box_upparkdevicedetection with 0 records
      Found table smartsystem.box_upparkevent with 0 records
      Found table smartsystem.box_upparkiorecord with 0 records
      Found table smartsystem.box_upparkorder with 0 records
      Found table smartsystem.box_upparktimeseries with 0 records
      Found table smartsystem.bwygatemapping with 0 records
      Found table smartsystem.dmdevparam with 0 records
      Found table smartsystem.dmperiod with 0 records
      Found table smartsystem.dmtemplmt3 with 0 records
      Found table smartsystem.dmupdate with 0 records
      Found table smartsystem.dmweeklmt3 with 0 records
      Found table smartsystem.doorarea with 0 records
      Found table smartsystem.doordevgrant with 0 records
      Found table smartsystem.doordevice with 0 records
      Found table smartsystem.doordeviceparam with 0 records
      Found table smartsystem.dooremployee with 0 records
      Found table smartsystem.dooremployeefollow with 0 records
      Found table smartsystem.dooremployeephoto with 0 records
      Found table smartsystem.doorevent with 0 records
      Found table smartsystem.doorgate with 0 records
      Found table smartsystem.doortimeperiod with 0 records
      Found table smartsystem.dooruploadcompany with 0 records
      Found table smartsystem.dooruploadproject with 0 records
      Found table smartsystem.employeeplate with 408 records
      Found table smartsystem.exceptions with 0 records
      Found table smartsystem.familycar with 0 records
      Found table smartsystem.familycarinoutnum with 0 records
      Found table smartsystem.formmaintitel with 0 records
      Found table smartsystem.jianhangconfig with 0 records
      Found table smartsystem.loginlog with 0 records
      Found table smartsystem.onlinenoticefailorder with 0 records
      Found table smartsystem.onlineorder with 0 records
      Found table smartsystem.operatelog with 4839 records
      Found table smartsystem.parkarea with 1 records
      Found table smartsystem.parkareafeeruleex with 0 records
      Found table smartsystem.parkblacklist with 1 records
      Found table smartsystem.parkbox with 2 records
      Found table smartsystem.parkboxdetection with 0 records
      Found table smartsystem.parkcarbit with 0 records
      Found table smartsystem.parkcarbitgroup with 0 records
      Found table smartsystem.parkcarderate with 38414 records
      Found table smartsystem.parkcardsuspendplan with 0 records
      Found table smartsystem.parkcarlineinfo with 4 records
      Found table smartsystem.parkcarmodel with 4 records
      Found table smartsystem.parkcartype with 4 records
      Found table smartsystem.parkcartypefeeruleex with 0 records
      Found table smartsystem.parkcartypesingle with 28 records
      Found table smartsystem.parkchangeshiftrecord with 100 records
      Found table smartsystem.parkconnectionproxy with 0 records
      Found table smartsystem.parkderate with 118 records
      Found table smartsystem.parkderateconfig with 0 records
      Found table smartsystem.parkderateintervar with 0 records
      Found table smartsystem.parkderateqrcode with 339 records
      Found table smartsystem.parkdevice with 8 records
      Found table smartsystem.parkdevicedetection with 8 records
      Found table smartsystem.parkdeviceparam with 0 records
      Found table smartsystem.parkevent with 94032 records
      Found table smartsystem.parkfeerule with 2 records
      Found table smartsystem.parkfeeruledetail with 9 records
      Found table smartsystem.parkfeeruleexsubtimeperiod with 121 records
      Found table smartsystem.parkfeeruleextimeperiod with 8 records
      Found table smartsystem.parkgate with 6 records
      Found table smartsystem.parkgateexpand with 0 records
      Found table smartsystem.parkgateiotime with 0 records
      Found table smartsystem.parkgrant with 509 records
      Found table smartsystem.parkholidaydate with 0 records
      Found table smartsystem.parkinterim with 0 records
      Found table smartsystem.parkiorecord with 43973 records
      Found table smartsystem.parkiorecordexend with 0 records
      Found table smartsystem.parkiorecordmanagebook with 0 records
      Found table smartsystem.parklpplan with 0 records
      Found table smartsystem.parkmonthlycarapply with 0 records
      Found table smartsystem.parknoninductivetype with 0 records
      Found table smartsystem.parkorder with 21969 records
      Found table smartsystem.parkorderexpand with 12154 records
      Found table smartsystem.parkoutetcinfo with 0 records
      Found table smartsystem.parkoverspeedrecord with 0 records
      Found table smartsystem.parkplateexpand with 479 records
      Found table smartsystem.parkreservebit with 0 records
      Found table smartsystem.parkrtagateinfo with 0 records
      Found table smartsystem.parkseller with 105 records
      Found table smartsystem.parkselleruser with 0 records
      Found table smartsystem.parksettlement with 0 records
      Found table smartsystem.parksettlementapprovalflow with 0 records
      Found table smartsystem.parkshare with 0 records
      Found table smartsystem.parktempinrecord with 0 records
      Found table smartsystem.parktimeseries with 0 records
      Found table smartsystem.parkvisitor with 0 records
      Found table smartsystem.pgarea with 0 records
      Found table smartsystem.pgareapoint with 0 records
      Found table smartsystem.pgdevice with 0 records
      Found table smartsystem.pgeventrec with 0 records
      Found table smartsystem.redpackorder with 0 records
      Found table smartsystem.resourceinfo with 0 records
      Found table smartsystem.sendmessageinfo with 0 records
      Found table smartsystem.sj_bindplatenumber with 0 records
      Found table smartsystem.sj_filetext with 0 records
      Found table smartsystem.statistics_changeshift with 0 records
      Found table smartsystem.statistics_gather with 0 records
      Found table smartsystem.statistics_gathergate with 0 records
      Found table smartsystem.statistics_gatherlongtime with 0 records
      Found table smartsystem.syscpmodelright with 0 records
      Found table smartsystem.sysdictionary with 0 records
      Found table smartsystem.sysroleauthorize with 126 records
      Found table smartsystem.sysroles with 2 records
      Found table smartsystem.sysrolescope with 0 records
      Found table smartsystem.sysscope with 0 records
      Found table smartsystem.sysscopeauthorize with 0 records
      Found table smartsystem.sysuser with 4 records
      Found table smartsystem.sysuserrolesmapping with 5 records
      Found table smartsystem.sysuserscopemapping with 0 records
      Found table smartsystem.thirdpartydocksetting with 0 records
      Found table smartsystem.uploaddatastate with 0 records
      Found table smartsystem.uploadimgs with 0 records
      Found table smartsystem.visitoraccount with 0 records
      Found table smartsystem.visitordevgrant with 0 records
      Found table smartsystem.visitorinfo with 0 records
      Found table smartsystem.visitorinfophoto with 0 records
      Found table smartsystem.wx_account with 0 records
      Found table smartsystem.wx_apiconfig with 0 records
      Found table smartsystem.wx_apisubmerchantconfig with 0 records
      Found table smartsystem.wx_article with 0 records
      Found table smartsystem.wx_carinfo with 0 records
      Found table smartsystem.wx_info with 0 records
      Found table smartsystem.wx_interactioninfo with 0 records
      Found table smartsystem.wx_keyword with 0 records
      Found table smartsystem.wx_lockcar with 0 records
      Found table smartsystem.wx_menu with 0 records
      Found table smartsystem.wx_menuaccessrecord with 0 records
      Found table smartsystem.wx_opinionfeedback with 0 records
      Found table smartsystem.wx_otherconfig with 0 records
      Found table smartsystem.wx_userlocation with 0 records
      Found table smartsystem.xjztf_area with 0 records
      
      Found on 2023-07-27 05:10
      94.8 MBytes 222846 rows
  • Open service 112.15.89.250:445

    2024-06-01 03:03

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-06-01 by SmbPlugin
    Create report
  • Open service 112.15.89.250:445

    2024-05-29 22:06

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-05-29 by SmbPlugin
    Create report
  • Open service 112.15.89.250:445

    2024-05-27 21:06

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-05-27 by SmbPlugin
    Create report
  • Open service 112.15.89.250:445

    2024-05-26 20:53

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-05-26 by SmbPlugin
    Create report
  • Open service 112.15.89.250:445

    2024-05-25 23:14

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-05-25 by SmbPlugin
    Create report
  • Open service 112.15.89.250:445

    2024-05-24 22:47

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-05-24 by SmbPlugin
    Create report
  • Open service 112.15.89.250:3308

    2024-05-24 10:53

    MySQL detected
    Found 2024-05-24 by tcpid
    Create report
  • Open service 112.15.89.250:445

    2024-05-23 22:44

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-05-23 by SmbPlugin
    Create report
  • Open service 112.15.89.250:445

    2024-05-22 20:43

    SMB NTLMSSP handshake results:
    Found Windows 6.1 build 7601
    NbComputerName: PC-20210324IWHQ
    NbDomainName: PC-20210324IWHQ
    DNSComputerName: PC-20210324IWHQ
    DNSDomainName: PC-20210324IWHQ
    
    Found 2024-05-22 by SmbPlugin
    Create report
Data leak
Size
94.8 MB
Collections
186
Rows
222846
Domain summary
No record