Host 162.241.216.122
United States
Software information
Apache
tcp/443 tcp/80
nginx 1.21.6
tcp/443 tcp/80
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 15:22
Last seen 2024-09-16 22:49
Open for 732 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2024-09-16 22:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 22:45
Open for 438 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 22:45
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: www.test.sushiheavenpenticton.ca
Port: 443
URL: https://www.test.sushiheavenpenticton.caFirst seen 2023-05-04 15:27
Last seen 2024-09-16 22:20
Open for 501 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 22:20321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.test.sushiheavenpenticton.ca
Port: 443
URL: https://www.test.sushiheavenpenticton.caFirst seen 2024-06-08 08:09
Last seen 2024-09-16 22:20
Open for 100 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c20f30ab920f30ab924fed7fab2881a2837c83c6458844c32Found 67 files trough .DS_Store spidering: /400.shtml /401.shtml /403.shtml /404.shtml /405.shtml /406.shtml /500.shtml /appetizers.html /combo1.html /css /css/DINPro.eot /css/DINPro.ttf /css/DINPro.woff /css/DS_Store /css/style.css /css/stylesheet.css /DS_Store /ftpquota /hplogo.gif /htaccess /img /img/backup_takeout_bg1.png /img/bhours.png /img/delivery.png /img/DS_Store /img/hours.png /img/katsu.pdf /img/katsu.png /img/lights.png /img/logo.png /img/main_bg.jpg /img/main_bg.png /img/main_bg1.png /img/maps.png /img/menu_appe.png /img/menu_box.png /img/menu_combo.png /img/menu_nigiri.png /img/menu_party.png /img/menu_roll.png /img/menu_spc.png /img/menu_tempura.png /img/menu_udon.png /img/rocket.png /img/sideWall.JPG /img/takeout_bg.png /img/takeout_bg1.png /index.html /index_setting.html /js /js/DS_Store /js/jquery-2.1.1.min.js /js/jquery-ui.min.js /js/jquery.easing.1.3.js /js/section.js /lunch1.html /menu /nigiri1.html /package-lock.json /party1.html /roll1.html /SHall1.html /spc1.html /takeout.html /TakeOutMenu /tempura1.html /udon1.html
Found on 2024-09-16 22:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c8e4417c08e4417c05ccf17936a89fc4942141f0ddb79e037Found 62 files trough .DS_Store spidering: /400.shtml /401.shtml /403.shtml /404.shtml /405.shtml /406.shtml /500.shtml /appetizers.html /combo1.html /css /css/DINPro.eot /css/DINPro.ttf /css/DINPro.woff /css/DS_Store /css/style.css /css/stylesheet.css /DS_Store /ftpquota /hplogo.gif /htaccess /img /img/backup_takeout_bg1.png /img/bhours.png /img/delivery.png /img/DS_Store /img/hours.png /img/katsu.pdf /img/katsu.png /img/lights.png /img/logo.png /img/main_bg.jpg /img/main_bg.png /img/main_bg1.png /img/maps.png /img/menu_appe.png /img/menu_box.png /img/menu_combo.png /img/menu_nigiri.png /img/menu_party.png /img/menu_roll.png /img/menu_spc.png /img/menu_tempura.png /img/menu_udon.png /img/rocket.png /img/sideWall.JPG /img/takeout_bg.png /img/takeout_bg1.png /index.html /index_setting.html /js /lunch1.html /menu /nigiri1.html /package-lock.json /party1.html /roll1.html /SHall1.html /spc1.html /takeout.html /TakeOutMenu /tempura1.html /udon1.html
Found on 2024-09-10 18:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:22
Last seen 2024-09-16 22:11
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.website-d17477dc.laelgia.com
Port: 443
URL: https://www.website-d17477dc.laelgia.comFirst seen 2024-02-20 16:35
Last seen 2024-09-16 21:57
Open for 209 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab70554525bb05d15db905a6ec70c757a3Found 7 files trough .DS_Store spidering: /contactme.html /css /experience /file /han_profile_photo-modified.png /image /index.html
Found on 2024-09-16 21:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: website-d17477dc.laelgia.com
Port: 443
URL: https://website-d17477dc.laelgia.comFirst seen 2024-02-20 16:35
Last seen 2024-09-16 21:31
Open for 209 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab70554525bb05d15db905a6ec70c757a3Found 7 files trough .DS_Store spidering: /contactme.html /css /experience /file /han_profile_photo-modified.png /image /index.html
Found on 2024-09-16 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-10 15:52
Last seen 2024-09-16 21:22
Open for 707 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d93a0121f93a0121f93a0121f93a0121fFound 1 files trough .DS_Store spidering: /uss
Found on 2024-09-16 21:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-09 15:28
Last seen 2024-09-16 21:18
Open for 435 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 15:53
Last seen 2024-09-16 21:00
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8383eb37bb35badd7a0de453067bd68d2Found 8 files trough .DS_Store spidering: /_mmServerScripts /_mmServerScripts/_notes /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2024-09-16 21:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: dbullmedical.windanseabeach.org
Port: 443
URL: https://dbullmedical.windanseabeach.orgFirst seen 2022-09-17 18:06
Last seen 2024-09-16 20:49
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 20:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.globalnexusinitiative.org
Port: 443
URL: https://mail.globalnexusinitiative.orgFirst seen 2022-09-17 16:35
Last seen 2024-09-16 20:49
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9f8ddd3d1865cdfaae8fdeca0777a64fbFound 5 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/gni /wp-content/themes/gni/js /wp-content/themes/gni-child
Found on 2024-09-16 20:49 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfcdac9e8c2b4b6dfc5c41e5e2b922cecd4Found 4 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/gni /wp-content/themes/gni-child
Found on 2022-11-18 17:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.collaborativemba.org
Port: 443
URL: https://www.collaborativemba.orgFirst seen 2022-09-15 15:22
Last seen 2024-09-16 20:47
Open for 732 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2024-09-16 20:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 20:39
Open for 438 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 20:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:00
Last seen 2024-09-16 20:35
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 20:35
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: www.sushiheavenpenticton.ca
Port: 443
URL: https://www.sushiheavenpenticton.caFirst seen 2023-07-06 15:31
Last seen 2024-09-16 20:30
Open for 438 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:30321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.sushiheavenpenticton.ca
Port: 443
URL: https://www.sushiheavenpenticton.caFirst seen 2023-07-06 15:31
Last seen 2024-09-16 20:30
Open for 438 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9dedb604c5edb604c5edb604c5edb604c5Found 1 files trough .DS_Store spidering: /menu
Found on 2024-09-16 20:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-02-20 16:35
Last seen 2024-09-16 20:17
Open for 209 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab70554525bb05d15db905a6ec70c757a3Found 7 files trough .DS_Store spidering: /contactme.html /css /experience /file /han_profile_photo-modified.png /image /index.html
Found on 2024-09-16 20:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:22
Last seen 2024-09-16 20:04
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 20:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.sushiheavenpenticton.laelgia.com
Port: 443
URL: https://www.sushiheavenpenticton.laelgia.comFirst seen 2023-07-23 15:42
Last seen 2024-09-16 20:00
Open for 421 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9dedb604c5edb604c5edb604c5edb604c5Found 1 files trough .DS_Store spidering: /menu
Found on 2024-09-16 20:00
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: www.sushiheavenpenticton.laelgia.com
Port: 443
URL: https://www.sushiheavenpenticton.laelgia.comFirst seen 2023-03-22 16:17
Last seen 2024-09-16 20:00
Open for 544 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 20:00321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.collaborativemba.com
Port: 443
URL: https://mail.collaborativemba.comFirst seen 2022-09-15 15:22
Last seen 2024-09-16 19:57
Open for 732 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2024-09-16 19:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.wcb.tvd.mybluehost.me
Port: 443
URL: https://www.wcb.tvd.mybluehost.meFirst seen 2024-07-21 19:41
Last seen 2024-09-16 19:55
Open for 57 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:10
Last seen 2024-09-16 19:30
Open for 716 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:30
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: sushiheavenpenticton.laelgia.com
Port: 443
URL: https://sushiheavenpenticton.laelgia.comFirst seen 2023-03-22 16:17
Last seen 2024-09-16 19:17
Open for 544 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 19:17321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: sushiheavenpenticton.laelgia.com
Port: 443
URL: https://sushiheavenpenticton.laelgia.comFirst seen 2023-07-23 15:42
Last seen 2024-09-16 19:17
Open for 421 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9dedb604c5edb604c5edb604c5edb604c5Found 1 files trough .DS_Store spidering: /menu
Found on 2024-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-05 16:35
Last seen 2024-09-16 19:05
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 19:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2024-06-01 03:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 15:53
Last seen 2024-09-16 18:19
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8383eb37bb35badd7a0de453067bd68d2Found 8 files trough .DS_Store spidering: /_mmServerScripts /_mmServerScripts/_notes /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2024-09-16 18:19 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab9ccd315693e647a7954983ef6d9aa829Found 7 files trough .DS_Store spidering: /_mmServerScripts /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2024-06-12 19:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: test.sushiheavenpenticton.ca
Port: 443
URL: https://test.sushiheavenpenticton.caFirst seen 2024-06-08 09:27
Last seen 2024-09-16 18:14
Open for 100 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c20f30ab920f30ab924fed7fab2881a2837c83c6458844c32Found 67 files trough .DS_Store spidering: /400.shtml /401.shtml /403.shtml /404.shtml /405.shtml /406.shtml /500.shtml /appetizers.html /combo1.html /css /css/DINPro.eot /css/DINPro.ttf /css/DINPro.woff /css/DS_Store /css/style.css /css/stylesheet.css /DS_Store /ftpquota /hplogo.gif /htaccess /img /img/backup_takeout_bg1.png /img/bhours.png /img/delivery.png /img/DS_Store /img/hours.png /img/katsu.pdf /img/katsu.png /img/lights.png /img/logo.png /img/main_bg.jpg /img/main_bg.png /img/main_bg1.png /img/maps.png /img/menu_appe.png /img/menu_box.png /img/menu_combo.png /img/menu_nigiri.png /img/menu_party.png /img/menu_roll.png /img/menu_spc.png /img/menu_tempura.png /img/menu_udon.png /img/rocket.png /img/sideWall.JPG /img/takeout_bg.png /img/takeout_bg1.png /index.html /index_setting.html /js /js/DS_Store /js/jquery-2.1.1.min.js /js/jquery-ui.min.js /js/jquery.easing.1.3.js /js/section.js /lunch1.html /menu /nigiri1.html /package-lock.json /party1.html /roll1.html /SHall1.html /spc1.html /takeout.html /TakeOutMenu /tempura1.html /udon1.html
Found on 2024-09-16 18:14 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c8efce1938efce1936cc520e037562a82074b0bd68a4900edFound 36 files trough .DS_Store spidering: /400.shtml /401.shtml /403.shtml /404.shtml /405.shtml /406.shtml /500.shtml /appetizers.html /combo1.html /css /css/DINPro.eot /css/DINPro.ttf /css/DINPro.woff /css/DS_Store /css/style.css /css/stylesheet.css /DS_Store /ftpquota /hplogo.gif /htaccess /img /index.html /index_setting.html /js /lunch1.html /menu /nigiri1.html /package-lock.json /party1.html /roll1.html /SHall1.html /spc1.html /takeout.html /TakeOutMenu /tempura1.html /udon1.html
Found on 2024-08-18 19:44
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: test.sushiheavenpenticton.ca
Port: 443
URL: https://test.sushiheavenpenticton.caFirst seen 2023-05-04 15:27
Last seen 2024-09-16 18:14
Open for 501 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 18:14321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-10 15:52
Last seen 2024-09-16 18:11
Open for 707 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d93a0121f93a0121f93a0121f93a0121fFound 1 files trough .DS_Store spidering: /uss
Found on 2024-09-16 18:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 18:01
Open for 438 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 18:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:07
Last seen 2024-09-16 18:00
Open for 716 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 18:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:08
Last seen 2024-09-16 17:46
Open for 716 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 17:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-02-20 16:35
Last seen 2024-09-16 17:43
Open for 209 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab70554525bb05d15db905a6ec70c757a3Found 7 files trough .DS_Store spidering: /contactme.html /css /experience /file /han_profile_photo-modified.png /image /index.html
Found on 2024-09-16 17:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.dbullmedical.windanseabeach.org
Port: 443
URL: https://www.dbullmedical.windanseabeach.orgFirst seen 2022-09-17 18:06
Last seen 2024-09-16 16:56
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 16:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 15:53
Last seen 2024-09-16 16:26
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8383eb37bb35badd7a0de453067bd68d2Found 8 files trough .DS_Store spidering: /_mmServerScripts /_mmServerScripts/_notes /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2024-09-16 16:26 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab9ccd315693e647a7954983ef6d9aa829Found 7 files trough .DS_Store spidering: /_mmServerScripts /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2024-05-12 20:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-18 17:29
Last seen 2024-09-16 16:02
Open for 667 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 16:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: hhfurnitureanddesign.com
Port: 443
URL: https://hhfurnitureanddesign.comFirst seen 2022-09-17 16:04
Last seen 2024-09-16 15:54
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f90296a02fa219c8c41462b253601319eFound 10 files trough .DS_Store spidering: /.well-known /_arch /_notes /assets /cgi-bin /css /home /img /js /pfp
Found on 2024-09-16 15:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.dreamcatcherflyfishing.com
Port: 443
URL: https://mail.dreamcatcherflyfishing.comFirst seen 2022-09-17 15:36
Last seen 2024-09-16 15:19
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f78ca2d18f4Found 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/amazing-hover-effects /wp-content/plugins/backupbuddy /wp-content/plugins/divi-builder /wp-content/plugins/easy-google-fonts /wp-content/plugins/image-hover-effects /wp-content/plugins/typekit-fonts-for-wordpress /wp-content/plugins/use-any-font /wp-content/themes /wp-content/themes/Divi /wp-content/themes/twentyseventeen /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 15:19 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e45073132ae6db8bf60d929ab4ab9e02574Found 30 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/amazing-hover-effects /wp-content/plugins/backupbuddy /wp-content/plugins/divi-builder /wp-content/plugins/easy-google-fonts /wp-content/plugins/image-hover-effects /wp-content/plugins/typekit-fonts-for-wordpress /wp-content/plugins/use-any-font /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 06:26 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02d792a79d6214e72fea6bd981af8caae7Found 24 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/Divi /wp-content/themes/twentyseventeen /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-06 06:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b1106b0bf7be6fe1adFound 22 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-17 15:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:22
Last seen 2024-09-16 15:19
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 15:19
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-07-06 15:31
Last seen 2024-09-16 15:16
Open for 437 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 15:16321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:31
Last seen 2024-09-16 15:16
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9dedb604c5edb604c5edb604c5edb604c5Found 1 files trough .DS_Store spidering: /menu
Found on 2024-09-16 15:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 15:07
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 15:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-21 19:09
Last seen 2024-09-16 13:51
Open for 56 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 13:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.collaborativemba.org
Port: 443
URL: https://mail.collaborativemba.orgFirst seen 2022-09-15 15:22
Last seen 2024-09-16 13:51
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2024-09-16 13:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:00
Last seen 2024-09-16 13:50
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 13:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 13:50
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 13:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: website-d17477dc.laelgia.com
Port: 80
URL: http://website-d17477dc.laelgia.comFirst seen 2024-02-20 16:35
Last seen 2024-09-16 13:40
Open for 208 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab70554525bb05d15db905a6ec70c757a3Found 7 files trough .DS_Store spidering: /contactme.html /css /experience /file /han_profile_photo-modified.png /image /index.html
Found on 2024-09-16 13:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-10 15:52
Last seen 2024-09-16 13:36
Open for 706 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d93a0121f93a0121f93a0121f93a0121fFound 1 files trough .DS_Store spidering: /uss
Found on 2024-09-16 13:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:10
Last seen 2024-09-16 12:56
Open for 715 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 12:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:57
Last seen 2024-09-16 12:53
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772d31b6ab02f1e3df22e9b5810e3736b23Found 11 files trough .DS_Store spidering: /Climbing.mp3 /DigitalAge.mp3 /DogNose.mp3 /Gimme your Money.mp3 /Guarateed Mystery.mp3 /lanscape2_ThisOne.mp3 /old mic.jpg /Sanibel_3b.mp3 /Say Goodbye.mp3 /Seattle Snow Day.mp3 /TimeforTea.mp3
Found on 2024-09-16 12:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.globalnexusinitiative.org
Port: 443
URL: https://www.globalnexusinitiative.orgFirst seen 2022-09-17 16:35
Last seen 2024-09-16 12:41
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9f8ddd3d1865cdfaae8fdeca0777a64fbFound 5 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/gni /wp-content/themes/gni/js /wp-content/themes/gni-child
Found on 2024-09-16 12:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.website-d17477dc.laelgia.com
Port: 80
URL: http://www.website-d17477dc.laelgia.comFirst seen 2024-02-20 16:35
Last seen 2024-09-16 12:36
Open for 208 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab70554525bb05d15db905a6ec70c757a3Found 7 files trough .DS_Store spidering: /contactme.html /css /experience /file /han_profile_photo-modified.png /image /index.html
Found on 2024-09-16 12:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.sushiheavenpenticton.ca
Port: 443
URL: https://mail.sushiheavenpenticton.caFirst seen 2023-07-06 15:31
Last seen 2024-09-16 12:26
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9dedb604c5edb604c5edb604c5edb604c5Found 1 files trough .DS_Store spidering: /menu
Found on 2024-09-16 12:26
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: mail.sushiheavenpenticton.ca
Port: 443
URL: https://mail.sushiheavenpenticton.caFirst seen 2023-07-06 15:31
Last seen 2024-09-16 12:26
Open for 437 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 12:26321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:00
Last seen 2024-09-16 12:19
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 12:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.hhfurnitureanddesign.com
Port: 443
URL: https://mail.hhfurnitureanddesign.comFirst seen 2022-09-17 16:04
Last seen 2024-09-16 11:54
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f90296a02fa219c8c41462b253601319eFound 10 files trough .DS_Store spidering: /.well-known /_arch /_notes /assets /cgi-bin /css /home /img /js /pfp
Found on 2024-09-16 11:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:46
Last seen 2024-09-16 10:36
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 10:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 16:35
Last seen 2024-09-16 09:27
Open for 604 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 09:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-21 19:09
Last seen 2024-09-16 09:09
Open for 56 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 09:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.fairmount-heights-org.ronhalbertproductions.com
Port: 443
URL: https://www.fairmount-heights-org.ronhalbertproductions.comFirst seen 2022-09-17 17:21
Last seen 2024-09-16 08:47
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 08:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.fairmount-heights.org
Port: 443
URL: https://mail.fairmount-heights.orgFirst seen 2022-09-17 17:20
Last seen 2024-09-16 08:47
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 08:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.collaborativemba.com
Port: 443
URL: https://www.collaborativemba.comFirst seen 2022-09-15 15:22
Last seen 2024-09-16 08:43
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2024-09-16 08:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:20
Last seen 2024-09-16 08:29
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 08:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: dreamcatcherflyfishing.com
Port: 443
URL: https://dreamcatcherflyfishing.comFirst seen 2022-09-17 15:36
Last seen 2024-09-16 07:57
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f78ca2d18f4Found 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/amazing-hover-effects /wp-content/plugins/backupbuddy /wp-content/plugins/divi-builder /wp-content/plugins/easy-google-fonts /wp-content/plugins/image-hover-effects /wp-content/plugins/typekit-fonts-for-wordpress /wp-content/plugins/use-any-font /wp-content/themes /wp-content/themes/Divi /wp-content/themes/twentyseventeen /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 07:57 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e45073132ae6db8bf60d929ab4ab9e02574Found 30 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/amazing-hover-effects /wp-content/plugins/backupbuddy /wp-content/plugins/divi-builder /wp-content/plugins/easy-google-fonts /wp-content/plugins/image-hover-effects /wp-content/plugins/typekit-fonts-for-wordpress /wp-content/plugins/use-any-font /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-10 10:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b1106b0bf7be6fe1adFound 22 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-18 16:58 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57acbfd613553305d87f586daf9e069311aFound 19 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-17 15:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: fairmount-heights-org.ronhalbertproductions.com
Port: 443
URL: https://fairmount-heights-org.ronhalbertproductions.comFirst seen 2022-09-17 17:20
Last seen 2024-09-16 07:53
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 07:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.wcb.tvd.mybluehost.me
Port: 443
URL: https://mail.wcb.tvd.mybluehost.meFirst seen 2024-07-21 19:41
Last seen 2024-09-16 07:42
Open for 56 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 07:42
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 16:35
Last seen 2024-09-16 06:59
Open for 604 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 06:59 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 16:35
Last seen 2024-09-16 06:48
Open for 604 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 06:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: leesoverseas.laelgia.com
Port: 443
URL: https://leesoverseas.laelgia.comFirst seen 2023-01-20 16:35
Last seen 2024-09-16 06:10
Open for 604 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 06:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-05 16:35
Last seen 2024-09-16 05:50
Open for 619 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 05:50 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2024-05-30 18:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.hhfurnitureanddesign.com
Port: 443
URL: https://www.hhfurnitureanddesign.comFirst seen 2022-09-17 16:04
Last seen 2024-09-16 05:46
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f90296a02fa219c8c41462b253601319eFound 10 files trough .DS_Store spidering: /.well-known /_arch /_notes /assets /cgi-bin /css /home /img /js /pfp
Found on 2024-09-16 05:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.dreamcatcherflyfishing.com
Port: 443
URL: https://www.dreamcatcherflyfishing.comFirst seen 2022-09-17 15:36
Last seen 2024-09-16 05:46
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f78ca2d18f4Found 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/amazing-hover-effects /wp-content/plugins/backupbuddy /wp-content/plugins/divi-builder /wp-content/plugins/easy-google-fonts /wp-content/plugins/image-hover-effects /wp-content/plugins/typekit-fonts-for-wordpress /wp-content/plugins/use-any-font /wp-content/themes /wp-content/themes/Divi /wp-content/themes/twentyseventeen /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 05:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e45073132ae6db8bf60d929ab4ab9e02574Found 30 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/amazing-hover-effects /wp-content/plugins/backupbuddy /wp-content/plugins/divi-builder /wp-content/plugins/easy-google-fonts /wp-content/plugins/image-hover-effects /wp-content/plugins/typekit-fonts-for-wordpress /wp-content/plugins/use-any-font /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-05-30 02:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b1106b0bf7be6fe1adFound 22 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-18 16:58 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57acbfd613553305d87f586daf9e069311aFound 19 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-17 15:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-21 19:09
Last seen 2024-09-16 05:41
Open for 56 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 05:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.fairmount-heights.org
Port: 443
URL: https://www.fairmount-heights.orgFirst seen 2022-09-17 17:20
Last seen 2024-09-16 05:40
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 05:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-21 19:22
Last seen 2024-09-16 05:39
Open for 56 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 05:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:08
Last seen 2024-09-16 05:33
Open for 715 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 05:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 15:22
Last seen 2024-09-16 05:28
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2024-09-16 05:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 04:24
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 04:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 04:24
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 04:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 04:24
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 04:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.leesoverseas.laelgia.com
Port: 443
URL: https://www.leesoverseas.laelgia.comFirst seen 2023-01-20 16:35
Last seen 2024-09-16 04:07
Open for 604 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 04:07 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 03:35
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 03:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-01 17:10
Last seen 2024-09-16 02:31
Open for 654 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 02:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:10
Last seen 2024-09-16 02:17
Open for 715 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 02:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: globalnexusinitiative.org
Port: 443
URL: https://globalnexusinitiative.orgFirst seen 2022-09-17 16:35
Last seen 2024-09-16 02:14
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9f8ddd3d1865cdfaae8fdeca0777a64fbFound 5 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/gni /wp-content/themes/gni/js /wp-content/themes/gni-child
Found on 2024-09-16 02:14 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-07-26 21:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.sushiheavenpenticton-ca.laelgia.com
Port: 443
URL: https://www.sushiheavenpenticton-ca.laelgia.comFirst seen 2023-07-06 15:31
Last seen 2024-09-16 02:01
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9dedb604c5edb604c5edb604c5edb604c5Found 1 files trough .DS_Store spidering: /menu
Found on 2024-09-16 02:01
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: www.sushiheavenpenticton-ca.laelgia.com
Port: 443
URL: https://www.sushiheavenpenticton-ca.laelgia.comFirst seen 2023-07-06 15:31
Last seen 2024-09-16 02:01
Open for 437 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 02:01321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: sushiheavenpenticton-ca.laelgia.com
Port: 443
URL: https://sushiheavenpenticton-ca.laelgia.comFirst seen 2023-07-06 15:31
Last seen 2024-09-16 01:50
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9dedb604c5edb604c5edb604c5edb604c5Found 1 files trough .DS_Store spidering: /menu
Found on 2024-09-16 01:50
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: sushiheavenpenticton-ca.laelgia.com
Port: 443
URL: https://sushiheavenpenticton-ca.laelgia.comFirst seen 2023-07-06 15:31
Last seen 2024-09-16 01:50
Open for 437 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 01:50321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-06 15:32
Last seen 2024-09-16 00:32
Open for 437 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 00:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-09 15:28
Last seen 2024-09-16 00:29
Open for 434 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-09-16 00:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.wcb.tvd.mybluehost.me
Port: 80
URL: http://www.wcb.tvd.mybluehost.meFirst seen 2024-07-21 19:41
Last seen 2024-09-14 05:22
Open for 54 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 05:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-28 08:40
Last seen 2024-09-13 00:12
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70eeb6df914aef33bfc141ae491577833fFound 26 files trough .DS_Store spidering: /apexcharts.min.js /assets /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-13 00:12 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cfdf2c773fdf2c77349cdef4bfadef40079486edb8b1fa602Found 50 files trough .DS_Store spidering: /app /artisan /bootstrap /composer.json /composer.lock /config /database /package.json /phpunit.xml /public /public/apexcharts.min.js /public/assets /public/assets/vendor_components /public/assets/vendor_components/flat-color-icons /public/assets/vendor_components/Ionicons /public/assetsweb /public/audio /public/Crypto.php /public/css /public/dispatcher /public/dist /public/docs /public/favicon.ico /public/firebase-database.json /public/fusioncharts.charts.js /public/fusioncharts.theme.fusion.js /public/images /public/index.php /public/invoice /public/js /public/map /public/mix-manifest.json /public/plugins /public/push-configurations /public/robots.txt /public/svg /public/taxi /public/vendor /public/web.config /README.md /resources /routes /server.php /storage /svg_for_booking_confirmation.txt /tests /true, /webbooking-apis.txt /webpack.mix.js /worker.log
Found on 2024-09-06 20:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb3a54194de4daebc5a35046c0610e4131aFound 29 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-04 18:13 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b0481dcbc2d8cc0089b04e2873daed47b14Found 53 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /images/7efs.mp4 /images/Accept_ride.gif /images/android-manual /images/automatic cancellation.gif /images/cancellation.png /images/cancelled.png /images/confirmation.gif /images/country /images/DELIVERY.png /images/email /images/flutter-doc /images/Group 208.png /images/loader.gif /images/no-drivers.png /images/owner-acc /images/pay.jpg /images/RENTAL.png /images/ride search.gif /images/success.jpeg /images/taxi.gif /images/TAXI.png /images/track.jpg /images/track1.jpg /images/user-manual-docs /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-03 23:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a87ad063bcee53e15d2212b42a326de68Found 19 files trough .DS_Store spidering: /.htaccess /admin_assets /bootstrap /css /error_log /favicon.ico /font /images /index.php /js /key.txt /key_backup.txt /readme /robots.txt /static /theme /trip_file /vendor /web.config
Found on 2024-08-18 12:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-28 08:44
Last seen 2024-09-12 11:53
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70eeb6df914aef33bfc141ae491577833fFound 26 files trough .DS_Store spidering: /apexcharts.min.js /assets /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-12 11:53 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b0481dcbc2d8cc0089b04e2873daed47b14Found 53 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /images/7efs.mp4 /images/Accept_ride.gif /images/android-manual /images/automatic cancellation.gif /images/cancellation.png /images/cancelled.png /images/confirmation.gif /images/country /images/DELIVERY.png /images/email /images/flutter-doc /images/Group 208.png /images/loader.gif /images/no-drivers.png /images/owner-acc /images/pay.jpg /images/RENTAL.png /images/ride search.gif /images/success.jpeg /images/taxi.gif /images/TAXI.png /images/track.jpg /images/track1.jpg /images/user-manual-docs /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-04 08:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb3a54194de4daebc5a35046c0610e4131aFound 29 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-04 01:52 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d4047824dd98b68d1085437bf56f05c6db970bf6Found 35 files trough .DS_Store spidering: /.htaccess /assets /assets/images /assets/images/alert /assets/images/background /assets/images/big /assets/images/browser /assets/images/custom-select.png /assets/images/document /assets/images/favicon.png /assets/images/gallery /assets/images/icon /assets/images/logo-icon.png /assets/images/logo-light-icon.png /assets/images/logo-light-text.png /assets/images/logo-text.png /assets/images/logo.png /assets/images/logo2.png /assets/images/manage.svg /assets/images/password-forgot.svg /assets/images/password-reset.svg /assets/images/password-verify.svg /assets/images/tooltip /assets/images/users /assets/plugins /css /favicon.ico /icons /images /index.php /js /mix-manifest.json /robots.txt /scss /web.config
Found on 2024-08-20 05:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a87ad063bcee53e15d2212b42a326de68Found 19 files trough .DS_Store spidering: /.htaccess /admin_assets /bootstrap /css /error_log /favicon.ico /font /images /index.php /js /key.txt /key_backup.txt /readme /robots.txt /static /theme /trip_file /vendor /web.config
Found on 2024-08-18 07:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.szf.rxg.mybluehost.me
Port: 443
URL: https://mail.szf.rxg.mybluehost.meFirst seen 2024-07-28 06:29
Last seen 2024-09-12 10:58
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70eeb6df914aef33bfc141ae491577833fFound 26 files trough .DS_Store spidering: /apexcharts.min.js /assets /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-12 10:58 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cfdf2c773fdf2c77349cdef4bfadef40079486edb8b1fa602Found 50 files trough .DS_Store spidering: /app /artisan /bootstrap /composer.json /composer.lock /config /database /package.json /phpunit.xml /public /public/apexcharts.min.js /public/assets /public/assets/vendor_components /public/assets/vendor_components/flat-color-icons /public/assets/vendor_components/Ionicons /public/assetsweb /public/audio /public/Crypto.php /public/css /public/dispatcher /public/dist /public/docs /public/favicon.ico /public/firebase-database.json /public/fusioncharts.charts.js /public/fusioncharts.theme.fusion.js /public/images /public/index.php /public/invoice /public/js /public/map /public/mix-manifest.json /public/plugins /public/push-configurations /public/robots.txt /public/svg /public/taxi /public/vendor /public/web.config /README.md /resources /routes /server.php /storage /svg_for_booking_confirmation.txt /tests /true, /webbooking-apis.txt /webpack.mix.js /worker.log
Found on 2024-09-06 16:22 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb3a54194de4daebc5a35046c0610e4131aFound 29 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-04 17:31 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b0481dcbc2d8cc0089b04e2873daed47b14Found 53 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /images/7efs.mp4 /images/Accept_ride.gif /images/android-manual /images/automatic cancellation.gif /images/cancellation.png /images/cancelled.png /images/confirmation.gif /images/country /images/DELIVERY.png /images/email /images/flutter-doc /images/Group 208.png /images/loader.gif /images/no-drivers.png /images/owner-acc /images/pay.jpg /images/RENTAL.png /images/ride search.gif /images/success.jpeg /images/taxi.gif /images/TAXI.png /images/track.jpg /images/track1.jpg /images/user-manual-docs /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-03 23:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525de59a471cb26fa52c015b40447a53b6aeFound 27 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-02 02:05 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cfdf2c773fdf2c77377cd791e2a78011ad017629c37e2f02fFound 50 files trough .DS_Store spidering: /apexcharts.min.js /assets /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /images/7efs.mp4 /images/Accept_ride.gif /images/android-manual /images/automatic cancellation.gif /images/cancellation.png /images/cancelled.png /images/confirmation.gif /images/country /images/DELIVERY.png /images/email /images/flutter-doc /images/Group 208.png /images/loader.gif /images/no-drivers.png /images/owner-acc /images/pay.jpg /images/RENTAL.png /images/ride search.gif /images/success.jpeg /images/taxi.gif /images/TAXI.png /images/track.jpg /images/track1.jpg /images/user-manual-docs /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-08-27 23:35 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a87ad063bcee53e15d2212b42a326de68Found 19 files trough .DS_Store spidering: /.htaccess /admin_assets /bootstrap /css /error_log /favicon.ico /font /images /index.php /js /key.txt /key_backup.txt /readme /robots.txt /static /theme /trip_file /vendor /web.config
Found on 2024-08-18 05:18 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c5a2cc21a5a2cc21a725d1b5cdbec44042403ee00f0c4947aFound 82 files trough .DS_Store spidering: /.editorconfig /.env /.env.example /.git /.gitattributes /.gitignore /.htaccess /.styleci.yml /app /app/Api.php /app/Bonus.php /app/BonusConducteur.php /app/CashPlan.php /app/CategorieUser.php /app/CategorieVehicule.php /app/Client.php /app/ClientWallet.php /app/Commande.php /app/CommandeAnnulee.php /app/CommandeAttente.php /app/CommandeDetail.php /app/CommandeTraitee.php /app/Commission.php /app/CommissionType.php /app/Conducteur.php /app/ConducteurCashPlan.php /app/ConducteurRating.php /app/ConducteurVehicule.php /app/Console /app/Coupon.php /app/CouponClient.php /app/Donateur.php /app/DriverType.php /app/Events /app/Exceptions /app/Favoris.php /app/FavorisTrajet.php /app/GestionUsersClient.php /app/Http /app/Http/Controllers /app/Http/Kernel.php /app/Http/Middleware /app/LangueParDefaut.php /app/MapKey.php /app/MelBet.php /app/MelBetTransaction.php /app/MinCost.php /app/MonApplication.php /app/NbRide.php /app/Notification.php /app/OrderType.php /app/PhoneNumberPrefix.php /app/Providers /app/SocketClient.php /app/StatistiquesClient.php /app/Token.php /app/Traits /app/Trajet.php /app/Transaction.php /app/User.php /app/UserClient.php /app/WalletTransaction.php /artisan /bootstrap /composer.json /composer.lock /config /database /laravel-echo-server.json /NodeJS /package-lock.json /package.json /phpunit.xml /public /README.md /resources /routes /server.php /storage /tests /vendor /webpack.mix.js
Found on 2024-08-08 02:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-28 04:40
Last seen 2024-09-12 02:17
Open for 45 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b70eeb6df914aef33bfc141ae491577833fFound 26 files trough .DS_Store spidering: /apexcharts.min.js /assets /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-12 02:17 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cecc85b04ecc85b0481dcbc2d8cc0089b04e2873daed47b14Found 53 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /images/7efs.mp4 /images/Accept_ride.gif /images/android-manual /images/automatic cancellation.gif /images/cancellation.png /images/cancelled.png /images/confirmation.gif /images/country /images/DELIVERY.png /images/email /images/flutter-doc /images/Group 208.png /images/loader.gif /images/no-drivers.png /images/owner-acc /images/pay.jpg /images/RENTAL.png /images/ride search.gif /images/success.jpeg /images/taxi.gif /images/TAXI.png /images/track.jpg /images/track1.jpg /images/user-manual-docs /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-04 02:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb3a54194de4daebc5a35046c0610e4131aFound 29 files trough .DS_Store spidering: /apexcharts.min.js /assets /assets/vendor_components /assets/vendor_components/flat-color-icons /assets/vendor_components/Ionicons /assetsweb /audio /Crypto.php /css /dispatcher /dist /docs /favicon.ico /firebase-database.json /fusioncharts.charts.js /fusioncharts.theme.fusion.js /images /index.php /invoice /js /map /mix-manifest.json /plugins /push-configurations /robots.txt /svg /taxi /vendor /web.config
Found on 2024-09-04 00:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a87ad063bcee53e15d2212b42a326de68Found 19 files trough .DS_Store spidering: /.htaccess /admin_assets /bootstrap /css /error_log /favicon.ico /font /images /index.php /js /key.txt /key_backup.txt /readme /robots.txt /static /theme /trip_file /vendor /web.config
Found on 2024-08-18 02:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.wcb.tvd.mybluehost.me
Port: 80
URL: http://mail.wcb.tvd.mybluehost.meFirst seen 2024-07-21 19:41
Last seen 2024-09-12 01:22
Open for 52 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-12 01:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-21 19:22
Last seen 2024-09-10 07:41
Open for 50 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-10 07:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-07-21 19:09
Last seen 2024-09-06 15:53
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-06 15:53
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2024-08-08 11:32
Last seen 2024-08-20 10:55
Open for 11 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522edbd3fa9[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = softstrikers@vs-ssh.visualstudio.com:v3/softstrikers/All_in_one/All_in_one fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-08-20 10:55299 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:35
Last seen 2024-07-25 13:00
Open for 676 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2024-07-25 13:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:35
Last seen 2024-07-25 13:00
Open for 676 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2024-07-25 13:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:35
Last seen 2024-07-25 13:00
Open for 676 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2024-07-25 13:00
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: www.meeting.integratests.com
Port: 443
URL: https://www.meeting.integratests.comFirst seen 2022-08-12 15:50
Last seen 2024-06-30 16:31
Open for 688 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65225ff0ad65[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://team-1601610915009-admin@bitbucket.org/team-1601610915009-admin/video-communication.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "feature/VC-4-integrate-zoom-in-web-for-video-com"] remote = origin merge = refs/heads/feature/VC-4-integrate-zoom-in-web-for-video-com
Found on 2024-06-30 16:31511 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.meeting.integratests.com
Port: 443
URL: https://www.meeting.integratests.comFirst seen 2022-10-12 15:53
Last seen 2024-06-30 16:31
Open for 627 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc51fa561cca5bd8c5e8a308fd207566baFound 4 files trough .DS_Store spidering: /css /images /js /vendor
Found on 2024-06-30 16:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: meeting.integratests.com
Port: 443
URL: https://meeting.integratests.comFirst seen 2022-10-12 15:53
Last seen 2024-06-30 11:57
Open for 626 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc51fa561cca5bd8c5e8a308fd207566baFound 4 files trough .DS_Store spidering: /css /images /js /vendor
Found on 2024-06-30 11:57
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: meeting.integratests.com
Port: 443
URL: https://meeting.integratests.comFirst seen 2022-08-12 15:50
Last seen 2024-06-30 11:57
Open for 687 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65225ff0ad65[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://team-1601610915009-admin@bitbucket.org/team-1601610915009-admin/video-communication.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "feature/VC-4-integrate-zoom-in-web-for-video-com"] remote = origin merge = refs/heads/feature/VC-4-integrate-zoom-in-web-for-video-com
Found on 2024-06-30 11:57511 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.test.leesoverseas.com
Port: 443
URL: https://www.test.leesoverseas.comFirst seen 2023-01-25 16:31
Last seen 2024-06-24 17:15
Open for 516 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-06-24 17:15 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-03-28 15:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772a068f0c57630eb598339c6c59da46842Found 11 files trough .DS_Store spidering: /asset-manifest.json /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt /static /static/css /static/js /static/media
Found on 2023-01-25 16:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-25 16:31
Last seen 2024-06-24 16:58
Open for 516 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-06-24 16:58 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-03-28 15:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772a068f0c57630eb598339c6c59da46842Found 11 files trough .DS_Store spidering: /asset-manifest.json /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt /static /static/css /static/js /static/media
Found on 2023-01-25 16:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.leesoverseas-net.laelgia.com
Port: 443
URL: https://www.leesoverseas-net.laelgia.comFirst seen 2023-01-21 16:32
Last seen 2024-06-24 15:01
Open for 519 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-06-24 15:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-21 16:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: leesoverseas-net.laelgia.com
Port: 443
URL: https://leesoverseas-net.laelgia.comFirst seen 2023-01-21 16:32
Last seen 2024-06-24 14:14
Open for 519 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2024-06-24 14:14 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-21 16:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:46
Last seen 2024-05-08 18:38
Open for 599 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-05-08 18:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:46
Last seen 2024-05-08 17:20
Open for 599 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-05-08 17:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.qio.hsj.mybluehost.me
Port: 80
URL: http://www.qio.hsj.mybluehost.meFirst seen 2024-03-15 19:28
Last seen 2024-05-01 00:40
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-05-01 00:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-15 19:19
Last seen 2024-04-30 23:51
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-04-30 23:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.qio.hsj.mybluehost.me
Port: 443
URL: https://mail.qio.hsj.mybluehost.meFirst seen 2024-03-15 19:28
Last seen 2024-04-30 23:33
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-04-30 23:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.qio.hsj.mybluehost.me
Port: 80
URL: http://mail.qio.hsj.mybluehost.meFirst seen 2024-03-15 19:28
Last seen 2024-04-30 21:45
Open for 46 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-04-30 21:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.qio.hsj.mybluehost.me
Port: 443
URL: https://www.qio.hsj.mybluehost.meFirst seen 2024-03-15 19:28
Last seen 2024-04-28 23:43
Open for 44 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-04-28 23:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.fairmount-heights.org
Port: 80
URL: http://mail.fairmount-heights.orgFirst seen 2022-09-17 17:20
Last seen 2023-09-23 15:44
Open for 370 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2022-09-17 17:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.fairmount-heights.org
Port: 80
URL: http://www.fairmount-heights.orgFirst seen 2022-09-17 17:20
Last seen 2023-09-23 15:44
Open for 370 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2022-09-17 17:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:20
Last seen 2023-09-23 15:44
Open for 370 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2022-09-17 17:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: fairmount-heights-org.ronhalbertproductions.com
Port: 80
URL: http://fairmount-heights-org.ronhalbertproductions.comFirst seen 2022-09-17 17:20
Last seen 2023-09-23 15:44
Open for 370 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2022-09-17 17:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.fairmount-heights-org.ronhalbertproductions.com
Port: 80
URL: http://www.fairmount-heights-org.ronhalbertproductions.comFirst seen 2022-09-17 17:21
Last seen 2023-09-23 15:44
Open for 370 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2022-09-17 17:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 16:35
Last seen 2023-09-22 15:44
Open for 244 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-07-23 15:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 16:35
Last seen 2023-09-22 15:44
Open for 244 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-07-23 15:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.leesoverseas.laelgia.com
Port: 80
URL: http://www.leesoverseas.laelgia.comFirst seen 2023-01-20 16:35
Last seen 2023-09-22 15:44
Open for 244 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-07-23 15:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 16:35
Last seen 2023-09-22 15:44
Open for 244 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-07-23 15:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 16:35
Last seen 2023-09-22 15:44
Open for 244 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e98b84c9b5c7ecc8e4ac2f80d520e4480dFound 5 files trough .DS_Store spidering: /favicon.ico /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-07-23 15:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814eae693cfaec557ab0ec9827152e778b6eFound 6 files trough .DS_Store spidering: /favicon.ico /index.html /logo192.png /logo512.png /manifest.json /robots.txt
Found on 2023-01-20 16:35
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: test.sushiheavenpenticton.ca
Port: 80
URL: http://test.sushiheavenpenticton.caFirst seen 2023-05-04 15:27-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-05-04 15:27321 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: www.test.sushiheavenpenticton.ca
Port: 80
URL: http://www.test.sushiheavenpenticton.caFirst seen 2023-05-04 15:27-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522ca95f64e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/s2curitydev/sushiheavenpenticton.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-05-04 15:27321 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:08
Last seen 2023-04-03 15:37
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-01 16:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-01 17:10
Last seen 2023-04-03 15:37
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-01 17:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-18 17:29
Last seen 2023-03-22 16:17
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-18 17:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.homesickandwestbound.com
Port: 443
URL: https://mail.homesickandwestbound.comFirst seen 2023-03-21 15:33-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2023-03-21 15:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.homesickandwestbound.com
Port: 443
URL: https://www.homesickandwestbound.comFirst seen 2022-11-18 17:11
Last seen 2023-03-21 15:33
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-18 17:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: homesickandwestbound.com
Port: 443
URL: https://homesickandwestbound.comFirst seen 2023-03-21 15:33-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2023-03-21 15:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:08
Last seen 2023-01-31 16:37
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-01 16:08
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:06
Last seen 2023-01-31 16:37
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-01 16:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:07
Last seen 2023-01-31 16:34
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9daa09a258aa09a258aa09a258aa09a258Found 1 files trough .DS_Store spidering: /sugarrushproductions
Found on 2022-10-01 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:07
Last seen 2023-01-31 16:34
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9daa09a258aa09a258aa09a258aa09a258Found 1 files trough .DS_Store spidering: /sugarrushproductions
Found on 2022-10-01 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:07
Last seen 2023-01-31 16:34
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9daa09a258aa09a258aa09a258aa09a258Found 1 files trough .DS_Store spidering: /sugarrushproductions
Found on 2022-10-01 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 15:53
Last seen 2023-01-20 17:02
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8383eb37bb35badd7a0de453067bd68d2Found 8 files trough .DS_Store spidering: /_mmServerScripts /_mmServerScripts/_notes /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2022-09-18 15:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 15:53
Last seen 2023-01-20 17:02
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8383eb37bb35badd7a0de453067bd68d2Found 8 files trough .DS_Store spidering: /_mmServerScripts /_mmServerScripts/_notes /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2022-09-18 15:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 15:53
Last seen 2023-01-20 17:02
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab9ccd315693e647a7954983ef6d9aa829Found 7 files trough .DS_Store spidering: /_mmServerScripts /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2023-01-20 17:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8383eb37bb35badd7a0de453067bd68d2Found 8 files trough .DS_Store spidering: /_mmServerScripts /_mmServerScripts/_notes /_notes /Admin /Connections /Images /Seasons /SpryAssets
Found on 2022-09-18 15:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:57
Last seen 2023-01-19 18:19
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772d31b6ab02f1e3df22e9b5810e3736b23Found 11 files trough .DS_Store spidering: /Climbing.mp3 /DigitalAge.mp3 /DogNose.mp3 /Gimme your Money.mp3 /Guarateed Mystery.mp3 /lanscape2_ThisOne.mp3 /old mic.jpg /Sanibel_3b.mp3 /Say Goodbye.mp3 /Seattle Snow Day.mp3 /TimeforTea.mp3
Found on 2022-09-17 17:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:00
Last seen 2023-01-19 18:19
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-17 18:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:00
Last seen 2023-01-19 18:19
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-17 18:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:00
Last seen 2023-01-19 18:19
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-17 18:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:22
Last seen 2023-01-19 18:08
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 17:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:21
Last seen 2023-01-19 18:08
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 17:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 17:22
Last seen 2023-01-19 18:08
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 17:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:46
Last seen 2023-01-19 17:40
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 16:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:46
Last seen 2023-01-19 17:40
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 16:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:46
Last seen 2023-01-19 17:40
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 16:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:35
Last seen 2023-01-19 16:50
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-17 15:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:35
Last seen 2023-01-19 16:50
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-17 15:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:35
Last seen 2023-01-19 16:50
Open for 124 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-17 15:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: dbullmedical.windanseabeach.org
Port: 80
URL: http://dbullmedical.windanseabeach.orgFirst seen 2022-09-17 18:06
Last seen 2023-01-18 17:16
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.dbullmedical.windanseabeach.org
Port: 80
URL: http://www.dbullmedical.windanseabeach.orgFirst seen 2022-09-17 18:06
Last seen 2023-01-18 17:16
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:04
Last seen 2023-01-18 16:46
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f90296a02fa219c8c41462b253601319eFound 10 files trough .DS_Store spidering: /.well-known /_arch /_notes /assets /cgi-bin /css /home /img /js /pfp
Found on 2022-09-17 16:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.hhfurnitureanddesign.com
Port: 80
URL: http://mail.hhfurnitureanddesign.comFirst seen 2022-09-17 16:04
Last seen 2023-01-18 16:46
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f90296a02fa219c8c41462b253601319eFound 10 files trough .DS_Store spidering: /.well-known /_arch /_notes /assets /cgi-bin /css /home /img /js /pfp
Found on 2022-09-17 16:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.hhfurnitureanddesign.com
Port: 80
URL: http://www.hhfurnitureanddesign.comFirst seen 2022-09-17 16:04
Last seen 2023-01-18 16:46
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f90296a02fa219c8c41462b253601319eFound 10 files trough .DS_Store spidering: /.well-known /_arch /_notes /assets /cgi-bin /css /home /img /js /pfp
Found on 2022-09-17 16:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 15:20
Last seen 2023-01-15 16:32
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2022-09-15 15:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 15:22
Last seen 2023-01-15 16:32
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2022-09-15 15:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.collaborativemba.org
Port: 80
URL: http://mail.collaborativemba.orgFirst seen 2022-09-15 15:22
Last seen 2023-01-15 16:32
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2022-09-15 15:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-10 15:52
Last seen 2023-01-07 16:37
Open for 89 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d93a0121f93a0121f93a0121f93a0121fFound 1 files trough .DS_Store spidering: /uss
Found on 2022-10-10 15:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-10 15:52
Last seen 2023-01-07 16:37
Open for 89 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d93a0121f93a0121f93a0121f93a0121fFound 1 files trough .DS_Store spidering: /uss
Found on 2022-10-10 15:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-10 15:52
Last seen 2023-01-07 16:37
Open for 89 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d93a0121f93a0121f93a0121f93a0121fFound 1 files trough .DS_Store spidering: /uss
Found on 2022-10-10 15:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-22 18:03
Last seen 2022-12-22 16:33
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642cf91069fe72adfa3e72adfa3e72adfa3Found 2 files trough .DS_Store spidering: /ajax /library
Found on 2022-10-22 18:03
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.216.122
Domain: www.meeting.integratests.com
Port: 80
URL: http://www.meeting.integratests.comFirst seen 2022-08-12 15:50
Last seen 2022-12-12 16:31
Open for 122 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65225ff0ad65[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://team-1601610915009-admin@bitbucket.org/team-1601610915009-admin/video-communication.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "feature/VC-4-integrate-zoom-in-web-for-video-com"] remote = origin merge = refs/heads/feature/VC-4-integrate-zoom-in-web-for-video-com
Found on 2022-08-12 15:50511 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.meeting.integratests.com
Port: 80
URL: http://www.meeting.integratests.comFirst seen 2022-10-12 15:53
Last seen 2022-12-12 16:31
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc51fa561cca5bd8c5e8a308fd207566baFound 4 files trough .DS_Store spidering: /css /images /js /vendor
Found on 2022-10-12 15:53
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-08-12 15:50
Last seen 2022-12-12 16:31
Open for 122 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65225ff0ad65[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://team-1601610915009-admin@bitbucket.org/team-1601610915009-admin/video-communication.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "feature/VC-4-integrate-zoom-in-web-for-video-com"] remote = origin merge = refs/heads/feature/VC-4-integrate-zoom-in-web-for-video-com
Found on 2022-08-12 15:50511 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-12 15:53
Last seen 2022-12-12 16:31
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc51fa561cca5bd8c5e8a308fd207566baFound 4 files trough .DS_Store spidering: /css /images /js /vendor
Found on 2022-10-12 15:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:07
Last seen 2022-12-01 17:06
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9daa09a258aa09a258aa09a258aa09a258Found 1 files trough .DS_Store spidering: /sugarrushproductions
Found on 2022-10-01 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:07
Last seen 2022-12-01 17:06
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9daa09a258aa09a258aa09a258aa09a258Found 1 files trough .DS_Store spidering: /sugarrushproductions
Found on 2022-10-01 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:07
Last seen 2022-12-01 17:06
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9daa09a258aa09a258aa09a258aa09a258Found 1 files trough .DS_Store spidering: /sugarrushproductions
Found on 2022-10-01 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.globalnexusinitiative.org
Port: 80
URL: http://www.globalnexusinitiative.orgFirst seen 2022-09-17 16:35
Last seen 2022-11-18 17:34
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9f8ddd3d1865cdfaae8fdeca0777a64fbFound 5 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/gni /wp-content/themes/gni/js /wp-content/themes/gni-child
Found on 2022-09-17 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: globalnexusinitiative.org
Port: 80
URL: http://globalnexusinitiative.orgFirst seen 2022-09-17 16:35
Last seen 2022-11-18 17:34
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9f8ddd3d1865cdfaae8fdeca0777a64fbFound 5 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/gni /wp-content/themes/gni/js /wp-content/themes/gni-child
Found on 2022-09-17 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.globalnexusinitiative.org
Port: 80
URL: http://mail.globalnexusinitiative.orgFirst seen 2022-09-17 16:35
Last seen 2022-11-18 17:34
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9f8ddd3d1865cdfaae8fdeca0777a64fbFound 5 files trough .DS_Store spidering: /wp-content /wp-content/themes /wp-content/themes/gni /wp-content/themes/gni/js /wp-content/themes/gni-child
Found on 2022-09-17 16:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:18
Last seen 2022-11-18 17:22
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-09-17 16:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:18
Last seen 2022-11-18 17:22
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-09-17 16:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:18
Last seen 2022-11-18 17:22
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-09-17 16:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:18
Last seen 2022-11-18 17:22
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-09-17 16:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.homesickandwestbound.com
Port: 80
URL: http://www.homesickandwestbound.comFirst seen 2022-11-18 17:11-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-18 17:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: www.dreamcatcherflyfishing.com
Port: 80
URL: http://www.dreamcatcherflyfishing.comFirst seen 2022-09-17 15:36
Last seen 2022-11-18 16:58
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b1106b0bf7be6fe1adFound 22 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-18 16:58 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e45073132ae6db8bf60d929ab4ab9e02574Found 30 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/amazing-hover-effects /wp-content/plugins/backupbuddy /wp-content/plugins/divi-builder /wp-content/plugins/easy-google-fonts /wp-content/plugins/image-hover-effects /wp-content/plugins/typekit-fonts-for-wordpress /wp-content/plugins/use-any-font /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-17 15:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.dreamcatcherflyfishing.com
Port: 80
URL: http://mail.dreamcatcherflyfishing.comFirst seen 2022-09-17 15:36
Last seen 2022-11-18 16:58
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b1106b0bf7be6fe1adFound 22 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-17 15:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: dreamcatcherflyfishing.com
Port: 80
URL: http://dreamcatcherflyfishing.comFirst seen 2022-09-17 15:36
Last seen 2022-11-18 16:58
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57acbfd613553305d87f586daf9e069311aFound 19 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-17 15:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 15:22
Last seen 2022-11-15 16:48
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2022-09-15 15:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.216.122
Domain: mail.collaborativemba.com
Port: 80
URL: http://mail.collaborativemba.comFirst seen 2022-09-15 15:22
Last seen 2022-11-15 16:48
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2022-09-15 15:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-25 15:56-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-25 15:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-25 15:56-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-25 15:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-25 15:56-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-25 15:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-25 15:56-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-25 15:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-25 15:56-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-25 15:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-25 15:56-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-25 15:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-22 18:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642cf91069fe72adfa3e72adfa3e72adfa3Found 2 files trough .DS_Store spidering: /ajax /library
Found on 2022-10-22 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-22 18:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642cf91069fe72adfa3e72adfa3e72adfa3Found 2 files trough .DS_Store spidering: /ajax /library
Found on 2022-10-22 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-22 18:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642cf91069fe72adfa3e72adfa3e72adfa3Found 2 files trough .DS_Store spidering: /ajax /library
Found on 2022-10-22 18:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:10-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-01 16:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-01 16:10-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-01 16:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:18-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-09-17 16:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 16:18-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-09-17 16:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:40-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 15:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:40-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 15:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:40-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 15:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:40-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 15:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 15:40-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 15:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-15 15:21-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a380fa3e4b80fa3e4b80fa3e4bFound 2 files trough .DS_Store spidering: /images /js
Found on 2022-09-15 15:21
-
-
Open service 162.241.216.122:80 · website-3c332e22.xly.czh.mybluehost.me
2024-09-16 09:58
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:58:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cadeauchocolat.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.bandeconcrete.com
2024-09-16 09:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:56:33 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.bandeconcrete.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.seanneprud.com
2024-09-16 09:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:56:19 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://seanneprud.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.themoreclub.com
2024-09-16 09:54
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:54:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://themoreclub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:54:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.cledygonzalez.com
2024-09-16 09:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:53:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://cledygonzalez.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:53:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · zekca.com.hk
2024-09-16 09:52
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:53:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 230 Location: https://zekca.com.hk/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://zekca.com.hk/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.val.wxt.mybluehost.me
2024-09-16 09:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:51:13 GMT Server: Apache Location: https://mail.val.wxt.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 244 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.val.wxt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · revdrkatewinters.com
2024-09-16 09:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:50:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://revdrkatewinters.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:50:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · val.wxt.mybluehost.me
2024-09-16 09:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:50:13 GMT Server: Apache Location: https://val.wxt.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 239 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://val.wxt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jordanwaugh.com
2024-09-16 09:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:49:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,Cookie Cache-Control: max-age=3, must-revalidate host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Jordan Waugh — Coming Soon <!DOCTYPE html><html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"><head><meta name="viewport" content="width=device-width"><meta name="robots" content="noindex, nofollow" /><title>Jordan Waugh — Coming Soon</title> <script src="https://jordanwaugh.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style><link rel="stylesheet" href="https://jordanwaugh.com/wp-content/cache/autoptimize/css/autoptimize_single_0e39022de919596be91d03c756b5b016.css?v=3.14.9" /></head><body><div id="wrap"><main class="content"><div class="subscription_widget"><h1>Coming Soon!</h1><h2>A New WordPress Site</h2><p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p></div></main></div><footer><p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jordanwaugh.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p></footer></body></html> <!-- Dynamic page generated in 4.978 seconds. --> <!-- Cached page generated by WP-Super-Cache on 2024-09-16 09:21:44 --> <!-- super cache -->Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.whitestone.institute
2024-09-16 09:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:48:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://whitestone.institute/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:53:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · wholeheartedwellnessalabama.com
2024-09-16 09:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:47:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wholeheartedwellnessalabama.com/wp-json/>; rel="https://api.w.org/", <https://wholeheartedwellnessalabama.com/wp-json/wp/v2/pages/79>; rel="alternate"; title="JSON"; type="application/json", <https://wholeheartedwellnessalabama.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.embeddedmindset.com
2024-09-16 09:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:47:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:47:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Gabriel Gonzalez - Cyber Security — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Gabriel Gonzalez - Cyber Security — Coming Soon</title> <script src="https://gabrielcybersecurity.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://gabrielcybersecurity.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://gabrielcybersecurity.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.kpv.wog.mybluehost.me
2024-09-16 09:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:47:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thematchmakingteam.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://thematchmakingteam.com/index.php?rest_route=/wp/v2/pages/18>; rel="alternate"; title="JSON"; type="application/json", <https://thematchmakingteam.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · laelgia.com
2024-09-16 09:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:46:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://laelgia.com/wp-json/>; rel="https://api.w.org/" Content-Security-Policy: upgrade-insecure-requests Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ddq.jdq.mybluehost.me
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebellatrix.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jsu.vtl.mybluehost.me
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://silverpuddleglum.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:45:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · aahomerealty.com
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:45:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://aahomerealty.com/wp-json/>; rel="https://api.w.org/", <https://aahomerealty.com/wp-json/wp/v2/pages/12>; rel="alternate"; title="JSON"; type="application/json", <https://aahomerealty.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ofo.evx.mybluehost.me
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type Expires: Mon, 16 Sep 2024 10:45:19 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://rfimagingandcommunications.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_woocommerce_session_99aad0bfc41bef935c7b8f7c65b0178f=815dfe6f0621a5f88e764b557c33e4f7%7C%7C1726652719%7C%7C1726649119%7C%7C959d8bf4754719e2f86fef223993111b; expires=Wed, 18-Sep-2024 09:45:19 GMT; Max-Age=172800; path=/; secure; HttpOnly Set-Cookie: yith_ywraq_session_99aad0bfc41bef935c7b8f7c65b0178f=9cd3255aa260961b02155a39155a7837%7C%7C1726652719%7C%7C1726649119%7C%7C3f8cf5bc1304c7740a62d687a4ef9c1c; expires=Wed, 18-Sep-2024 09:45:19 GMT; Max-Age=172800; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · bsl.abf.mybluehost.me
2024-09-16 09:43
HTTP/1.1 503 Service Unavailable Date: Mon, 16 Sep 2024 09:43:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 428 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Connection: close Page title: 503 Service Unavailable <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>503 Service Unavailable</title> </head><body> <h1>Service Unavailable</h1> <p>The server is temporarily unable to service your request due to maintenance downtime or capacity problems. Please try again later.</p> <p>Additionally, a 503 Service Unavailable error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · spircen.com
2024-09-16 09:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:43:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: spircen.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>spircen.com — Coming Soon</title> <script src="https://spircen.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://spircen.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://spircen.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.whitestone.institute
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://whitestone.institute/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:48:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.liz-jackson.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://liz-jackson.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.assertif.us
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://assertif.us/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fassertif.us%2F; expires=Mon, 14 Oct 2024 09:43:29 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.levinsonforeastpenn.org
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://levinsonforeastpenn.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · clubboring.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://neurostrategiesfx.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.idx.oao.mybluehost.me
2024-09-16 09:42
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:42:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.idx.oao.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.idx.oao.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.fzr.tdd.mybluehost.me
2024-09-16 09:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:42:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kaliskaclean.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kaliskaclean.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kaliskaclean.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.securingyourfamily.com
2024-09-16 09:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:42:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://securingyourfamily.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.tangerineeatery.com
2024-09-16 09:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:42:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.tangerineeatery.com/wp-json/>; rel="https://api.w.org/", <https://www.tangerineeatery.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/Pa1PcB-5>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.new.greatplacetobelong.org.au
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: http://www.greatplacetobelong.org.au/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=c12266ae561a5a0ce801a00ec55dff4b; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · website-da2d9bdc.qok.pan.mybluehost.me
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Fan Page Robot — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Fan Page Robot — Coming Soon</title> <script src="http://mediakrsolutions.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://mediakrsolutions.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="http://mediakrsolutions.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · thegraphiteline.com
2024-09-16 09:41
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tangerineeatery.com
2024-09-16 09:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:41:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.tangerineeatery.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · bksbmpa.com
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 P3P: CP="ALL DSP NID CURa ADMa DEVa HISa OTPa OUR NOR NAV DEM" Link: <https://bksbmpa.com/wp-json/>; rel="https://api.w.org/", <https://bksbmpa.com/wp-json/wp/v2/pages/23>; rel="alternate"; title="JSON"; type="application/json", <https://bksbmpa.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.unitechcomputersnorthwest.co.uk
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <br /> <b>Warning</b>: The magic method ProteusThemes\ThemeRegistration\ThemeRegistration::__wakeup() must have public visibility in <b>/home1/uniteci2/public_html/unitechcomputersnorthwestco/wp-content/themes/repairpress-pt/vendor/proteusthemes/theme-registration-and-updates/src/ThemeRegistration.php</b> on line <b>170</b><br /> <br /> <b>Warning</b>: Cannot modify header information - headers already sent by (output started at /home1/uniteci2/public_html/unitechcomputersnorthwestco/wp-content/themes/repairpress-pt/vendor/proteusthemes/theme-registration-and-updates/src/ThemeRegistration.php:170) in <b>/home1/uniteci2/public_html/unitechcomputersnorthwestco/wp-includes/pluggable.php</b> on line <b>1435</b><br /> <br /> <b>Warning</b>: Cannot modify header information - headers already sent by (output started at /home1/uniteci2/public_html/unitechcomputersnorthwestco/wp-content/themes/repairpress-pt/vendor/proteusthemes/theme-registration-and-updates/src/ThemeRegistration.php:170) in <b>/home1/uniteci2/public_html/unitechcomputersnorthwestco/wp-includes/pluggable.php</b> on line <b>1438</b><br />
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rebushealth.mkadvisory.com
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebushealth.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.website-185d22be.livinglifeyouthwellness.com
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://firststepimpact.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · btg.yzs.mybluehost.me
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.grupoabindus.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=3cb9ce734ffbcd64ba800d96ebfdf9bf; path=/; secure; HttpOnly Set-Cookie: wp_woocommerce_session_60ff857980523e40baf1eb9dd854dc18=t_536df13f2bbabf3e55e5303ec06b8f%7C%7C1726652434%7C%7C1726648834%7C%7C29615fc83ce30c24e196ec1f99ea1eb8; expires=Wed, 18 Sep 2024 09:40:34 GMT; Max-Age=172800; path=/; secure; HttpOnly Set-Cookie: yith_ywraq_session_60ff857980523e40baf1eb9dd854dc18=fe2814e6172165ec158ff5cc6eb99f74%7C%7C1726652434%7C%7C1726648834%7C%7C5802434dbb563bf211859e113b8e29dd; expires=Wed, 18 Sep 2024 09:40:34 GMT; Max-Age=172800; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · authortalk.tv
2024-09-16 09:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:40:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://authortalk.tv/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:40:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · stevenrychen.com
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://stevenrychen.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://stevenrychen.com/index.php?rest_route=/wp/v2/pages/113>; rel="alternate"; title="JSON"; type="application/json", <https://stevenrychen.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.billmoore.auroralightgraffiti.com
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://billmoore.auroralightgraffiti.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tsc.coo.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://canadaimmihelps.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.futech.cl
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:44:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: futech.cl — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>futech.cl — Coming Soon</title> <script src="https://futech.cl/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://futech.cl/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> <div id="subscribe-text"> <p>Be the first to know when we launch, enter your email address and we will let you know when we go live and any future website updates we have.</p> </div> <div id="success" class="status-message"> Thank you, please check your email to confirm your subscription. </div> <div id="error-active" class="status-message"> Your email address is already subscribed to this website. Stay tuned to your inbox for our updates or try a different email address. </div> <div id="error-invalid" class="status-message"> There was an error with your submission and you were not subscribed. Please try again with a valid email address. </div> <form action="" method="post" accept-charset="utf-8" id="subscribe"> <input type="hidden" name="action" value="newfold_coming_soon_subscribe"> <input type="hidden" id="newfold-nonce-coming-soon-subscribe" name="newfold-nonce-coming-soon-subscribe" value="9b954af678" /><input type="hidden" name="_wp_http_referer" value="/" /> <span class="inputs email" id="subscribe-email"> <label id="subscribe-label" for="subscribe-field"> Email </label> <input type="email" name="email" required="required" value="" id="subscribe-field" placeholder="Enter your email address" > </span> <span class="inputs submit" id="subscribe-submit"> <input class="btn" type="submit" value="Subscribe" name="subscriptions_widget"> </span> </form> <script> var ajaxscript = { ajax_url: 'https://futech.cl/wp-admin/admin-ajax.php' }; jQuery(document).ready(function ($) { $('#subscribe-submit input').click(function (e) { e.prFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.iml.kes.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://iml.kes.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.ljl.zhc.mybluehost.me
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://szwrites.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.martechcreative.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:58 GMT Server: Apache Link: <https://www.martechcreative.com/wp-json/>; rel="https://api.w.org/", <https://www.martechcreative.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Martech Creative - Get Marketing & Marketecture Solutions <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="description" content="Get the marketing (and marketecture) support you want and deserve ... discover your #1 source for unique content candy, testing ideas, and lead generation programs that get results (and make you smile)." /><meta name="keywords" content="Online Marketing, Marketecture, Copywriting, Multivariate Testing, Email Programs" /><meta http-equiv="X-UA-Compatible" content="IE=edge"> <link rel="pingback" href="https://www.martechcreative.com/xmlrpc.php" /> <script type="text/javascript"> document.documentElement.className = 'js'; </script> <script>var et_site_url='https://www.martechcreative.com';var et_post_id='107';function et_core_page_resource_fallback(a,b){"undefined"===typeof b&&(b=a.sheet.cssRules&&0===a.sheet.cssRules.length);b&&(a.onerror=null,a.onload=null,a.href?a.href=et_site_url+"/?et_core_page_resource="+a.id+et_post_id:a.src&&(a.src=et_site_url+"/?et_core_page_resource="+a.id+et_post_id))} </script><title>Martech Creative - Get Marketing & Marketecture Solutions</title> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Martech Creative - Get Awesome Marketing (and Marketecture) to Unleash Your Story » Feed" href="https://www.martechcreative.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Martech Creative - Get Awesome Marketing (and Marketecture) to Unleash Your Story » Comments Feed" href="https://www.martechcreative.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.martechcreative.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.4.16"}}; /*! This file is auto-generated */ !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <meta content="Divi v.4.4.5" name="generator"/><style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: noneFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.jackbabbage.chiefsimplicityofficer.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://jackbabbage.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/8jBMp>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-b8e2bb48.simplyfinn.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anotherbrandcreativeco.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-e7a6b7e6.rightslaw.org
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-cache, private Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: XSRF-TOKEN=eyJpdiI6InM3Q1FJZnZyRWtNM1hNZ2s0T1p1TEE9PSIsInZhbHVlIjoiUzdjS1JVNStWVnlIUDJVbjFTOWlZd21XRlBWOXlLb0Y5ZjVwZkk1ZXRTeU9xeHhjbXhvVWN3cG9VM1BYK0NNTzF2TDc1b2lKU3NobVlXZzdsNHRQWldtVEJiUlRidDBxVjRaellmZ1NCS2JDQnErekh6NFBtZkRNUFVpeWY2RW4iLCJtYWMiOiIxZjg0OTZmYzliOGM1YzY3NTE5MjY5ZDhkYzRkMmI1MTYyNTA2MDc1NjViMGY0ZmI3Zjk5NDFmZGU0MjFhOTU1IiwidGFnIjoiIn0%3D; expires=Mon, 16 Sep 2024 11:38:47 GMT; Max-Age=7200; path=/; secure Set-Cookie: laravel_session=eyJpdiI6ImY1Z3F1UGVzSVA4RVBHc1AyYW1teWc9PSIsInZhbHVlIjoieTUvd1k4SXBRVFRWb0h3NytIb3lPWmVwWnp2K1hWaldaSG9qaDU0Q3Z1ZHYvckhFcWp6QUZNVHJMdklUbUNxR09Hc2lBK1RVZUhNV2ZPOVFoTHZEYlc4cDNRV2R2OWQ2emZ6OEcyazFpQm44V1J6aW13WVNOZUR6aXNiblM1ZDUiLCJtYWMiOiJiMWEzNzA3MjQzNWU5NzlkYzU3YTdiZjMzZWNhYTFjMTliN2NhNzA5NTEzYzg5OGVkOWRjMDIwMzM3ZGI3Nzk4IiwidGFnIjoiIn0%3D; expires=Mon, 16 Sep 2024 11:38:47 GMT; Max-Age=7200; path=/; httponly Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · sjqart.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://sjqart.com/wp-json/>; rel="https://api.w.org/", <https://sjqart.com/wp-json/wp/v2/pages/19>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PbfE92-j>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:43:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.dgy.goc.mybluehost.me
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://containstore.co/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: request_a_quote_user_coockie=66e7fca5e8263
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · razzlemarketing.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://razzlemarketing.com/wp-json/>; rel="https://api.w.org/", <https://razzlemarketing.com/wp-json/wp/v2/pages/36>; rel="alternate"; title="JSON"; type="application/json", <https://razzlemarketing.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:43:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.startguides.net
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 10:38:32 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://startguides.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Vary: Accept-Encoding X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.sportsnews-swiss.ch
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sportsnews-swiss.ch/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.simplycolorguard.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://simplycolorguard.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=e8ad52bd693d14f6ce55f01512ebccb4; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · greenobsessionnursery.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.greenobsessionnursery.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.noemarti.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://noemarti.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · familybackyardadventures.com
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://familybackyardadventures.com/wp-json/>; rel="https://api.w.org/", <https://familybackyardadventures.com/wp-json/wp/v2/pages/3973>; rel="alternate"; title="JSON"; type="application/json", <https://familybackyardadventures.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.inklingvideo.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inklingvideo.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · hatchersmith.com
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Hatcher Smith, LLC — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Hatcher Smith, LLC — Coming Soon</title> <script src="https://hatchersmith.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hatchersmith.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hatchersmith.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jfp.vgr.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://idahocl.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.fua.zzt.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://pawsitivelyfitadventures.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.subdomain.radhakrishna.ca
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://subdomain.radhakrishna.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.martimcerere.edu.ec
2024-09-16 09:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:35:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://martimcerere.edu.ec/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tjq.ijo.mybluehost.me
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.vorcast.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · atentinthewoods.atentforfour.com
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://atentinthewoods.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://atentinthewoods.com/index.php?rest_route=/wp/v2/pages/84>; rel="alternate"; title="JSON"; type="application/json", <https://atentinthewoods.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:39:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.monioweddings.com
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://monioweddings.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=de; expires=Tue, 16 Sep 2025 09:34:10 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax Connection: close
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.lifewithvernandjoli.com
2024-09-16 09:33
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:33:51 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Life with Vern and Joli — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Life with Vern and Joli — Coming Soon</title> <script src="https://lifewithvernandjoli.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lifewithvernandjoli.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lifewithvernandjoli.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.meltcville.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:50 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://meltcville.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.shittybooks.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:50 GMT Server: Apache Link: <https://www.shittybooks.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/1KP15>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.roadrevelations.org
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://roadrevelations.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.sunshinespaulding.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sunshinespaulding.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · julialaurel.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://julialaurel.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · unitechcomputersnorthwest.co.uk
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · migukedit.travelglobenow.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://migukedit.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:37:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.fjj.duj.mybluehost.me
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:43 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 2249 Last-Modified: Sat, 14 Oct 2023 00:25:12 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="http://fjj.duj.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://fjj.duj.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.3.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="http://fjj.duj.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html> <!--Generated by Newfold Page Cache-->Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.embraceherflow.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://embraceherflow.com/xmlrpc.php X-Redirect-By: WordPress Location: https://embraceherflow.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:37:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jwholesalespa.com
2024-09-16 09:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jwholesalespa.com/wp-json/>; rel="https://api.w.org/", <https://jwholesalespa.com/wp-json/wp/v2/pages/17>; rel="alternate"; title="JSON"; type="application/json", <https://jwholesalespa.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:37:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.bmm.isd.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kimchikisses.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · leavingchristianity-net.pmg.dbr.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.leavingchristianity.net/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:37:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.dealers.marketing
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:32:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://dealers.marketing/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rebellatrix.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebellatrix.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.silverpuddleglum.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://silverpuddleglum.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.inklingvideo.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inklingvideo.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · thechefdinnerclub.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thechefdinnerclub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · primroseground.nlyh.org
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://primroseground.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.cinetyka-mg.andcorp.org
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:30 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://cinetyka.mg/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rmt.zga.mybluehost.me
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bloomsrentals.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ushoneybeehealthsurvey.info
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ushoneybeehealthsurvey.info/wp-json/>; rel="https://api.w.org/", <https://ushoneybeehealthsurvey.info/wp-json/wp/v2/pages/54>; rel="alternate"; title="JSON"; type="application/json", <https://ushoneybeehealthsurvey.info/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.defendeastpenn.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge Expires: Mon, 16 Sep 2024 10:31:24 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://defendeastpenn.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · xperttreeservicesma-ri.com
2024-09-16 09:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:30:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://xperttreeservicesma-ri.com/wp-json/>; rel="https://api.w.org/", <https://xperttreeservicesma-ri.com/wp-json/wp/v2/pages/658>; rel="alternate"; title="JSON"; type="application/json", <https://xperttreeservicesma-ri.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.hss.lcd.mybluehost.me
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ushoneybeehealthsurvey.info/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.berenicelefebvre.com
2024-09-16 09:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:30:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://berenicelefebvre.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:35:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.ldb.psw.mybluehost.me
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://epicchronicles.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.overthinkingcomics.com
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://overthinkingcomics.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · improveyour20s.com
2024-09-16 09:29
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:29:48 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: How to improve your 20s — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>How to improve your 20s — Coming Soon</title> <script src="https://improveyour20s.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://improveyour20s.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://improveyour20s.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.keatonlannert.com
2024-09-16 09:29
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:29:43 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Keaton Lannert — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Keaton Lannert — Coming Soon</title> <script src="https://box5402.temp.domains/~hvvwwjmy/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5402.temp.domains/~hvvwwjmy/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://box5402.temp.domains/~hvvwwjmy/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-3c332e22.xly.czh.mybluehost.me
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cadeauchocolat.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.saltycentral.com
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:29 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://saltycentral.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.bobbymoen.com
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:21 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://bobbymoen.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jesustrustinginhim.ca
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Jesus: Trusting in Him — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Jesus: Trusting in Him — Coming Soon</title> <script src="https://jesustrustinginhim.ca/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jesustrustinginhim.ca/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jesustrustinginhim.ca/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.milehighsquares.org
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://milehighsquares.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.vedictantra.ca
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: b9b_HTTP.200,b9b_HTTP.301 X-Redirect-By: WordPress Location: https://vedictantra.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wmc_ip_info=eyJjb3VudHJ5IjoiTkwiLCJjdXJyZW5jeV9jb2RlIjoiRVVSIn0%3D; expires=Tue, 17 Sep 2024 09:28:50 GMT; Max-Age=86400; path=/ Set-Cookie: wmc_current_currency=CAD; expires=Tue, 17 Sep 2024 09:28:50 GMT; Max-Age=86400; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · awx.rew.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bolbiethebear.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.novacountertopsusa.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14-Sep-2034 09:28:37 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked Page title: Nova Countertops — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Nova Countertops — Coming Soon</title> <script src="https://novacountertopsusa.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://novacountertopsusa.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://novacountertopsusa.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.vnv.sty.mybluehost.me
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:20 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: nasalvape — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <title> nasalvape — Coming Soon </title> <meta name="robots" content="noindex, nofollow" /> <script src="https://nasalvape.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url("https://nasalvape.com/wp-content/plugins/bluehost-wordpress-plugin/static/images/cs-bluehost-bg.jpg"); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom: 0; left: 0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16pxFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.myh.rwl.mybluehost.me
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://beauheyman.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:28:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.fonvilletreeservice.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fonvilletreeservice.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.dermatologiajimenez.hfy.ovo.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dermatologiajimenez.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.faronassociates.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://faronassociates.com/xmlrpc.php X-Redirect-By: WordPress Location: https://faronassociates.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: User-Agent X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.themightyoakes.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://themightyoakes.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:32:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.anothersunnyday.us
2024-09-16 09:27
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:27:44 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Another Sunny Day — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Another Sunny Day — Coming Soon</title> <script src="https://anothersunnyday.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://anothersunnyday.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://anothersunnyday.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · dgy.goc.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://containstore.co/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: request_a_quote_user_coockie=66e7fa1217d35
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.superpsychicroyale.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.superpsychicroyale.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.superpsychicroyale.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.superpsychicroyale.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.chr.vql.mybluehost.me
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://chr.vql.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://chr.vql.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://chr.vql.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.discgolfaround.teacherdouble.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://discgolfaround.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.nmk.dhy.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wowexpress.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · slinkyandmoose.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://www.slinkyandmoose.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.leesoverseas.com
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:17 GMT Server: Apache Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 30 May 2023 03:26:18 GMT Accept-Ranges: bytes Content-Length: 802 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Type: text/html Page title: LEES | Overseas Delights <!doctype html><html lang="en"><head><meta charset="utf-8"/><link rel="icon" href="/favicon.ico"/><meta name="viewport" content="width=device-width,initial-scale=1"/><meta name="theme-color" content="#000000"/><meta name="description" content="Web site created using create-react-app"/><link rel="apple-touch-icon" href="/logo192.png"/><link rel="manifest" href="/manifest.json"/><link href="https://cdn.jsdelivr.net/npm/bootstrap@5.2.0/dist/css/bootstrap.min.css" rel="stylesheet" integrity="sha384-gH2yIJqKdNHPEq0n4Mqa/HGKIhSkIHeL5AyhkYV8i59U5AR6csBvApHHNl/vI1Bx" crossorigin="anonymous"><title>LEES | Overseas Delights</title><script defer="defer" src="/static/js/main.604c8a71.js"></script><link href="/static/css/main.1d85db38.css" rel="stylesheet"></head><body><div id="root"></div></body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · gabesiegal.com
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://gabesiegal.com/wp-json/>; rel="https://api.w.org/", <https://gabesiegal.com/wp-json/wp/v2/pages/3166>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/Pa1fcJ-P4>; rel=shortlink Last-Modified: Mon, 16 Sep 2024 09:27:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.familybackyardadventures.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://familybackyardadventures.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.growinggreatsouls.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://growinggreatsouls.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.aiwtd.nlyh.org
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://aiwtd.com/index.php?rest_route=/>; rel="https://api.w.org/" Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Site is undergoing maintenance <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <title>Site is undergoing maintenance</title> <meta name="viewport" content="width=device-width, maximum-scale=1, initial-scale=1, minimum-scale=1"> <meta name="description" content=""/> <meta http-equiv="X-UA-Compatible" content="" /> <meta property="og:site_name" content="Aiwtd - "/> <meta property="og:title" content="Site is undergoing maintenance"/> <meta property="og:type" content="Maintenance"/> <meta property="og:url" content="https://aiwtd.com"/> <meta property="og:description" content="Site will be available soon. Thank you for your patience!"/> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://aiwtd.com/xmlrpc.php" /> <link rel='stylesheet' id='mtnc-style-css' href='https://aiwtd.com/wp-content/plugins/maintenance/load/css/style.css?ver=1702675285' media='all' /> <link rel='stylesheet' id='mtnc-fonts-css' href='https://aiwtd.com/wp-content/plugins/maintenance/load/css/fonts.css?ver=1702675285' media='all' /> <style type="text/css">body {background-color: #111111}.preloader {background-color: #111111}body {font-family: Open Sans; }.site-title, .preloader i, .login-form, .login-form a.lost-pass, .btn-open-login-form, .site-content, .user-content-wrapper, .user-content, footer, .maintenance a{color: #ffffff;} a.close-user-content, #mailchimp-box form input[type="submit"], .login-form input#submit.button {border-color:#ffffff} input[type="submit"]:hover{background-color:#ffffff} input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-text-fill-color:#ffffff} body > .login-form-container{background-color:#111111}.btn-open-login-form{background-color:#111111}input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-box-shadow:0 0 0 50px #111111 inset}input[type='submit']:hover{color:#111111} #custom-subscribe #submit-subscribe:before{background-color:#111111} </style> <!--[if IE]> <style type="text/css"> </style> <script type="text/javascript" src="https://aiwtd.com/wp-content/plugins/maintenance/load/js/jquery.backstretch.min.js"></script> <![endif]--> <link rel="stylesheet" href="https://fonts.bunny.net/css?family=Open%20Sans:300,300italic,regular,italic,600,600italic,700,700italic,800,800italic:Latin"></head> <body class="maintenance "> <div class="main-container"> <div class="preloader"><i class="fi-widget" aria-hidden="true"></i></div> <div id="wrapper"> <div class="center logotype"> <header> <div class="logo-box istext" rel="home"><h1 class="site-title">Aiwtd</h1></div> </header> </div> <div id="content" class="site-content"> <div class="center"> <h2 class="heading font-center" style="font-weight:normal;font-style:Latin">Maintenance mode is on</h2><div class="description" style="font-weight:normal;font-style:Latin"><p>Site will be available soon. Thank you for your patience!</p> </div> </div> </div> </div> <!-- end wrapper --> <footer> <div class="center"> <div style="font-weight:normal;font-style:Latin">© Aiwtd 2023</div> </div> </footer> <picture class="bg-img"> <img src="https://aiwtd.com/wp-content/uploads/2023/12/mt-sample-background.jpg"> </picture> </div> <div class="login-form-container"> <input type="hidden" id="mtnc_login_check" name="mtnc_login_check" value="758443ed1d" /><input type="hidden" name="_wp_http_referer" value="/" /><form id="login-form" class="login-form" method="post"><label>User Login</label><span class="login-error"></span><span class="licon user-icon"><input type="text" name="log" id="log" value="" size="20" class="input username" placeholder="Username" /></span><span class="picon pass-icon"><input type="password" name="pwd" id="login_password" value="" size="20" class="input password" placeholder="Password" /></span><a class="lost-pass" href="https://aiwtd.com/wp-login.php?action=lostpassword">Lost Password</a><input type="submit" class="button" name="submit" id="submit" value="Login" /><input type="hidden" name="is_custom_login" value="1" /><input type="hidden" id="mtnc_logFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.galezmarketing.com
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://galezmarketing.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://galezmarketing.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://galezmarketing.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-cea4c429.accessibledbt.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://radiantmindtherapy.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · thewhitelightcollective.com
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: 78a_HTTP.200 Link: <https://thewhitelightcollective.com/wp-json/>; rel="https://api.w.org/", <https://thewhitelightcollective.com/wp-json/wp/v2/pages/13>; rel="alternate"; title="JSON"; type="application/json", <https://thewhitelightcollective.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.gzp.xng.mybluehost.me
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trafficfreegh.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Vary: User-Agent X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · vyf.svi.mybluehost.me
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:53 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: __wpdm_client=581b2b6e7f107a7373d16deafc439c65; path=/; secure; HttpOnly Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fprayerpointpress.com%2F; expires=Mon, 14-Oct-2024 09:25:55 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Upgrade: h2,h2c Connection: Upgrade, close Location: https://prayerpointpress.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:30:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.crystalaccountsnig.com
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://crystalaccountsnig.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://crystalaccountsnig.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://crystalaccountsnig.com/>; rel=shortlink Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:25:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.im4c.com
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://im4c.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.mindfulequanimity.com
2024-09-16 09:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Jetpack-Boost-Cache: miss Vary: accept,content-type X-Redirect-By: WordPress Location: https://mindfulequanimity.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.prepamasters-com.mte.uzz.mybluehost.me
2024-09-16 09:24
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · parkramz.amenired.com
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:24 GMT Server: Apache Link: <https://www.parkramz.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · beyondglioblastoma.com
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:23 GMT Server: Apache Link: <https://beyondglioblastoma.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:29:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · berenicelefebvre.com
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://berenicelefebvre.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:29:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.thb.bpj.mybluehost.me
2024-09-16 09:24
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · elm-rc.com
2024-09-16 09:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:24:08 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: elm-rc.com — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>elm-rc.com — Coming Soon</title> <script src="https://elm-rc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://elm-rc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://elm-rc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · xcf.wvs.mybluehost.me
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:24:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://razahandymanservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · artsbiotica.spircen.com
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:46 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: artsbiotica.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>artsbiotica.com — Coming Soon</title> <script src="https://artsbiotica.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://artsbiotica.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://artsbiotica.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.montcopatchpro.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://montcopatchpro.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:28:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.loveandwar.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://loveandwar.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · configjon.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.configjon.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:28:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.doorbustersale.thematchmakingteam.com
2024-09-16 09:22
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:22:05 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: DoorBusterSale — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>DoorBusterSale — Coming Soon</title> <script src="https://doorbustersale.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://doorbustersale.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://doorbustersale.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.silkbeautyfromqi.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: BeautyandHarmonyforYou — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>BeautyandHarmonyforYou — Coming Soon</title> <script src="http://silkbeautyfromqi.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://silkbeautyfromqi.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://silkbeautyfromqi.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.ivuemedia.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ivuemedia.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.gbts-llc.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:53 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://gbts-llc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.nbtrades.thematchmakingteam.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:48 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: NBTrades.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>NBTrades.com — Coming Soon</title> <script src="https://nbtrades.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nbtrades.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nbtrades.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · old.pavedc.org
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Pingback: https://old.pavedc.org/xmlrpc.php Link: <https://old.pavedc.org/wp-json/>; rel="https://api.w.org/", <https://old.pavedc.org/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://old.pavedc.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.badassloops.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:25:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Badass Loops — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Badass Loops — Coming Soon</title> <script src="https://badassloops.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://badassloops.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://badassloops.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · grape-experiences.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.grape-experiences.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.tammyhicksjackson.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:19 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://tammyhicksjackson.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jesustrustinginhim.ca
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Jesus: Trusting in Him — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Jesus: Trusting in Him — Coming Soon</title> <script src="https://jesustrustinginhim.ca/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jesustrustinginhim.ca/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jesustrustinginhim.ca/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.dmwoodturners.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:16 GMT Server: Apache Link: <https://www.dmwoodturners.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.dmwoodturners.com/index.php?rest_route=/wp/v2/pages/10>; rel="alternate"; title="JSON"; type="application/json", <https://www.dmwoodturners.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Des Moines Woodturners | AAW Chapter serving central Iowa woodturners of all skill levels <!DOCTYPE html> <!--[if IE 6]> <html id="ie6" lang="en-US"> <![endif]--> <!--[if IE 7]> <html id="ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html id="ie8" lang="en-US"> <![endif]--> <!--[if !(IE 6) & !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title> Des Moines Woodturners | AAW Chapter serving central Iowa woodturners of all skill levels </title> <link rel="profile" href="https://gmpg.org/xfn/11" /> <link rel="stylesheet" type="text/css" media="all" href="https://www.dmwoodturners.com/wp-content/themes/twentyeleven/style.css?ver=20221101" /> <link rel="pingback" href="https://www.dmwoodturners.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.dmwoodturners.com/wp-content/themes/twentyeleven/js/html5.js?ver=3.7.0" type="text/javascript"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel="alternate" type="application/rss+xml" title="Des Moines Woodturners » Feed" href="https://www.dmwoodturners.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Des Moines Woodturners » Comments Feed" href="https://www.dmwoodturners.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.dmwoodturners.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythiFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.bumclues.schindlerengineering.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:03 GMT Server: Apache Link: <https://bumclues.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://bumclues.com/index.php?rest_route=/wp/v2/pages/21>; rel="alternate"; type="application/json", <https://bumclues.com/>; rel=shortlink Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 09:20:05 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.eleventy-one.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://eleventy-one.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · inspirednationonline.com
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://inspirednationonline.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.ljx.ryb.mybluehost.me
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: BeautyandHarmonyforYou — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>BeautyandHarmonyforYou — Coming Soon</title> <script src="https://silkbeautyfromqi.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://silkbeautyfromqi.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://silkbeautyfromqi.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · tsc.coo.mybluehost.me
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://canadaimmihelps.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.janellelynnrn.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://janellelynnrn.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.livingthehlife.com
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:18:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:23:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: My Awesome Future Self — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>My Awesome Future Self — Coming Soon</title> <script src="https://heidischubert.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://heidischubert.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://heidischubert.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · letthebunsbake.com
2024-09-16 09:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:18:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://beauheyman.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:18:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.bat-trac.com
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:18:05 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:18:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://battrac.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://battrac.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.6.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://battrac.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.xmw.pan.mybluehost.me
2024-09-16 09:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:17:42 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:17:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://xmw.pan.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://xmw.pan.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://xmw.pan.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · tinker1881.chiefsimplicityofficer.com
2024-09-16 09:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:17:20 GMT Server: Apache Link: <https://www.tinker1881.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.secondcityfireprotection.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:56 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://secondcityfireprotection.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://secondcityfireprotection.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://secondcityfireprotection.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.votersrighttoknow.org
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:16:45 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Set-Cookie: PHPSESSID=5a19093d641569e2ddd01a32b5974e72; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://votersrighttoknow.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.dearricky.com
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:16:35 GMT Server: Apache X-Pingback: https://dearricky.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://dearricky.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.ohanaparents.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://seattledoulapartners.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.hrsfashionllc.com
2024-09-16 09:16
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.mindfulequanimity.com
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:16:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Jetpack-Boost-Cache: miss Vary: accept,content-type X-Redirect-By: WordPress Location: https://mindfulequanimity.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · test.westmountplacepharmacy.com
2024-09-16 09:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:15:57 GMT Server: Apache Link: <https://test.westmountplacepharmacy.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Page not found – pharmahealthcare <!DOCTYPE html> <html lang="en-US" class="no-js"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <script>(function(html){html.className = html.className.replace(/\bno-js\b/,'js')})(document.documentElement);</script> <title>Page not found – pharmahealthcare</title> <meta name='robots' content='noindex,nofollow' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link href='https://fonts.gstatic.com' crossorigin rel='preconnect' /> <link rel="alternate" type="application/rss+xml" title="pharmahealthcare » Feed" href="https://test.westmountplacepharmacy.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="pharmahealthcare » Comments Feed" href="https://test.westmountplacepharmacy.com/comments/feed/" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/test.westmountplacepharmacy.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.4.16"}}; /*! This file is auto-generated */ !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://test.westmountplacepharmacy.com/wp-includes/css/dist/block-library/style.min.css?ver=5.4.16' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='https://test.westmountplacepharmacy.com/wp-includes/css/dist/block-library/theme.min.css?ver=5.4.16' media='all' /> <link rel='stylesheet' id='wc-block-style-css' href='https://test.westmountplacepharmacy.com/wp-content/plugins/woocommerce/packages/woocommerce-blocks/build/style.css?ver=2.5.14' media='all' /> <link rel='stylesheet' id='woocommerce-layout-css'Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-d965dad7.gandtideas.com
2024-09-16 09:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:15:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hopesforthepath.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:15:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.brennanforpa.com
2024-09-16 09:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:15:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://brennanforpa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:15:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · southernlehightogether.com
2024-09-16 09:14
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:14:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Pingback: https://southernlehightogether.com/xmlrpc.php X-UA-Compatible: IE=edge Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <!DOCTYPE html> <html class="sp-html sp-is-mobile sp-seedprod sp-h-full" lang="en-US"> <head> <!-- Open Graph --> <meta property="og:url" content="https://southernlehightogether.com/" /> <meta property="og:type" content="website" /> <!-- Twitter Card --> <meta name="twitter:card" content="summary" /> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <!-- Default CSS --> <link rel='stylesheet' id='seedprod-css-css' href='https://southernlehightogether.com/wp-content/plugins/coming-soon/public/css/tailwind.min.css?ver=6.18.5' type='text/css' media='all' /> <link rel='stylesheet' id='seedprod-fontawesome-css' href='https://southernlehightogether.com/wp-content/plugins/coming-soon/public/fontawesome/css/all.min.css?ver=6.18.5' type='text/css' media='all' /> <!-- Global Styles --> <style> #sp-page{color:#272727} #sp-page .sp-header-tag-h1,#sp-page .sp-header-tag-h2,#sp-page .sp-header-tag-h3,#sp-page .sp-header-tag-h4,#sp-page .sp-header-tag-h5,#sp-page .sp-header-tag-h6{color:#000000}#sp-page h1,#sp-page h2,#sp-page h3,#sp-page h4,#sp-page h5,#sp-page h6{color:#000000; font-family:'Helvetica Neue', Arial, sans-serif;font-weight:400;font-style:normal} #sp-page a{color:#FF0000} #sp-page a:hover{color:#cc0000}#sp-page .btn{background-color:#000000}body{background-color:#FFFFFF; background-image:;} @media only screen and (max-width: 480px) { } @media only screen and (min-width: 481px) and (max-width: 1024px) { } @media only screen and (min-width: 1024px) { } </style> <!-- JS --> <script> </script> <script src="https://southernlehightogether.com/wp-content/plugins/coming-soon/public/js/sp-scripts.min.js" defer></script> <script src="https://southernlehightogether.com/wp-includes/js/jquery/jquery.min.js"></script> </head> <body class="spBgcover sp-h-full sp-antialiased sp-bg-slideshow"> <div id="sp-page" class="spBgcover sp-content-1" style="background-color: rgb(255, 255, 255); font-family: 'Helvetica Neue', Arial, sans-serif; font-weight: 400;"><section id="sp-ks8a8s" class="sp-el-section " style="width: 100%; max-width: 100%; padding: 10px;"><div id="sp-vw3kvy" class="sp-el-row sm:sp-flex sp-justify-between sp-w-full sp-m-auto" style="padding: 0px; width: auto; max-width: 1000px;"><div id="sp-wlr0tr" class="sp-el-col sp-p-4 sp-w-full" style="width: calc(100% - 0px); padding: 10px;"><figure id="sp-vjjrmw" class="sp-image-wrapper" style="margin-top: 0px; padding: 10px; text-align: center;"><span><a href="https://southernlehightogether.com" target="" rel="noopener"><img src="https://southernlehightogether.com/wp-content/uploads/2021/07/SLT-Logo.jpg" alt="" srcset=" https://southernlehightogether.com/wp-content/uploads/2021/07/SLT-Logo-150x150.jpg 150w, https://southernlehightogether.com/wp-content/uploads/2021/07/SLT-Logo-300x232.jpg 300w, https://southernlehightogether.com/wp-content/uploads/2021/07/SLT-Logo-1024x791.jpg 1024w, https://southernlehightogether.com/wp-content/uploads/2021/07/SLT-Logo.jpg 1100w" style="width: 25%;"></a></span></figure><div class="sp-button-wrapper" style="padding: 10px; margin-top: 0px; text-align: center;"><a href="https://facebook.com/SouthernLehighTogether" id="sp-d7wfs0" target="" rel="noopener" class="sp-button sp-css-target sp-text-center sp-inline-block sp-leading-none sp-button-d7wfs0" style="font-size: 22px; background: linear-gradient(-180deg, rgb(37, 120, 201), rgb(31, 102, 171) 90%); color: rgb(255, 255, 255); width: auto; padding: 16px 20px; border-radius: 4px; border: 1px solid rgb(29, 94, 158); box-shadow: rgba(255, 255, 255, 0.2) 0px 1px 0px inset;" draggable="false"><span><strong>Find Us on Facebook</strong></span></a></div><div class="sp-button-wrapper" style="padding: 10px; margin-top: 0px; text-align: center;"><a href="mailto:info@southernlehightogether.com" id="sp-rz9wft" target="" rel="noopener" class="sp-button sp-css-target sp-text-center sp-inline-block sp-leading-none sp-button-rz9wft" style="font-size: 22px; baFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ssscolumbia-org.sgw.ihj.mybluehost.me
2024-09-16 09:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:13:08 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ssscolumbia.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:13:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · overthinkingcomics.seanneprud.com
2024-09-16 09:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:12:51 GMT Server: Apache Link: <https://overthinkingcomics.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.wfh.tdd.mybluehost.me
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:12:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://heraextension.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://heraextension.com/index.php?rest_route=/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://heraextension.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:12:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · themoreclub.com
2024-09-16 09:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:11:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://themoreclub.com/wp-json/>; rel="https://api.w.org/", <https://themoreclub.com/wp-json/wp/v2/pages/314>; rel="alternate"; title="JSON"; type="application/json", <https://themoreclub.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:11:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.loveandwar.com
2024-09-16 09:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:10:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://loveandwar.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:10:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.ibahai.org
2024-09-16 09:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:09:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://ibahai.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:09:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · grupolazaro.com
2024-09-16 09:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:09:01 GMT Server: Apache Expires: Mon, 16 Sep 2024 10:09:04 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.grupolazaro.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · littlefeetbigworld.blog
2024-09-16 09:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:08:46 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:08:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Adventure awaits — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Adventure awaits — Coming Soon</title> <script src="https://littlefeetbigworld.blog/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://littlefeetbigworld.blog/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://littlefeetbigworld.blog/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.boriginallifecoach.com
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Borginallifecoach — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Borginallifecoach — Coming Soon</title> <script src="https://boriginallifecoach.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://boriginallifecoach.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://boriginallifecoach.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.ancernetwork.org
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:56 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.ancernetwork.org/mainap/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · fjb.gro.mybluehost.me
2024-09-16 09:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:06:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Jesus: Trusting in Him — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Jesus: Trusting in Him — Coming Soon</title> <script src="https://jesustrustinginhim.ca/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jesustrustinginhim.ca/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jesustrustinginhim.ca/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · qfs.yhn.mybluehost.me
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://neurostrategiesfx.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.mah.rfn.mybluehost.me
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thebrilliantfool.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mll.kqm.mybluehost.me
2024-09-16 09:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:06:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inklingvideo.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:06:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.website-41f92733.litraven.com
2024-09-16 09:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:05:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://philomathean.tv/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:05:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.cht.jvd.mybluehost.me
2024-09-16 09:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:04:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://janellelynnrn.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:04:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.containstore.co
2024-09-16 09:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:04:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://containstore.co/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:04:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: request_a_quote_user_coockie=66e7f49311ef0
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · revolvt.com
2024-09-16 09:01
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:01:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://revolvt.com/wp-json/>; rel="https://api.w.org/", <https://revolvt.com/wp-json/wp/v2/pages/44>; rel="alternate"; title="JSON"; type="application/json", <https://revolvt.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:01:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.qarnis.com
2024-09-16 09:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:01:00 GMT Server: Apache Link: <https://www.qarnis.com/wp-json/>; rel="https://api.w.org/", <https://www.qarnis.com/wp-json/wp/v2/pages/45>; rel="alternate"; type="application/json", <https://www.qarnis.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.centralkitchenla.com
2024-09-16 08:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:59:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://centralkitchenla.com/xmlrpc.php X-Redirect-By: WordPress Location: https://centralkitchenla.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:59:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.epicchronicles.ca
2024-09-16 08:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:59:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://epicchronicles.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:59:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · nbtrades.thematchmakingteam.com
2024-09-16 08:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:59:44 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: NBTrades.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>NBTrades.com — Coming Soon</title> <script src="https://nbtrades.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nbtrades.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nbtrades.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · bolbiethebear.com
2024-09-16 08:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:59:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bolbiethebear.com/wp-json/>; rel="https://api.w.org/", <https://bolbiethebear.com/wp-json/wp/v2/pages/11>; rel="alternate"; title="JSON"; type="application/json", <https://bolbiethebear.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:59:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · skyscrapers.today
2024-09-16 08:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:58:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://skyscrapers.today/wp-json/>; rel="https://api.w.org/", <https://skyscrapers.today/wp-json/wp/v2/pages/1014>; rel="alternate"; title="JSON"; type="application/json", <https://skyscrapers.today/>; rel=shortlink Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:58:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · schindlerengineering.com
2024-09-16 08:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:58:30 GMT Server: Apache Link: <https://schindlerengineering.com/public/wp-json/>; rel="https://api.w.org/" Set-Cookie: wp_wpfileupload_185cc1d4fdacc65f05d53fddae72db0a=eX6ERFDtczTfKTS49qHAcRAqe682A7Fj; expires=Wed, 18 Sep 2024 08:58:30 GMT; Max-Age=172800; path=/public/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.website-f4f68066.simplyfinn.com
2024-09-16 08:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:58:02 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:58:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Hair by Stephanie — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Hair by Stephanie — Coming Soon</title> <script src="https://njs.hbq.mybluehost.me/website_f4f68066/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://njs.hbq.mybluehost.me/website_f4f68066/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://njs.hbq.mybluehost.me/website_f4f68066/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.airr-na.org
2024-09-16 08:57
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:57:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.airr-na.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:57:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · campustocorporatellc.com
2024-09-16 08:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:57:27 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: accept,content-type,Accept-Encoding X-Pingback: https://campustocorporatellc.com/xmlrpc.php Link: <https://campustocorporatellc.com/wp-json/>; rel="https://api.w.org/", <https://campustocorporatellc.com/wp-json/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://wp.me/P3Q9nE-5>; rel=shortlink Set-Cookie: PHPSESSID=d91add3fdc4d21560ffb10e7108c4eef; path=/ Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.zealium.media
2024-09-16 08:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:56:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zealium.media/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:56:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · creatimartcr.com
2024-09-16 08:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:56:24 GMT Server: Apache X-UA-Compatible: IE=edge,chrome=1 Link: <https://creatimartcr.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://creatimartcr.com/index.php?rest_route=/wp/v2/pages/2496>; rel="alternate"; title="JSON"; type="application/json", <https://creatimartcr.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:56:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.levinsonforeastpenn.org
2024-09-16 08:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:56:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://levinsonforeastpenn.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:56:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-b64bd23a.yqr.bzx.mybluehost.me
2024-09-16 08:56
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 08:56:08 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: http://www.explorefreeresults.com/?dn=box5402.bluehost.com&pid=5POJ5651L&spfwd=1 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.bahaiteacher.org
2024-09-16 08:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:55:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bahaiteacher.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:55:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-da2d9bdc.qok.pan.mybluehost.me
2024-09-16 08:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:55:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:55:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Fan Page Robot — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Fan Page Robot — Coming Soon</title> <script src="https://mediakrsolutions.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://mediakrsolutions.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://mediakrsolutions.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · aiwtd.com
2024-09-16 08:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:55:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://aiwtd.com/index.php?rest_route=/>; rel="https://api.w.org/" Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Site is undergoing maintenance <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <title>Site is undergoing maintenance</title> <meta name="viewport" content="width=device-width, maximum-scale=1, initial-scale=1, minimum-scale=1"> <meta name="description" content=""/> <meta http-equiv="X-UA-Compatible" content="" /> <meta property="og:site_name" content="Aiwtd - "/> <meta property="og:title" content="Site is undergoing maintenance"/> <meta property="og:type" content="Maintenance"/> <meta property="og:url" content="https://aiwtd.com"/> <meta property="og:description" content="Site will be available soon. Thank you for your patience!"/> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://aiwtd.com/xmlrpc.php" /> <link rel='stylesheet' id='mtnc-style-css' href='https://aiwtd.com/wp-content/plugins/maintenance/load/css/style.css?ver=1702675285' media='all' /> <link rel='stylesheet' id='mtnc-fonts-css' href='https://aiwtd.com/wp-content/plugins/maintenance/load/css/fonts.css?ver=1702675285' media='all' /> <style type="text/css">body {background-color: #111111}.preloader {background-color: #111111}body {font-family: Open Sans; }.site-title, .preloader i, .login-form, .login-form a.lost-pass, .btn-open-login-form, .site-content, .user-content-wrapper, .user-content, footer, .maintenance a{color: #ffffff;} a.close-user-content, #mailchimp-box form input[type="submit"], .login-form input#submit.button {border-color:#ffffff} input[type="submit"]:hover{background-color:#ffffff} input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-text-fill-color:#ffffff} body > .login-form-container{background-color:#111111}.btn-open-login-form{background-color:#111111}input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-box-shadow:0 0 0 50px #111111 inset}input[type='submit']:hover{color:#111111} #custom-subscribe #submit-subscribe:before{background-color:#111111} </style> <!--[if IE]> <style type="text/css"> </style> <script type="text/javascript" src="https://aiwtd.com/wp-content/plugins/maintenance/load/js/jquery.backstretch.min.js"></script> <![endif]--> <link rel="stylesheet" href="https://fonts.bunny.net/css?family=Open%20Sans:300,300italic,regular,italic,600,600italic,700,700italic,800,800italic:Latin"></head> <body class="maintenance "> <div class="main-container"> <div class="preloader"><i class="fi-widget" aria-hidden="true"></i></div> <div id="wrapper"> <div class="center logotype"> <header> <div class="logo-box istext" rel="home"><h1 class="site-title">Aiwtd</h1></div> </header> </div> <div id="content" class="site-content"> <div class="center"> <h2 class="heading font-center" style="font-weight:normal;font-style:Latin">Maintenance mode is on</h2><div class="description" style="font-weight:normal;font-style:Latin"><p>Site will be available soon. Thank you for your patience!</p> </div> </div> </div> </div> <!-- end wrapper --> <footer> <div class="center"> <div style="font-weight:normal;font-style:Latin">© Aiwtd 2023</div> </div> </footer> <picture class="bg-img"> <img src="https://aiwtd.com/wp-content/uploads/2023/12/mt-sample-background.jpg"> </picture> </div> <div class="login-form-container"> <input type="hidden" id="mtnc_login_check" name="mtnc_login_check" value="758443ed1d" /><input type="hidden" name="_wp_http_referer" value="/" /><form id="login-form" class="login-form" method="post"><label>User Login</label><span class="login-error"></span><span class="licon user-icon"><input type="text" name="log" id="log" value="" size="20" class="input username" placeholder="Username" /></span><span class="picon pass-icon"><input type="password" name="pwd" id="login_password" value="" size="20" class="input password" placeholder="Password" /></span><a class="lost-pass" href="https://aiwtd.com/wp-login.php?action=lostpassword">Lost Password</a><input type="submit" class="button" name="submit" id="submit" value="Login" /><input type="hidden" name="is_custom_login" value="1" /><input type="hidden" id="mtnc_logFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · advancedtreehealth.com
2024-09-16 08:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:55:13 GMT Server: Apache X-Pingback: https://www.advancedtreehealth.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.advancedtreehealth.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.newcomfortinc.com
2024-09-16 08:54
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:54:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Nitro-Cache: MISS X-Redirect-By: WordPress Location: https://newcomfortinc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · naturallygoodlife.com
2024-09-16 08:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:53:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.naturallygoodlife.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:53:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.wholehomeandbodyhealth.com
2024-09-16 08:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:51:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wholehomeandbodyhealth.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:51:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress content-Security-Policy: upgrade-insecure-requests X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.roofsaverscolorado.com
2024-09-16 08:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:51:12 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=9427aaab4f4a34d2f11432f8003227ad; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://roofsaversco.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · yqr.bzx.mybluehost.me
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: I'm trying to live a beautiful life. Maybe I can help you do the same. — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>I'm trying to live a beautiful life. Maybe I can help you do the same. — Coming Soon</title> <script src="https://yqr.bzx.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://yqr.bzx.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://yqr.bzx.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.en.cydefi.com
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://en.cydefi.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.aysphiladelphia.com
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://aysphiladelphia.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.thematchmakingteam.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thematchmakingteam.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://thematchmakingteam.com/index.php?rest_route=/wp/v2/pages/18>; rel="alternate"; title="JSON"; type="application/json", <https://thematchmakingteam.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.tahitianinn.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tahitianinn.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:48:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 1 X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.insideoutcareer.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:31 GMT Server: Apache Vary: accept,content-type,accept-encoding,cookie Expires: Mon, 16 Sep 2024 09:48:34 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://insideoutcareer.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · nwgroutworks.com
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://nwgroutworks.com/wp-json/>; rel="https://api.w.org/", <https://nwgroutworks.com/wp-json/wp/v2/pages/27>; rel="alternate"; title="JSON"; type="application/json", <https://nwgroutworks.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · xrk.get.mybluehost.me
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://rrcompany.co/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rebushealth.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebushealth.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.fairmount-heights-org.ronhalbertproductions.com
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:24 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.fairmount-heights.org
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:20 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.mte.uzz.mybluehost.me
2024-09-16 08:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:47:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thechefdinnerclub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mah.rfn.mybluehost.me
2024-09-16 08:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thebrilliantfool.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · hkx.yek.mybluehost.me
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome to Your New Life! — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome to Your New Life! — Coming Soon</title> <script src="https://fr3domnow.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://fr3domnow.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://fr3domnow.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · whitestone.institute
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://whitestone.institute/wp-json/>; rel="https://api.w.org/", <https://whitestone.institute/wp-json/wp/v2/pages/7>; rel="alternate"; title="JSON"; type="application/json", <https://whitestone.institute/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:50:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · thesavannahoakswinery.com
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://transcendinghorizonsmarketing.com/index.php?rest_route=/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · thelifewhispers.com
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Last-Modified: Tue, 21 Nov 2023 16:27:55 GMT Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:45:03 GMT Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · digitaleyearmor.com
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://digitaleyearmor.com/wp-json/>; rel="https://api.w.org/", <https://digitaleyearmor.com/wp-json/wp/v2/pages/873>; rel="alternate"; title="JSON"; type="application/json", <https://digitaleyearmor.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-8dc5acf0.livinglifeyouthwellness.com
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:35 GMT Server: Apache Link: <https://yuo.mbc.mybluehost.me/.website_8dc5acf0/wp-json/>; rel="https://api.w.org/", <https://yuo.mbc.mybluehost.me/.website_8dc5acf0/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://yuo.mbc.mybluehost.me/.website_8dc5acf0/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.newcomfortinc.com
2024-09-16 08:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://newcomfortinc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · lauradevaisher.com
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: accept,content-type,Accept-Encoding Link: <https://lauradevaisher.com/wp-json/>; rel="https://api.w.org/", <https://lauradevaisher.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PaRRrv-4>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=4ee641b69880f48c0573f53444e03dc2; path=/ Transfer-Encoding: chunked Page title: LauraDevaisher | <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) | !(IE 8) ]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <title>LauraDevaisher | </title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://lauradevaisher.com/xmlrpc.php" /> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//v0.wordpress.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="LauraDevaisher » Feed" href="https://lauradevaisher.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="LauraDevaisher » Comments Feed" href="https://lauradevaisher.com/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v7.10.4 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No UA code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/lauradevaisher.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.bryangarde.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bryangarde.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:48:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · seefeldtlab.org
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.seefeldtlab.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.daviddtaylor.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:10 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Pragma: no-cache Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.daviddtaylor.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.isaacbutler.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:13 GMT Server: Apache X-Redirect-By: WordPress Vary: Accept-Encoding Upgrade: h2,h2c Connection: Upgrade, close Location: https://isaacbutler.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.collaborativemba.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:43:06 GMT Server: Apache Location: http://collaborativemba.org/ Content-Length: 236 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 301 Moved Permanently <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>301 Moved Permanently</title> </head><body> <h1>Moved Permanently</h1> <p>The document has moved <a href="http://collaborativemba.org/">here</a>.</p> </body></html>
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · relationalchristianity.com
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:51 GMT Server: Apache Link: <https://relationalchristianity.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: FreshWater – A Mentoring Fellowship <!DOCTYPE html> <html lang="en-US"> <head itemscope itemtype="https://schema.org/WebSite"> <meta charset="UTF-8" /> <title>FreshWater – A Mentoring Fellowship</title><meta name="description" content="A Mentoring Fellowship" /> <meta name="robots" content="noodp,noydir" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="FreshWater » Feed" href="https://relationalchristianity.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="FreshWater » Comments Feed" href="https://relationalchristianity.com/comments/feed/" /> <link rel="canonical" href="https://relationalchristianity.com/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/relationalchristianity.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.8.25"}}; !function(t,a,e){var r,i,n,o=a.createElement("canvas"),l=o.getContext&&o.getContext("2d");function c(t){var e=a.createElement("script");e.src=t,e.defer=e.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(e)}for(n=Array("flag","emoji4"),e.supports={everything:!0,everythingExceptFlag:!0},i=0;i<n.length;i++)e.supports[n[i]]=function(t){var e,a=String.fromCharCode;if(!l||!l.fillText)return!1;switch(l.clearRect(0,0,o.width,o.height),l.textBaseline="top",l.font="600 32px Arial",t){case"flag":return(l.fillText(a(55356,56826,55356,56819),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,56826,8203,55356,56819),0,0),e===o.toDataURL())?!1:(l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447),0,0),e!==o.toDataURL());case"emoji4":return l.fillText(a(55358,56794,8205,9794,65039),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55358,56794,8203,9794,65039),0,0),e!==o.toDataURL()}return!1}(n[i]),e.supports.everything=e.supports.everything&&e.supports[n[i]],"flag"!==n[i]&&(e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&e.supports[n[i]]);e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&!e.supports.flag,e.DOMReady=!1,e.readyCallback=function(){e.DOMReady=!0},e.supports.everything||(r=function(){e.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",r,!1),t.addEventListener("load",r,!1)):(t.attachEvent("onload",r),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&e.readyCallback()})),(r=e.source||{}).concatemoji?c(r.concatemoji):r.wpemoji&&r.twemoji&&(c(r.twemoji),c(r.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='altitude-pro-theme-css' href='https://relationalchristianity.com/wp-content/themes/altitude-pro/style.css?ver=1.0.0' type='text/css' media='all' /> <style id='altitude-pro-theme-inline-css' type='text/css'> .front-page-1 { background-image: url(//relationalchristianity.com/wp-content/uploads/2015/09/freshwater.jpg); }.front-page-3 { background-image: url(//relationalchristianity.com/wp-content/themes/altitude-pro/images/bg-3.jpg); }.front-page-5 { background-image: url(//relationalchristianity.com/wp-content/themes/altitude-pro/images/bg-5.jpg); }.front-page-7 { background-image: url(//relationalchristianity.com/wp-content/themes/altitude-pro/images/bg-7.Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · upro1.net
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:39 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.upro1.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.mandalainteriordesigns.com
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:27 GMT Server: Apache X-Pingback: https://mandalainteriordesigns.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://mandalainteriordesigns.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.grv.zzm.mybluehost.me
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:42:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Domain In Use — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Domain In Use — Coming Soon</title> <script src="https://domaininuse.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://domaininuse.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://domaininuse.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.middleschoolkingdom.com
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:31 GMT Server: Apache Link: <https://www.middleschoolkingdom.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Middle [School] Kingdom | Our kids go to local school in China. We hope to do it through middle school. <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <title>Middle [School] Kingdom | Our kids go to local school in China. We hope to do it through middle school.</title> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.middleschoolkingdom.com/xmlrpc.php"> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.middleschoolkingdom.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Middle [School] Kingdom » Feed" href="https://www.middleschoolkingdom.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Middle [School] Kingdom » Comments Feed" href="https://www.middleschoolkingdom.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.middleschoolkingdom.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · emmacorriganfilm.com
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:06 GMT Server: Apache Link: <https://emmacorriganfilm.com/wp-json/>; rel="https://api.w.org/", <https://emmacorriganfilm.com/wp-json/wp/v2/pages/27>; rel="alternate"; title="JSON"; type="application/json", <https://emmacorriganfilm.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:41:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.apknowledgehub.com
2024-09-16 08:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:40:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.apknowledgehub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.brandengill.com
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:21 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Branden Gill — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Branden Gill — Coming Soon</title> <script src="https://brandengill.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://brandengill.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://brandengill.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-657d527b.laelgia.com
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:11 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://laelgia.com/website_657d527b/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://laelgia.com/website_657d527b/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://laelgia.com/website_657d527b/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · rebellatrix.com
2024-09-16 08:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:39:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:39:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Rebellatrix — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Rebellatrix — Coming Soon</title> <script src="https://rebellatrix.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rebellatrix.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rebellatrix.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.emmacorriganfilm.com
2024-09-16 08:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:39:38 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://emmacorriganfilm.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:39:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · wallylambdesign.com
2024-09-16 08:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:38:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wallylambdesign.com/wp-json/>; rel="https://api.w.org/", <https://wallylambdesign.com/wp-json/wp/v2/pages/24>; rel="alternate"; title="JSON"; type="application/json", <https://wallylambdesign.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.rebellatrix.com
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebellatrix.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.kal.tdd.mybluehost.me
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitaleyearmor.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.xoi.ooe.mybluehost.me
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Jetpack-Boost-Cache: miss Vary: accept,content-type X-Redirect-By: WordPress Location: https://mindfulequanimity.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.sportsnews-swiss.ch
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sportsnews-swiss.ch/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.frontlinecustomprinting.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://frontlinecustomprinting.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.muratarslanoglu.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://muratarslanoglu.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · maxbloom.com
2024-09-16 08:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:36:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:41:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://maxbloom.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://maxbloom.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://maxbloom.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.diversifiedequipmentinc.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://www.diversifiedequipmentinc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=4c0caac88093e623597219c7b90af159; path=/
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.sewingcoursesshrewsbury.co.uk
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:35 GMT Server: Apache X-Pingback: https://sewingcoursesshrewsbury.co.uk/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://sewingcoursesshrewsbury.co.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.fiveonthego.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fiveonthego.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:41:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.demirpinar.com
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://demirpinar.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:35:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.simplyunderstood.com
2024-09-16 08:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://simplyunderstood.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · loveandwar.com
2024-09-16 08:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://loveandwar.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:38:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: HIT
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.nbtrades.com
2024-09-16 08:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:31:06 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: NBTrades.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>NBTrades.com — Coming Soon</title> <script src="https://nbtrades.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nbtrades.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nbtrades.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · micdrop.one
2024-09-16 08:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:30:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,Cookie,User-Agent Cache-Control: max-age=3600, must-revalidate Hummingbird-Cache: Served host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.iprettygirl.com
2024-09-16 08:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:30:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://i-prettybeautystudio.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:29:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · fairmount-heights.org
2024-09-16 08:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:29:36 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.yla.joe.mybluehost.me
2024-09-16 08:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:29:36 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kayleebeeckmansfotografie.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:29:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · themightyoakes.com
2024-09-16 08:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:29:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://themightyoakes.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:34:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.kassargroup2.bravaconsultancy.com
2024-09-16 08:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:29:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kassargroup.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · gabrielcybersecurity.com
2024-09-16 08:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:28:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:28:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Gabriel Gonzalez - Cyber Security — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Gabriel Gonzalez - Cyber Security — Coming Soon</title> <script src="http://gabrielcybersecurity.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://gabrielcybersecurity.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://gabrielcybersecurity.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · assertif.us
2024-09-16 08:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:24:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://assertif.us/wp-json/>; rel="https://api.w.org/", <https://assertif.us/wp-json/wp/v2/pages/7>; rel="alternate"; title="JSON"; type="application/json", <https://assertif.us/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:24:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fassertif.us%2F; expires=Mon, 14 Oct 2024 08:24:49 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.haysolar.com.au
2024-09-16 08:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:24:35 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.haysolar.com.au/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · tangerineeatery.com
2024-09-16 08:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:24:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.tangerineeatery.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:24:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · tool.plannexcg.com
2024-09-16 08:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:21:50 GMT Server: Apache Link: <https://tool.plannexcg.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:21:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.trafficfreegh.com
2024-09-16 08:20
HTTP/1.1 409 Conflict Date: Mon, 16 Sep 2024 08:20:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 83 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== <script>document.cookie = "humans_21909=1"; document.location.reload(true)</script>
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.daa.mke.mybluehost.me
2024-09-16 08:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:19:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://i-prettybeautystudio.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:19:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.bobbymoen.com
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:59 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://bobbymoen.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.embraceherflow.com
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://embraceherflow.com/xmlrpc.php X-Redirect-By: WordPress Location: https://embraceherflow.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:23:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.imdsspecialists.com
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:26 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-LiteSpeed-Tag: d9e_HTTP.200,d9e_HTTP.301 X-Redirect-By: WordPress Set-Cookie: PHPSESSID=2102737bd56d6d8bda27b59a44ddd938; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://imdsspecialists.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.monomovement.org
2024-09-16 08:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:49 GMT Server: Apache Link: <https://box5402.temp.domains/~thematc2/monomovement/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.cop.mzi.mybluehost.me
2024-09-16 08:17
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.mve.ldj.mybluehost.me
2024-09-16 08:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:17:35 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://meshhad.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:17:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.vyf.svi.mybluehost.me
2024-09-16 08:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:17:22 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: __wpdm_client=90628e4b3fc70a062acc24abc5ca5b16; path=/; secure; HttpOnly Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fprayerpointpress.com%2F; expires=Mon, 14-Oct-2024 08:17:27 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Upgrade: h2,h2c Connection: Upgrade, close Location: https://prayerpointpress.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:22:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · artjefferson.com
2024-09-16 08:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://artjefferson.com/wp-json/>; rel="https://api.w.org/", <https://artjefferson.com/wp-json/wp/v2/pages/355>; rel="alternate"; type="application/json", <https://artjefferson.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rte.qps.mybluehost.me
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:29 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:21:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: The Local Basket Case — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>The Local Basket Case — Coming Soon</title> <script src="https://thelocalbasketcase.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thelocalbasketcase.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.1.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <div id="subscribe-text"> <p>Be the first to know when we launch, enter your email address and we will let you know when we go live and any future website updates we have.</p> </div> <div id="success" class="status-message"> Thank you, please check your email to confirm your subscription. </div> <div id="error-active" class="status-message"> Your email address is already subscribed to this website. Stay tuned to your inbox for our updates or try a different email address. </div> <div id="error-invalid" class="status-message"> There was an error with your submission and you were not subscribed. Please try again with a valid email address. </div> <form action="" method="post" accept-charset="utf-8" id="subscribe"> <input type="hidden" name="action" value="newfold_coming_soon_subscribe"> <input type="hidden" id="newfold-nonce-coming-soon-subscribe" name="newfold-nonce-coming-soon-subscribe" value="0ac841d15c" /><input type="hidden" name="_wp_http_referer" value="/" /> <span class="inputs email" id="subscribe-email"> <label id="subscribe-label" for="subscribe-field"> Email </label> <input type="email" name="email" required="required" value="" id="subscribe-field" placeholder="Enter your email address" > </span> <span class="inputs submit" id="subscribe-submit"> <input class="btn" type="submit" value="Subscribe" name="subscriptions_widget"> </span> </form> <script> var ajaxscript = { ajax_url: 'https://thelocalbasketcase.com/wp-admin/admin-ajax.php' }; jQuery(document).ready(function ($) { $('#subscribe-submit input').click(function (e) { e.preventDefault(); $('#success').hide(); $('#error').hide(); var email = $('#subscribe-field').val(); var nonce = $('#newfold-nonce-coming-soon-subscribe').val(); $.ajax({ type: 'POST', url: window.ajaxscript.ajax_url, data: { 'action': 'newfold_coming_soon_subscribe', 'email': email, 'nonce': nonce }, success: function (response) { var status = response.status;Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.cometpluto.com
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:24 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: CometPluto — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>CometPluto — Coming Soon</title> <script src="https://cometpluto.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cometpluto.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cometpluto.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.tankardsaweigh.chiefsimplicityofficer.com
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:12 GMT Server: Apache Link: <https://www.tankardsaweigh.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Tankards Aweigh | Just another WordPress site <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head profile="http://gmpg.org/xfn/11"> <title>Tankards Aweigh | Just another WordPress site</title> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="robots" content="index, nofollow" /> <link rel="stylesheet" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/css/reset.css" type="text/css" /> <link rel="stylesheet" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/css/960.css" type="text/css" /> <link rel="stylesheet" type="text/css" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/style.css" media="screen" /> <link rel="alternate" type="application/rss+xml" title="RSS 2.0" href="https://www.tankardsaweigh.com/feed/" /> <link rel="pingback" href="https://www.tankardsaweigh.com/xmlrpc.php" /> <!--[if lt IE 7]> <script src="https://www.tankardsaweigh.com/wp-content/themes/tankards/includes/js/pngfix.js" type="text/javascript"></script> <link rel="stylesheet" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/css/ie6.css" type="text/css" /> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.tankardsaweigh.com' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.tankardsaweigh.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · allprofencingplus.com
2024-09-16 08:15
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://allprofencingplus.com/wp-json/>; rel="https://api.w.org/", <https://allprofencingplus.com/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://allprofencingplus.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:16:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.dyu.kzx.mybluehost.me
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:15:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cybersecurealaska.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:15:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · bizfornurses.com
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:15:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://andytheselfmade.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:15:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.karenchavez.com
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:40 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://karenchavez.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.artjefferson.com
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://artjefferson.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.uft.psw.mybluehost.me
2024-09-16 08:14
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:14:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wupple.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:14:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.teammcgloin-delevieforpsu.com
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://teammcgloin-delevieforpsu.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:14:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.kal.tdd.mybluehost.me
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitaleyearmor.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:14:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · bronxanimalhospital.com
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 08:30:06 GMT Cache-Control: max-age=3600 Location: https://www.bronxanimalhospital.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: HIT
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · inklingvideo.com
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://inklingvideo.com/wp-json/>; rel="https://api.w.org/", <https://inklingvideo.com/wp-json/wp/v2/pages/17>; rel="alternate"; title="JSON"; type="application/json", <https://inklingvideo.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.spicesindia-ca.vedictantra.ca
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: spicesindia.ca — Coming Soon <!DOCTYPE html> <html lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>spicesindia.ca — Coming Soon</title> <script src="https://spicesindia.ca/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://spicesindia.ca/wp-content/plugins/bluehost-wordpress-plugin/static/coming-soon.css?v=2.12.20" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>A New WordPress Site!</h1> <h2>Coming Soon!</h2> <a class="btn" href="https://spicesindia.ca/wp-login.php"> Admin Login </a> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com/wordpress" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://spicesindia.ca/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · pqg.ssy.mybluehost.me
2024-09-16 08:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:12:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mountainviewrecovery.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:12:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.nir.qhd.mybluehost.me
2024-09-16 08:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:11:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache cf-edge-cache: cache,platform=wordpress X-Redirect-By: WordPress Location: https://chiton.store/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:11:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.clubboring.com
2024-09-16 08:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:11:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://neurostrategiesfx.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.powerplus.tw
2024-09-16 08:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:10:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://powerplus.tw/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.myh.rwl.mybluehost.me
2024-09-16 08:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:06:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://beauheyman.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:06:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · westlakechineseacademy.org
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Last-Modified: Mon, 16 Sep 2024 07:34:35 GMT Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 08:06:38 GMT Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.gwblue-site.pkk.xvd.mybluehost.me
2024-09-16 08:05
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:05:46 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: GW Test Domain Site — Coming Soon <!DOCTYPE html> <html> <head> <meta name="viewport" content="width=device-width"> <title>GW Test Domain Site — Coming Soon</title> <script src="https://robinandvera.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url( "https://robinandvera.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/cs-bluehost-bg.jpg" ); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom:0; left:0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16px; font-size: 11px; top: 2px; } .bh_subscription_widget form .bh-inputs.email input[type="email"] { background-color: #fff; background-image: url( "https://robinandvera.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/icon-email.svg" ); background-position: 10px center; background-repeat: no-repeat; border: 1px solid #5B5B5B; border-radius: 3px; color: #5B5B5B; font-size: 11px; margin-right: 6px; min-width: 300px; padding: 14px 15px 14pxFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.muguetphotography.com
2024-09-16 08:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:05:42 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://muguetphotography.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.qarnis.lfc.twv.mybluehost.me
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:55 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.qarnis.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · theeverydayhousewife.com
2024-09-16 08:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:04:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://theeverydayhousewife.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://theeverydayhousewife.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://theeverydayhousewife.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · evecustompackaging.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:04 GMT Server: Apache Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.evepackaging.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.soo.fuh.mybluehost.me
2024-09-16 08:02
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:02:50 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://worthwhilelife.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.dmwoodturners.com
2024-09-16 08:02
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:02:46 GMT Server: Apache Link: <https://www.dmwoodturners.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.dmwoodturners.com/index.php?rest_route=/wp/v2/pages/10>; rel="alternate"; title="JSON"; type="application/json", <https://www.dmwoodturners.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Des Moines Woodturners | AAW Chapter serving central Iowa woodturners of all skill levels <!DOCTYPE html> <!--[if IE 6]> <html id="ie6" lang="en-US"> <![endif]--> <!--[if IE 7]> <html id="ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html id="ie8" lang="en-US"> <![endif]--> <!--[if !(IE 6) & !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title> Des Moines Woodturners | AAW Chapter serving central Iowa woodturners of all skill levels </title> <link rel="profile" href="https://gmpg.org/xfn/11" /> <link rel="stylesheet" type="text/css" media="all" href="https://www.dmwoodturners.com/wp-content/themes/twentyeleven/style.css?ver=20221101" /> <link rel="pingback" href="https://www.dmwoodturners.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.dmwoodturners.com/wp-content/themes/twentyeleven/js/html5.js?ver=3.7.0" type="text/javascript"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.dmwoodturners.com' /> <link rel="alternate" type="application/rss+xml" title="Des Moines Woodturners » Feed" href="https://www.dmwoodturners.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Des Moines Woodturners » Comments Feed" href="https://www.dmwoodturners.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.dmwoodturners.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supportsFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.uft.psw.mybluehost.me
2024-09-16 08:02
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:02:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wupple.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:02:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jcc.qfv.mybluehost.me
2024-09-16 07:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:59:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:59:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://fridanelkenrealestate.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://fridanelkenrealestate.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://fridanelkenrealestate.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.monomovement.org
2024-09-16 07:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:59:45 GMT Server: Apache Link: <https://box5402.temp.domains/~thematc2/monomovement/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.vivianasoto.vivianasoto.com
2024-09-16 07:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:59:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://vivianasoto.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:04:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: User-Agent,Accept-Encoding X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · isaacbutler.com
2024-09-16 07:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:59:07 GMT Server: Apache Link: <https://isaacbutler.com/wp-json/>; rel="https://api.w.org/", <https://isaacbutler.com/wp-json/wp/v2/pages/6>; rel="alternate"; type="application/json", <https://isaacbutler.com/>; rel=shortlink Vary: Accept-Encoding Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · dreamcatcherflyfishing.com
2024-09-16 07:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:57:29 GMT Server: Apache Link: <https://dreamcatcherflyfishing.com/wp-json/>; rel="https://api.w.org/", <https://dreamcatcherflyfishing.com/wp-json/wp/v2/pages/80>; rel="alternate"; type="application/json", <https://dreamcatcherflyfishing.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · fairmount-heights-org.ronhalbertproductions.com
2024-09-16 07:53
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:53:33 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.mte.uzz.mybluehost.me
2024-09-16 07:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:46:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thechefdinnerclub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:46:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.thesleepeasymethod.com
2024-09-16 07:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:44:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wholehomeandbodyhealth.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:44:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress content-Security-Policy: upgrade-insecure-requests X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.thb.bpj.mybluehost.me
2024-09-16 07:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:44:08 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:44:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://emmasteinbeckromance.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://emmasteinbeckromance.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://emmasteinbeckromance.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.mvmteam.thematchmakingteam.com
2024-09-16 07:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:43:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: mvmteam — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>mvmteam — Coming Soon</title> <script src="https://mvmteam.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://mvmteam.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.13.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://mvmteam.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.azfqhc.com
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:42:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://www.arizonaroanhorses.com/xmlrpc.php X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.arizonaroanhorses.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:47:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.wcb.tvd.mybluehost.me
2024-09-16 07:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:42:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ibahai.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:42:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.wcb.tvd.mybluehost.me
2024-09-16 07:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:42:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ibahai.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:42:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rez.lbn.mybluehost.me
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:42:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rez.lbn.mybluehost.me/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · edlanger.com
2024-09-16 07:40
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:40:19 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.edlanger.com
2024-09-16 07:40
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:40:19 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.kef.ops.mybluehost.me
2024-09-16 07:39
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:39:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.kef.ops.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.kef.ops.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.xavierguri.com
2024-09-16 07:39
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:39:24 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · annakaytolberk.com
2024-09-16 07:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:38:30 GMT Server: Apache Link: <https://annakaytolberk.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:38:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.kzt.iml.mybluehost.me
2024-09-16 07:38
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:38:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.kzt.iml.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.kzt.iml.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.aml.ano.mybluehost.me
2024-09-16 07:37
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:38:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.aml.ano.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.aml.ano.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · vgp.tta.mybluehost.me
2024-09-16 07:37
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:37:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://vgp.tta.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://vgp.tta.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.yra.wyz.mybluehost.me
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://yearroundroadcare.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.aniespizza.com
2024-09-16 07:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:36:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aniespizza.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:41:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.courtneycoffey.com
2024-09-16 07:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:36:40 GMT Server: Apache Link: <https://courtneycoffey.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://courtneycoffey.com/index.php?rest_route=/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://courtneycoffey.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:41:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.khoecungdoc.com
2024-09-16 07:35
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:35:27 GMT Server: Apache Location: http://www.khoecungdoc.com/cgi-sys/suspendedpage.cgi Content-Length: 236 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.khoecungdoc.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · dearricky.com
2024-09-16 07:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:34:46 GMT Server: Apache X-Pingback: https://dearricky.com/xmlrpc.php Link: <https://dearricky.com/wp-json/>; rel="https://api.w.org/", <https://dearricky.com/wp-json/wp/v2/pages/40>; rel="alternate"; title="JSON"; type="application/json", <https://dearricky.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:34:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.uut.thm.mybluehost.me
2024-09-16 07:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:33:31 GMT Server: Apache Location: http://www.uut.thm.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 242 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.uut.thm.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.duettoeventi.com
2024-09-16 07:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:33:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,Cookie Location: https://duettoeventi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <!-- WP Super Cache is installed but broken. The constant WPCACHEHOME must be set in the file wp-config.php and point at the WP Super Cache plugin directory. -->
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.ushoneybeehealthsurvey.info
2024-09-16 07:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:32:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ushoneybeehealthsurvey.info/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.steppinginpurpose.com
2024-09-16 07:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:32:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://steppinginpurpose.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · scottstravelblog.com
2024-09-16 07:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:31:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://scottstravelblog.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:31:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.onlinesellingsystems.us
2024-09-16 07:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:31:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://onlinesellingsystems.us/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:31:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.brainstreamhelp.com
2024-09-16 07:31
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:31:09 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.newentrepreneurontheblock.pickupabroom.com
2024-09-16 07:30
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:30:21 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · travelwithjai.com
2024-09-16 07:30
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:30:19 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.qualicumwellnesspartnersgroup.com
2024-09-16 07:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:30:15 GMT Server: Apache Link: <https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Page not found – Qualicum Wellness Partners Group <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/xmlrpc.php"> <title>Page not found – Qualicum Wellness Partners Group</title> <link rel='dns-prefetch' href='//www.qualicumwellnesspartnersgroup.yourbrainrules.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Qualicum Wellness Partners Group » Feed" href="https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Qualicum Wellness Partners Group » Comments Feed" href="https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/?feed=comments-rss2" /> <link rel='stylesheet' id='wp-block-library-css' href='https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/wp-includes/css/dist/block-library/style.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='tesseract-style-css' href='https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/wp-content/themes/TESSERACT/style.css?ver=1.0.0' type='text/css' media='all' /> <link rel='stylesheet' id='tesseract-fonts-css' href='//fonts.googleapis.com/css?family=Open%2BSans%3A400%2C300%2C300italic%2C400italic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic%26subset%3Dlatin%2Cgreek%2Cgreek-ext%2Cvietnamese%2Ccyrillic-ext%2Ccyrillic%2Clatin-ext&ver=1.0.0' type='text/css' media='all' /> <link rel='stylesheet' id='tesseract-icons-css' href='https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/wp-content/themes/TESSERACT/css/typicons.css?ver=1.0.0' type='text/css' media='all' /> <link rel='stylesheet' id='fontawesome-css' href='https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/wp-content/themes/TESSERACT/css/font-awesome.min.css?ver=4.4.0' type='text/css' media='all' /> <link rel='stylesheet' id='tesseract-site-banner-css' href='https://www.qualicumwellnesspartnersgroup.yourbrainrules.com/wp-content/themes/TESSERACT/css/site-banner.css?ver=1.0.0' type='text/css' media='all' /> <style id='tesseract-site-banner-inline-css' type='text/css'> .site-header, .main-navigation ul ul a, #header-right-menu ul ul a, .site-header .cart-content-details { background-color: rgb(89, 188, 217); } .site-header .cart-content-details:after { border-bottom-color: rgb(89, 188, 217); } .home .site-header, .home .main-navigation ul ul a, .home #header-right ul ul a, .home .site-header .cart-content-details { background-color: rgba(89, 188, 217, 1); } .home .site-header .cart-content-details:after { border-bottom-color: rgba(89, 188, 217, 1); } .site-header, .site-header h1, .site-header h2, .site-header h3, .site-header h4, .site-header h5, .site-header h6 { color: #ffffff!important; } #masthead .search-field { color: #ffffff; } #masthead .search-field.watermark { color: #ccc; } .site-header a, .main-navigation ul ul a, #header-right-menu ul ul a, .menu-open, .dashicons.menu-open, .menu-close, .dashicons.menu-close { color: #ffffff; } .site-header a:hover, .main-navigation ul ul a:hover, #header-right-menu ul ul a:hover, .menu-open:hover, .dashicons.menu-open:hover, .menu-close:hover, .dashicons.menu-open:hover { color: #d1ecff; } /* Header logo height */ #site-banner .site-logo img { height: 40px; } #masthead { padding-top: 10px; padding-bottom: 10px; } /* Header width props */ #site-banner-left { width: 60%; } #site-banner-right { width: 40%; } #site-banner { max-width: 100%; padding-left: 0; padding-right: 0; } .icon-shopping-cart, .woocart-header .cart-arrow, .woocart-header .cart-contents { color: #fff; } </style> <link rel='stylesheet' id='tesseract-footer-banner-css' href='https://www.qualicumwellnFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.whynotgifted.com
2024-09-16 07:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:29:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://whynotgifted.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:29:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.aidealsandoffers.com
2024-09-16 07:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:29:49 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.aidealsandoffers.pickupabroom.com
2024-09-16 07:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:29:33 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ivuerobotics.com
2024-09-16 07:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:27:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ivuerobotics.com/wp-json/>; rel="https://api.w.org/", <https://ivuerobotics.com/wp-json/wp/v2/pages/2616>; rel="alternate"; title="JSON"; type="application/json", <https://ivuerobotics.com/>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://ivuerobotics.com/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://ivuerobotics.com Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:27:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.cdc.jvd.mybluehost.me
2024-09-16 07:26
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:26:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.cdc.jvd.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.cdc.jvd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.charlesjmorganmdpsychiatry.com
2024-09-16 07:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:26:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://charlesjmorganmdpsychiatry.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:26:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.website-3c332e22.xly.czh.mybluehost.me
2024-09-16 07:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:25:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cadeauchocolat.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · wfh.tdd.mybluehost.me
2024-09-16 07:24
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rfimagingandcommunications.com
2024-09-16 07:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:24:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type Expires: Mon, 16 Sep 2024 08:24:43 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://rfimagingandcommunications.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_woocommerce_session_99aad0bfc41bef935c7b8f7c65b0178f=f3f1471033a5c5c1d80b07e3e31a36a0%7C%7C1726644282%7C%7C1726640682%7C%7Cd7729695e6a35c500a44e436a002eaac; expires=Wed, 18-Sep-2024 07:24:42 GMT; Max-Age=172800; path=/; secure; HttpOnly Set-Cookie: yith_ywraq_session_99aad0bfc41bef935c7b8f7c65b0178f=f6c83d5762bceaa862274907af978737%7C%7C1726644282%7C%7C1726640682%7C%7C1974890c79bea2356a64d79128e39b76; expires=Wed, 18-Sep-2024 07:24:42 GMT; Max-Age=172799; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.michaelklotz.mkadvisory.com
2024-09-16 07:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:24:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://michaelklotz.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:29:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.primroseground.nlyh.org
2024-09-16 07:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:23:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://primroseground.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.collaborativemba.org
2024-09-16 07:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:23:27 GMT Server: Apache Link: <https://collaborativemba.org/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Collaborative MBA | Home <!doctype html> <!-- paulirish.com/2008/conditional-stylesheets-vs-css-hacks-answer-neither/ --> <!--[if lt IE 7 ]> <html class="no-js ie6" lang="en"> <![endif]--> <!--[if IE 7 ]> <html class="no-js ie7" lang="en"> <![endif]--> <!--[if IE 8 ]> <html class="no-js ie8" lang="en"> <![endif]--> <!--[if (gte IE 9)|!(IE)]><!--> <html class="no-js" lang="en" xmlns:og="http://ogp.me/ns#" xmlns:fb="http://www.facebook.com/2008/fbml"> <!--<![endif]--> <head> <!-- Global site tag (gtag.js) - Google Analytics --> <script async src="https://www.googletagmanager.com/gtag/js?id=UA-110406831-1"></script> <script> window.dataLayer = window.dataLayer || []; function gtag(){dataLayer.push(arguments);} gtag('js', new Date()); gtag('config', 'UA-110406831-1'); </script> <meta charset="utf-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> <meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=5"> <title>Collaborative MBA | Home</title> <meta name="description" content="A joint MBA program promoting leadership for the common good"> <link rel="stylesheet" href="https://collaborativemba.org/wp-content/themes/_Collaborative-MBA/style.css" type="text/css" media="screen" /> <link rel="icon" type="image/x-icon" href="https://collaborativemba.org/wp-content/themes/_Collaborative-MBA/images/favicon.ico"> <link rel="apple-touch-icon" href="https://collaborativemba.org/wp-content/themes/_Collaborative-MBA/images/apple-touch-icon.png" /> <script src="//use.edgefonts.net/source-sans-pro:n2,i2,n3,i3,n4,i4,n6,i6,n7,i7,n9,i9.js"></script> </head> <body> <script> (function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){ (i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*new Date();a=s.createElement(o), m=s.getElementsByTagName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m) })(window,document,'script','//www.google-analytics.com/analytics.js','ga'); ga('create', 'UA-48291134-1', 'collaborativemba.org'); ga('send', 'pageview'); </script> <header> <div class="fixedTop"> <div class="wrap"> <a href="https://collaborativemba.org/admissions/requirements/" class="apply">APPLY<br> NOW</a> <a href="https://www.facebook.com/CollaborativeMBA/" class="facebook" target="_blank"><img src="https://collaborativemba.org/wp-content/themes/_Collaborative-MBA/images/facebook.png" width="30" height="30" alt="The Collaborative MBA on Facebook"></a> <a href="https://collaborativemba.org" class="logo"></a> <div class="buttons"> <div class="hamburger" id="hamburger"></div> <a href="https://collaborativemba.org/faq"><button>FAQ</button></a> <a href="https://collaborativemba.org/contact"><button>CONTACT</button></a> <div class="search"> <form role="search" method="get" id="searchform" action="https://collaborativemba.org/"> <div><label class="screen-reader-text" for="s"></label> <input type="text" value="" name="s" id="s" placeholder="search"/> </div> </form> </div> </div> </div><!-- wrap --> <div class="searchTail"></div> </div> <!-- fixedTop --> <div class="banner"></div> <div class="wrap"> <nav> <div class="menu-main-menu-container"><ul id="menu-main-menu" class="menu"><li id="menu-item-973" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-973"><a href="https://collaborativemba.org/about/">About</a> <ul class="sub-menu"> <li id="menu-item-85" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-85"><a href="https://collaborativemba.org/about/leadership-for-the-common-good/">Leadership for the Common Good</a></li> <li id="menu-item-88" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-88"><a href="https://collaborativemba.org/about/program-values/">Program Values</a></li> <li id="menu-item-44" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-44"><a href="https://collaborativemba.org/about/flexibility/">Flexibility</a></li> <li id="menu-item-95" class="menu-item menu-Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tce.qby.mybluehost.me
2024-09-16 07:21
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:21:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.tce.qby.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.tce.qby.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · sxj.mhd.mybluehost.me
2024-09-16 07:20
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:20:50 GMT Server: Apache Location: http://sxj.mhd.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 238 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://sxj.mhd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.zekca.com.hk
2024-09-16 07:20
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:20:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 235 Location: https://mail.zekca.com.hk/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.zekca.com.hk/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · qas.wbq.mybluehost.me
2024-09-16 07:19
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:20:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://qas.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://qas.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · anothersunnyday.us
2024-09-16 07:19
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 07:19:03 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Another Sunny Day — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Another Sunny Day — Coming Soon</title> <script src="https://anothersunnyday.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://anothersunnyday.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://anothersunnyday.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.uponaboard.com
2024-09-16 07:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:18:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://uponaboard.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tripsactions.online
2024-09-16 07:18
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:18:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: https://mail.tripsactions.online/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.tripsactions.online/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.aze.zhc.mybluehost.me
2024-09-16 07:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:17:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://easyrecruitnow.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:17:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.projectevan.com
2024-09-16 07:17
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:17:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 237 Location: https://www.projectevan.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.projectevan.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.zog.ufe.mybluehost.me
2024-09-16 07:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:17:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Pragma: no-cache X-UA-Compatible: IE=edge Expires: Mon, 16 Sep 2024 08:17:13 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://micdrop.one/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: User-Agent X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=84e95185e5cc4c59a62bd020d375f6a7; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.zpv.ops.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · zpv.ops.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: http://zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.zpv.ops.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.wrv.ops.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.wrv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.wrv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.wrv.ops.mybluehost.me
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.wrv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.wrv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.havefridayeveryday.com
2024-09-16 07:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:15:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://havefridayeveryday.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:15:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · fgt.wgl.mybluehost.me
2024-09-16 07:14
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:14:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://fgt.wgl.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://fgt.wgl.mybluehost.me/wp-json/wp/v2/pages/29>; rel="alternate"; title="JSON"; type="application/json", <https://fgt.wgl.mybluehost.me/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.havefridayeveryday.com
2024-09-16 07:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:14:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://havefridayeveryday.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:14:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · fjj.duj.mybluehost.me
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:23 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 2249 Last-Modified: Sat, 14 Oct 2023 00:25:12 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="http://fjj.duj.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://fjj.duj.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.3.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="http://fjj.duj.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html> <!--Generated by Newfold Page Cache-->Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · atentinthewoods.com
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://atentinthewoods.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://atentinthewoods.com/index.php?rest_route=/wp/v2/pages/84>; rel="alternate"; title="JSON"; type="application/json", <https://atentinthewoods.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:18:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.fridanelkenrealestate.com
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fridanelkenrealestate.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ctmracing.com
2024-09-16 07:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:12:14 GMT Server: Apache Link: <https://ctmracing.com/wp-json/>; rel="https://api.w.org/", <https://ctmracing.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: CTM Racing <!DOCTYPE html> <html class="" lang="en-US" prefix="og: http://ogp.me/ns# fb: http://ogp.me/ns/fb#"> <head> <meta http-equiv="X-UA-Compatible" content="IE=edge" /> <meta http-equiv="Content-Type" content="text/html; charset=utf-8"/> <meta name="viewport" content="width=device-width, initial-scale=1" /> <title>CTM Racing</title> <meta name='robots' content='noindex,follow' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="CTM Racing » Feed" href="https://ctmracing.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="CTM Racing » Comments Feed" href="https://ctmracing.com/comments/feed/" /> <!-- For iPad Retina display --> <link rel="apple-touch-icon-precomposed" sizes="144x144" href=""> <meta property="og:title" content="Landing Page"/> <meta property="og:type" content="article"/> <meta property="og:url" content="https://ctmracing.com/"/> <meta property="og:site_name" content="CTM Racing"/> <meta property="og:description" content="We moved to a new location! CTM Racing Products, Inc. 9338 Bond Avenue El Cajon, CA 92021 Get Directions Phone: 619-334-9166 Fax: 619-334-9170 info@ctmracing.com Our new website will be coming soon."/> <meta property="og:image" content="http://ctmracing.com/wp-content/uploads/2016/12/ctmlogo.png"/> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/ctmracing.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.7.29"}}; !function(t,a,e){var r,n,i,o=a.createElement("canvas"),l=o.getContext&&o.getContext("2d");function c(t){var e=a.createElement("script");e.src=t,e.defer=e.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(e)}for(i=Array("flag","emoji4"),e.supports={everything:!0,everythingExceptFlag:!0},n=0;n<i.length;n++)e.supports[i[n]]=function(t){var e,a=String.fromCharCode;if(!l||!l.fillText)return!1;switch(l.clearRect(0,0,o.width,o.height),l.textBaseline="top",l.font="600 32px Arial",t){case"flag":return(l.fillText(a(55356,56826,55356,56819),0,0),o.toDataURL().length<3e3)?!1:(l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,65039,8205,55356,57096),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,55356,57096),0,0),e!==o.toDataURL());case"emoji4":return l.fillText(a(55357,56425,55356,57341,8205,55357,56507),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55357,56425,55356,57341,55357,56507),0,0),e!==o.toDataURL()}return!1}(i[n]),e.supports.everything=e.supports.everything&&e.supports[i[n]],"flag"!==i[n]&&(e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&e.supports[i[n]]);e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&!e.supports.flag,e.DOMReady=!1,e.readyCallback=function(){e.DOMReady=!0},e.supports.everything||(r=function(){e.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",r,!1),t.addEventListener("load",r,!1)):(t.attachEvent("onload",r),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&e.readyCallback()})),(r=e.source||{}).concatemoji?c(r.concatemoji):r.wpemoji&&r.twemoji&&(c(r.twemoji),c(r.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='avada-stylesheet-css' href='https://ctmracing.com/wp-content/themes/Avada/assets/css/style.min.css?ver=5.0.6' type='text/css' media='all' /> <link rel='stylesheet' id='child-style-css' href='https://ctmracing.com/wp-content/themes/CTM-ChilFound 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.training-ground.bluehivecreative.com
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:58 GMT Server: Apache X-Pingback: https://training-ground.com/xmlrpc.php X-UA-Compatible: IE=edge X-Redirect-By: WordPress Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 07:10:59 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://training-ground.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.showmefreight.com
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:57 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://showmefreight.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · nuthatchleos.com
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:52 GMT Server: Apache X-Pingback: https://www.nuthatchleos.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.nuthatchleos.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.laelgia.com
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://laelgia.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.analyticallens.com
2024-09-16 07:10
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:33 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:15:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Analytical Lens — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Analytical Lens — Coming Soon</title> <script src="https://analyticallens.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://analyticallens.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://analyticallens.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · clintfirstbaptist.org
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:09 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.clintfirstbaptist.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · caosville.com
2024-09-16 07:10
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:06 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://caosville.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/6Mf6q>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.mkadvisory.com
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:03 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://mkadvisory.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · parentsmakinganinvestment.com
2024-09-16 07:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:09:30 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://parentsmakinganinvestment.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/akDc9>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.nmk.dhy.mybluehost.me
2024-09-16 07:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:09:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wowexpress.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:09:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · prepamasters-com.mte.uzz.mybluehost.me
2024-09-16 07:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:09:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://prepamasters.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:09:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.beginagain.site
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:52 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://beginagain.site/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.inspirednationonline.com
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://inspirednationonline.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.outtaroad.com
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://outtaroad.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ipt.wgl.mybluehost.me
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: spircen.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>spircen.com — Coming Soon</title> <script src="https://spircen.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://spircen.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://spircen.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.bryangarde.on-garde.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bryangarde.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.ashotofpetrone.transcendinghorizonsmarketing.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ashotofpetrone.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: apbct_timestamp=1726470458; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_site_landing_ts=1726470458; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_page_hits=1; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_cookies_test=%257B%2522cookies_names%2522%253A%255B%2522apbct_timestamp%2522%252C%2522apbct_site_landing_ts%2522%252C%2522apbct_page_hits%2522%255D%252C%2522check_value%2522%253A%2522e1d6a243c6bf80c56862970322f196ed%2522%257D; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_site_referer=UNKNOWN; expires=Thu, 19 Sep 2024 07:07:38 GMT; Max-Age=259200; path=/; domain=ashotofpetrone.com; secure; HttpOnly; SameSite=Lax Set-Cookie: ct_sfw_pass_key=c00d15c642ae2d83c5cdcff0fbce63280; expires=Wed, 16 Oct 2024 07:07:38 GMT; Max-Age=2592000; path=/; secure; SameSite=Lax Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.alphabetcorner.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alphabetcorner.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.littrellelectric.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.littrellelectric.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.alabamadrivethroughtesting.gandtideas.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:08 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://alabamadrivethroughtesting.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://alabamadrivethroughtesting.com/index.php?rest_route=/wp/v2/pages/36>; rel="alternate"; type="application/json", <https://alabamadrivethroughtesting.com/>; rel=shortlink Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 07:07:09 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.bizfornurses.com
2024-09-16 07:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:06:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://andytheselfmade.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.drdeborahlevy.com.au
2024-09-16 07:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:06:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.drdeblevy.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:11:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · canadaimmihelps.com
2024-09-16 07:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:06:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://canadaimmihelps.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · buloy.nh-bluehost3.com
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://buloy.nh-bluehost3.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · umx.hsk.mybluehost.me
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://christianfiction101.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://christianfiction101.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://christianfiction101.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.tjw.bjl.mybluehost.me
2024-09-16 07:06
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:06:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.tjw.bjl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.tjw.bjl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · advancetreehealth.com
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:54 GMT Server: Apache X-Pingback: https://www.advancedtreehealth.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.advancedtreehealth.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.njj.ano.mybluehost.me
2024-09-16 07:05
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:05:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.njj.ano.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.njj.ano.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · doorbustersale.thematchmakingteam.com
2024-09-16 07:05
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 07:05:51 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: DoorBusterSale — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>DoorBusterSale — Coming Soon</title> <script src="https://doorbustersale.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://doorbustersale.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://doorbustersale.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.artsbiotica.com
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:41 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://artsbiotica.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.discgolfaround.com
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://discgolfaround.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.elevatedbecoming.com
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://elevatedbecoming.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · triginc.org
2024-09-16 07:05
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:05:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://triginc.org/wp-json/>; rel="https://api.w.org/", <https://triginc.org/wp-json/wp/v2/pages/521>; rel="alternate"; title="JSON"; type="application/json", <https://triginc.org/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:10:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · levinsonforeastpenn.org
2024-09-16 07:05
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.laelgia.com
2024-09-16 07:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:05:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://laelgia.com/wp-json/>; rel="https://api.w.org/" Content-Security-Policy: upgrade-insecure-requests Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mandeepstratigies.com
2024-09-16 07:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:04:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mandeepstratigies.com/wp-json/>; rel="https://api.w.org/", <https://mandeepstratigies.com/wp-json/wp/v2/pages/36>; rel="alternate"; title="JSON"; type="application/json", <https://mandeepstratigies.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ivuemedia.com
2024-09-16 07:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:04:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ivuemedia.com/wp-json/>; rel="https://api.w.org/", <https://ivuemedia.com/wp-json/wp/v2/pages/2039>; rel="alternate"; title="JSON"; type="application/json", <https://ivuemedia.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · bahaiteacher.org
2024-09-16 07:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:04:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://bahaiteacher.org/wp-json/>; rel="https://api.w.org/", <https://bahaiteacher.org/wp-json/wp/v2/pages/116>; rel="alternate"; title="JSON"; type="application/json", <https://bahaiteacher.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.sportsgematria.com
2024-09-16 07:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:04:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://gematriasports.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/bfD2n>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:09:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fgematriasports.com%2F; expires=Mon, 14 Oct 2024 07:04:43 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · prodermalwellness.spircen.com
2024-09-16 07:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:04:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:09:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: prodermalwellness.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>prodermalwellness.com — Coming Soon</title> <script src="https://prodermalwellness.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://prodermalwellness.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://prodermalwellness.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.matjararabi.net
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://matjararabi.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.siliangz.com
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://siliangz.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.sxj.mhd.mybluehost.me
2024-09-16 07:04
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:04:03 GMT Server: Apache Location: https://www.sxj.mhd.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 243 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.sxj.mhd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.rodnreelfishing.com
2024-09-16 07:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rodnreelfishing.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.evr.ths.mybluehost.me
2024-09-16 07:03
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.irevealhealth.com
2024-09-16 07:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:03:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://irevealhealth.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.worklikeagirl.co
2024-09-16 07:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:03:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://worklikeagirl.co/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:03:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.zpv.ops.mybluehost.me
2024-09-16 07:03
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:03:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.zpv.ops.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.kassargroup.com
2024-09-16 07:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:03:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kassargroup.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.ykl.thm.mybluehost.me
2024-09-16 07:03
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:03:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.ykl.thm.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.ykl.thm.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.lwolfeauthor.com
2024-09-16 07:02
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:02:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: https://www.lwolfeauthor.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.lwolfeauthor.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tjw.bjl.mybluehost.me
2024-09-16 07:02
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:02:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.tjw.bjl.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.tjw.bjl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.belottieros.com
2024-09-16 07:02
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:02:18 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.heraextension.com
2024-09-16 07:01
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:01:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://heraextension.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:01:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.uaj.tdd.mybluehost.me
2024-09-16 07:01
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:01:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://uaj.tdd.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:01:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.szf.rxg.mybluehost.me
2024-09-16 07:01
HTTP/1.1 403 Forbidden Date: Mon, 16 Sep 2024 07:01:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 318 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 403 Forbidden <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>403 Forbidden</title> </head><body> <h1>Forbidden</h1> <p>You don't have permission to access this resource.</p> <p>Additionally, a 403 Forbidden error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.shrineandrepublic.com
2024-09-16 07:00
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 07:00:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Connection: close
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · nnh.zbc.mybluehost.me
2024-09-16 07:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:00:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: https://nnh.zbc.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:00:30 GMT X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 301 Moved Permanently <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>301 Moved Permanently</title> </head><body> <h1>Moved Permanently</h1> <p>The document has moved <a href="https://nnh.zbc.mybluehost.me/">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.legaceeproductions.com
2024-09-16 07:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:00:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.legaceeproductions.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:00:30 GMT X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 301 Moved Permanently <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>301 Moved Permanently</title> </head><body> <h1>Moved Permanently</h1> <p>The document has moved <a href="https://www.legaceeproductions.com/">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.legaceeproductions.com
2024-09-16 07:00
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · easyrecruitnow.com
2024-09-16 06:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:59:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://easyrecruitnow.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:59:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · leesoverseas.com
2024-09-16 06:59
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:59:37 GMT Server: Apache Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 30 May 2023 03:26:18 GMT Accept-Ranges: bytes Content-Length: 802 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Type: text/html Page title: LEES | Overseas Delights <!doctype html><html lang="en"><head><meta charset="utf-8"/><link rel="icon" href="/favicon.ico"/><meta name="viewport" content="width=device-width,initial-scale=1"/><meta name="theme-color" content="#000000"/><meta name="description" content="Web site created using create-react-app"/><link rel="apple-touch-icon" href="/logo192.png"/><link rel="manifest" href="/manifest.json"/><link href="https://cdn.jsdelivr.net/npm/bootstrap@5.2.0/dist/css/bootstrap.min.css" rel="stylesheet" integrity="sha384-gH2yIJqKdNHPEq0n4Mqa/HGKIhSkIHeL5AyhkYV8i59U5AR6csBvApHHNl/vI1Bx" crossorigin="anonymous"><title>LEES | Overseas Delights</title><script defer="defer" src="/static/js/main.604c8a71.js"></script><link href="/static/css/main.1d85db38.css" rel="stylesheet"></head><body><div id="root"></div></body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.pqg.ssy.mybluehost.me
2024-09-16 06:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:59:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mountainviewrecovery.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:59:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jnoblespeak.com
2024-09-16 06:59
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:59:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: https://mail.jnoblespeak.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.jnoblespeak.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · imperepoxy.com
2024-09-16 06:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:59:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://imperepoxy.com/wp-json/>; rel="https://api.w.org/", <https://imperepoxy.com/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://imperepoxy.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:04:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.gbb.tdd.mybluehost.me
2024-09-16 06:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:58:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://centradex.co/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:58:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · www.gdd.cjs.mybluehost.me
2024-09-16 06:58
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:58:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.gdd.cjs.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.gdd.cjs.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.fotografia-gallery.com
2024-09-16 06:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:58:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-cache, private Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: XSRF-TOKEN=eyJpdiI6IjROcXRtNnpXUEdsaWZydmpIRVI5QXc9PSIsInZhbHVlIjoiUTF3dHVsOE1LWVRUVXl0K29JUFA4bXlhODM1cmNMb3k0SXExYlZVU01UTFZ4eG1tYWVuaVlrMDl4cmkzRFcwaTdUN3FRSVE4RG9Vcjh3UXBPZzJxWEZVQXM3WEZkbHJ4WUlLb1dCbHVjcXFPekJVT3Q1eWtSNkhNKzFKbkxEZjMiLCJtYWMiOiJlOWI1YzdmN2Y2MWEzYTc1NTQ1ZmVjMzdjZmZlNzY2YTU5OGM1Yjc5OTJkMTNmNjRlMmY4NDFlM2Q5OTE2YjI4IiwidGFnIjoiIn0%3D; expires=Mon, 16 Sep 2024 08:58:19 GMT; Max-Age=7200; path=/; secure Set-Cookie: laravel_session=eyJpdiI6IjdqTGJsWlJjNURrSDNvTW1DSjUyZEE9PSIsInZhbHVlIjoidHRCemdMQWF2bm12Z0thRU4wNnBhNTdPbUZ6ZUFibjE5VzFlWG1wa1NudjVmZU1pd2U1RFRodW12WDdyQW84Z2RSUllVRjBzZkVsQ0lpaWRXZGJJVUQxRXROajl0eC9Ed3ZRY2VWM1RkclN0cVhMcnowWWIxUld0TkRPUWhzb1EiLCJtYWMiOiIwYTc5ZjFjODhkYmY2NmRhMWU0OTEyZGE3MDI5NzI0MjdjNDE4YTI2MWJjZjAyMzc0MjA1ODQ0Njk4OTFkZWQxIiwidGFnIjoiIn0%3D; expires=Mon, 16 Sep 2024 08:58:19 GMT; Max-Age=7200; path=/; httponly Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.tmh.qdt.mybluehost.me
2024-09-16 06:58
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:58:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.tmh.qdt.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.tmh.qdt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mte.uzz.mybluehost.me
2024-09-16 06:57
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:57:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thechefdinnerclub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:57:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.thebridgechristianpodcast.thebridgechristianfellowshipteachings.com
2024-09-16 06:57
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:57:33 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · journalofpornography.com
2024-09-16 06:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:57:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:56:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: The New England Journal of Pornography — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>The New England Journal of Pornography — Coming Soon</title> <script src="https://journalofpornography.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://journalofpornography.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://journalofpornography.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.schindlerscrapandsalvage.schindlerengineering.com
2024-09-16 06:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:56:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://schindlerscrapandsalvage.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:56:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.ste.tdd.mybluehost.me
2024-09-16 06:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:56:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pedgeaccounting.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:55:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · allboybootytrain.com
2024-09-16 06:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:55:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: ALL BOY BOOTY TRAIN — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>ALL BOY BOOTY TRAIN — Coming Soon</title> <script src="https://allboybootytrain.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://allboybootytrain.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://allboybootytrain.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · erd1music.com
2024-09-16 06:55
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:55:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 231 Location: https://erd1music.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://erd1music.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.zenithsolutionsnm.com
2024-09-16 06:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:55:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zenithsolutionsnm.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:55:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.decghana.org
2024-09-16 06:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:55:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://decghana.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:55:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tmh.qdt.mybluehost.me
2024-09-16 06:55
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:55:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.tmh.qdt.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.tmh.qdt.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tmx.bpj.mybluehost.me
2024-09-16 06:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:55:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:55:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tmx.bpj.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tmx.bpj.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tmx.bpj.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · opulent.gold
2024-09-16 06:54
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:54:36 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 192147 Vary: User-Agent,Accept-Encoding Accept-Ranges: bytes Cache-Control: max-age=3600, public Expires: Mon, 16 Sep 2024 06:54:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress x-speedycache-source: Server Cache-Tag: opulent.gold CDN-Cache-Control: max-age=2592000 Pragma: public X-Server-Cache: true X-Proxy-Cache: MISS Page title: Opulent Gold – Luxury Opulent Gold jewelry pieces <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <title>Opulent Gold – Luxury Opulent Gold jewelry pieces</title> <link rel="alternate" type="application/rss+xml" title="Opulent Gold » Feed" href="https://opulent.gold/feed/" /> <link rel="alternate" type="application/rss+xml" title="Opulent Gold » Comments Feed" href="https://opulent.gold/comments/feed/" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/opulent.gold\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.1"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); </script> <link rel='stylesheet' id='astra-theme-css-css' href='https://opulent.gold/wp-content/themes/astra/assets/css/minified/main.min.css?ver=4.6.14' media='all' /> <style id='astra-theme-css-inline-css'> :root{--ast-post-nav-space:0;--ast-container-default-xlg-padding:2.5em;--ast-container-default-lg-padding:2.5em;--ast-container-defaulFound 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.thesaltypaddle.com
2024-09-16 06:54
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:54:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Pingback: https://thesaltypaddle.com/xmlrpc.php X-Redirect-By: WordPress Location: https://thesaltypaddle.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:54:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== content-Security-Policy: upgrade-insecure-requests X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.funeka-shop.com
2024-09-16 06:54
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:54:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 237 Location: https://www.funeka-shop.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.funeka-shop.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · funeka-shop.com
2024-09-16 06:52
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:52:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 232 Location: http://funeka-shop.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://funeka-shop.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.digitaleyearmor.com
2024-09-16 06:52
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:52:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitaleyearmor.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:52:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · tmx.bpj.mybluehost.me
2024-09-16 06:51
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jacksoneducationservices.com
2024-09-16 06:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:51:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 07:51:43 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://jacksoneducationservices.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.jacksoneducationservices.com
2024-09-16 06:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:51:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 07:51:43 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://jacksoneducationservices.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jacksoneducationservices.com
2024-09-16 06:51
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.plantbookusa.com
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: http://mail.plantbookusa.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.plantbookusa.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · weddings.bluehivecreative.com
2024-09-16 06:50
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:50:59 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 115522 Vary: User-Agent,Accept-Encoding Accept-Ranges: bytes Cache-Control: max-age=3600, public Expires: Mon, 16 Sep 2024 08:50:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 x-speedycache-source: Server Cache-Tag: weddings.bluehivecreative.com CDN-Cache-Control: max-age=2592000 Pragma: public X-Server-Cache: true X-Proxy-Cache: MISS Page title: Blue Hive Creative Weddings – Blue Hive Creative Weddings <!DOCTYPE html> <html lang="en-US"> <head itemscope="itemscope" itemtype="http://schema.org/WebSite"> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <link rel="profile" href="https://gmpg.org/xfn/11"> <meta name="mobile-web-app-capable" content="yes"> <meta name="apple-mobile-web-app-capable" content="yes"> <meta name="apple-mobile-web-app-title" content="Blue Hive Creative Weddings - Blue Hive Creative Weddings"> <link rel="pingback" href="https://weddings.bluehivecreative.com/xmlrpc.php" /> <title>Blue Hive Creative Weddings – Blue Hive Creative Weddings</title> <script type="text/javascript"> var WebFontConfig = WebFontConfig || {}; WebFontConfig['active'] = function() { if ( typeof ( window.jQuery ) !== 'undefined' ) { jQuery(window).trigger('liquid_async_fonts_active'); } }; WebFontConfig['inactive'] = function() { if ( typeof ( window.jQuery ) !== 'undefined' ) { jQuery(window).trigger('liquid_async_fonts_inactive'); } }; </script> <meta name='robots' content='max-image-preview:large' /> <meta itemprop="name" content="Blue Hive Creative Weddings" /> <meta itemprop="url" content="https://weddings.bluehivecreative.com/" /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Blue Hive Creative Weddings » Feed" href="https://weddings.bluehivecreative.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Blue Hive Creative Weddings » Comments Feed" href="https://weddings.bluehivecreative.com/comments/feed/" /> <link rel="preload" href="https://weddings.bluehivecreative.com/wp-content/themes/hub/assets/vendors/liquid-icon/lqd-essentials/fonts/lqd-essentials.woff2" as="font" type="font/woff2" crossorigin><script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/weddings.bluehivecreative.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.1"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)returFound 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.plantbookusa.com
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: https://www.plantbookusa.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.plantbookusa.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · gdd.cjs.mybluehost.me
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://gdd.cjs.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://gdd.cjs.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.rtv.cup.mybluehost.me
2024-09-16 06:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:48:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zenithsolutionsnm.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:48:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.leesoverseas.com
2024-09-16 06:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:48:21 GMT Server: Apache Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 30 May 2023 03:26:18 GMT Accept-Ranges: bytes Content-Length: 802 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Type: text/html Page title: LEES | Overseas Delights <!doctype html><html lang="en"><head><meta charset="utf-8"/><link rel="icon" href="/favicon.ico"/><meta name="viewport" content="width=device-width,initial-scale=1"/><meta name="theme-color" content="#000000"/><meta name="description" content="Web site created using create-react-app"/><link rel="apple-touch-icon" href="/logo192.png"/><link rel="manifest" href="/manifest.json"/><link href="https://cdn.jsdelivr.net/npm/bootstrap@5.2.0/dist/css/bootstrap.min.css" rel="stylesheet" integrity="sha384-gH2yIJqKdNHPEq0n4Mqa/HGKIhSkIHeL5AyhkYV8i59U5AR6csBvApHHNl/vI1Bx" crossorigin="anonymous"><title>LEES | Overseas Delights</title><script defer="defer" src="/static/js/main.604c8a71.js"></script><link href="/static/css/main.1d85db38.css" rel="stylesheet"></head><body><div id="root"></div></body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · eaviationnews.com
2024-09-16 06:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:47:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://eaviationnews.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://eaviationnews.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://eaviationnews.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.annakaytolberk.com
2024-09-16 06:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:47:06 GMT Server: Apache Link: <https://annakaytolberk.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:47:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.balconyguide.com
2024-09-16 06:46
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:46:20 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.dronesivue.ivuerobotics.com
2024-09-16 06:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:45:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.dronesivue.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:45:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 06:45:41 GMT; Max-Age=315360000; path=/
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.prayerpointpress.vyf.svi.mybluehost.me
2024-09-16 06:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:45:19 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Mon, 16 Sep 2024 06:41:05 GMT Accept-Ranges: bytes Content-Length: 771158 Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:45:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Newfold-Cache-Level: 2 X-nginx-cache: WordPress Content-Type: text/html Page title: Prayer Resources – Connect To God's Heart – Prayer Point Press <!DOCTYPE html> <!--[if lt IE 7]> <html class="no-js ie lt-ie9 lt-ie8 lt-ie7" lang="en-US"> <![endif]--> <!--[if IE 7]> <html class="no-js ie lt-ie9 lt-ie8" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="no-js ie lt-ie9" lang="en-US"> <![endif]--> <!--[if gt IE 8]> <html class="no-js ie lt-ie10" lang="en-US"> <![endif]--> <!--[if gt IE 9]><!--> <html class="no-ie" lang="en-US"> <!--<![endif]--> <head> <meta charset="utf-8"> <link rel="icon" type="image/png" href="https://prayerpointpress.com/wp-content/uploads/2019/04/Prayer-Point-Logo-Black-copy.png" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <!--[if lte IE 9]> <script src="https://prayerpointpress.com/wp-content/themes/dfd-ronneby/assets/js/html5shiv.js"></script> <![endif]--> <!--[if lte IE 8]> <script src="https://prayerpointpress.com/wp-content/themes/dfd-ronneby/assets/js/excanvas.compiled.js"></script> <![endif]--> <link rel="alternate" type="application/rss+xml" title="Prayer Point Press Feed" href="https://prayerpointpress.com/feed/"> <title>Prayer Resources – Connect To God's Heart – Prayer Point Press</title> <meta name='robots' content='max-image-preview:large' /> <!-- Google Tag Manager for WordPress by gtm4wp.com --> <script data-cfasync="false" data-pagespeed-no-defer> var gtm4wp_datalayer_name = "dataLayer"; var dataLayer = dataLayer || []; const gtm4wp_use_sku_instead = false; const gtm4wp_id_prefix = ''; const gtm4wp_remarketing = false; const gtm4wp_eec = true; const gtm4wp_classicec = false; const gtm4wp_currency = 'USD'; const gtm4wp_product_per_impression = 10; const gtm4wp_needs_shipping_address = false; const gtm4wp_business_vertical = 'retail'; const gtm4wp_business_vertical_id = 'id'; </script> <!-- End Google Tag Manager for WordPress by gtm4wp.com --> <!-- This site is optimized with the Yoast SEO Premium plugin v11.3 - https://yoast.com/wordpress/plugins/seo/ --> <meta name="description" content="At Prayer Point Press we've build an arsenal of prayer resources to grow a robust prayer ministry. Let's pray together for the lost!"/> <link rel="canonical" href="https://prayerpointpress.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Prayer Resources – Connect To God's Heart – Prayer Point Press" /> <meta property="og:description" content="At Prayer Point Press we've build an arsenal of prayer resources to grow a robust prayer ministry. Let's pray together for the lost!" /> <meta property="og:url" content="https://prayerpointpress.com/" /> <meta property="og:site_name" content="Prayer Point Press" /> <meta name="twitter:card" content="summary_large_image" /> <meta name="twitter:description" content="At Prayer Point Press we've build an arsenal of prayer resources to grow a robust prayer ministry. Let's pray together for the lost!" /> <meta name="twitter:title" content="Prayer Resources – Connect To God's Heart – Prayer Point Press" /> <script type='application/ld+json' class='yoast-schema-graph yoast-schema-graph--main'>{"@context":"https://schema.org","@graph":[{"@type":"Organization","@id":"https://prayerpointpress.com/#organization","name":"Prayer Point Press","url":"https://prayerpointpress.com/","sameAs":["https://www.facebook.com/PrayerPointMinistry/","https://www.instagram.com/prayer_point_ministry/"],"logo":{"@type":"ImageObject","@id":"https://prayerpointpress.com/#logo","url":"https://prayerpointpress.com/wp-content/uploads/2019/04/Prayer-Point-Logo-Black-copy.png","width":149,"height":90,"caption":"Prayer Point Press"},"image":{"@id":"https://prayerpointpress.com/#logo"}},{"@type":"WebSite","@id":"https://prayerpointpress.com/#website","url":"https://prayerpointpress.com/","name":"Prayer Point Press","publisher":{"@id":"https://prayerpointpress.com/#organization"},"potentialAction":{"@type":"SearchAction","target":"httpsFound 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.overthinkingcomics.seanneprud.com
2024-09-16 06:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:45:16 GMT Server: Apache Link: <https://overthinkingcomics.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.michmondo.com
2024-09-16 06:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:45:04 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://michmondo.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:50:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.xvm.cup.mybluehost.me
2024-09-16 06:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:45:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:45:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: AI-Powered Network Builder — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>AI-Powered Network Builder — Coming Soon</title> <script src="https://thegtmnetwork.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thegtmnetwork.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thegtmnetwork.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.aayaproductionsny.com
2024-09-16 06:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:43:27 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 186882 Last-Modified: Mon, 16 Sep 2024 05:21:02 GMT Accept-Ranges: bytes Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:48:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: aayaproductionsny Video Production Company |New York| <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml" lang="en-US" itemscope="itemscope" itemtype="http://schema.org/Website"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <!--[if IE]><meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"><![endif]--> <meta name="viewport" content="width=device-width, initial-scale=1.0, shrink-to-fit=no"/> <link rel="profile" href="http://gmpg.org/xfn/11"/> <meta name="title" content="Aaya Productions "> <meta name="description" content="aayaproductionsny, Reality TV & Documentary, Music Videos & Films,commercials, website, branding, workshop, Web Videos & Commercials."> <meta property="og:title" content="Home"/> <meta property="og:type" content="website"/> <meta property="og:url" content="https://www.aayaproductionsny.com/" /> <meta property="og:description" content="AAYA Productions, Entertainment Inc is an American entertainment company based in New York City. Our company organizes various entertaining services in Video, Film, Media, Advertising.Aaya productions founded by the Algerian Filmmaker Amine Mihoubi. Similarly, Our team is talented and"/> <meta property="og:image" content="https://i0.wp.com/www.aayaproductionsny.com/wp-content/uploads/2019/02/last-version-logo-company.jpg?fit=653%2C1024&ssl=1"/> <meta property="og:site_name" content="AAYA PRODUCTIONS"/> <!--HOME--> <!--Summary--> <!--Photo--> <!--Gallery--> <!--Product--> <link rel="pingback" href="https://www.aayaproductionsny.com/xmlrpc.php" /> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- Jetpack Site Verification Tags --> <script>window._wca = window._wca || [];</script> <!-- This site is optimized with the Yoast SEO plugin v23.4 - https://yoast.com/wordpress/plugins/seo/ --> <title>aayaproductionsny Video Production Company |New York|</title> <meta name="description" content="aayaproductionsny video production company based in New York, Documentary, Music Videos & Films, branding, workshop, Web Videos & Commercials." /> <link rel="canonical" href="https://www.aayaproductionsny.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Aaya Productions" /> <meta property="og:description" content="aayaproductionsny, film prod, commercials, advertising, publicity, movie, website, branding, media, workshop, Corporate & Business Videos, Reality TV & Documentary, Music Videos & Films, Web Videos & Commercials, Digital Marketing." /> <meta property="og:url" content="https://www.aayaproductionsny.com/" /> <meta property="og:site_name" content="AAYA PRODUCTIONS" /> <meta property="article:publisher" content="https://www.facebook.com/aayaproductions/?ref=bookmarks" /> <meta property="article:modified_time" content="2022-09-13T15:43:16+00:00" /> <meta property="og:image" content="https://www.aayaproductionsny.com/wp-content/uploads/2017/01/element-1001.jpg" /> <meta property="og:image:width" content="1120" /> <meta property="og:image:height" content="840" /> <meta property="og:image:type" content="image/jpeg" /> <meta name="twitter:card" content="summary_large_image" /> <meta name="twitter:site" content="@ProductionsAaya" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://www.aayaproductionsny.com/","url":"https://www.aayaproductionsny.com/","name":"aayaproductionsny Video Production Company |New York|","isPartOf":{"@id":"https://www.aayaproductionsny.com/#website"},"about":{"@id":"https://www.aayaproductionsny.com/#organization"},"primaryImageOfPage":{"@id":"https://www.aayaproductionsny.com/#primaryimage"},"image":{"@id":"https://www.aayaproductionsny.com/#primaryimage"},"thumbnailUrl":"https://i0.wp.com/www.aayaproductionsny.com/wp-content/uploads/2019/02/last-version-logo-company.jpg?fit=720%2C1129&ssl=1","datePublished":"2017-01-01T12:14Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · keywomeninchrist.com
2024-09-16 06:42
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:43:00 GMT Server: Apache Location: https://keywomeninchrist.com/cgi-sys/suspendedpage.cgi Content-Length: 238 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://keywomeninchrist.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.tankardsaweigh.com
2024-09-16 06:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:43:00 GMT Server: Apache Link: <https://www.tankardsaweigh.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Tankards Aweigh | Just another WordPress site <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head profile="http://gmpg.org/xfn/11"> <title>Tankards Aweigh | Just another WordPress site</title> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="robots" content="index, nofollow" /> <link rel="stylesheet" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/css/reset.css" type="text/css" /> <link rel="stylesheet" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/css/960.css" type="text/css" /> <link rel="stylesheet" type="text/css" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/style.css" media="screen" /> <link rel="alternate" type="application/rss+xml" title="RSS 2.0" href="https://www.tankardsaweigh.com/feed/" /> <link rel="pingback" href="https://www.tankardsaweigh.com/xmlrpc.php" /> <!--[if lt IE 7]> <script src="https://www.tankardsaweigh.com/wp-content/themes/tankards/includes/js/pngfix.js" type="text/javascript"></script> <link rel="stylesheet" href="https://www.tankardsaweigh.com/wp-content/themes/tankards/css/ie6.css" type="text/css" /> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.tankardsaweigh.com' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.tankardsaweigh.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.fua.zzt.mybluehost.me
2024-09-16 06:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:42:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://pawsitivelyfitadventures.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:42:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.instincxbyanayanicole.com
2024-09-16 06:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:41:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://instincx.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:41:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · rmt.zga.mybluehost.me
2024-09-16 06:41
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.heraextension.com
2024-09-16 06:40
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.redheadlivesmatter.com
2024-09-16 06:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:40:27 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://redheadlivesmatter.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · recon-logic.com
2024-09-16 06:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:40:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://recon-logic.com/wp-json/>; rel="https://api.w.org/", <https://recon-logic.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://recon-logic.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:40:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.humansalike.com
2024-09-16 06:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:39:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://neurostrategiesfx.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jhairstudio.ca
2024-09-16 06:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:39:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://jhairstudio.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:39:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.eliterazor.com
2024-09-16 06:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:39:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://eliterazor.com/wp-json/>; rel="https://api.w.org/", <https://eliterazor.com/wp-json/wp/v2/pages/32>; rel="alternate"; title="JSON"; type="application/json", <https://eliterazor.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:39:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 content-Security-Policy: upgrade-insecure-requests X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Feliterazor.com%2F; expires=Mon, 14-Oct-2024 06:39:55 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.lyubastudio.co.uk
2024-09-16 06:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:38:59 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: http://www.lyubastudio.co.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.uyw.fmr.mybluehost.me
2024-09-16 06:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:38:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: About David Wong — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>About David Wong — Coming Soon</title> <script src="https://davidwong.com.hk/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://davidwong.com.hk/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://davidwong.com.hk/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.roofsaversco.com
2024-09-16 06:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:38:43 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=bc9d403fa05d51aa01527696d84c4fd7; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://roofsaversco.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.lyubastudio.co.uk
2024-09-16 06:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:38:38 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.lyubastudio.co.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.alexketo.com
2024-09-16 06:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:38:33 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://alexketo.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:43:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.chiton.store
2024-09-16 06:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:36:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache cf-edge-cache: cache,platform=wordpress X-Redirect-By: WordPress Location: https://chiton.store/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:36:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · thewayofthekingdom.pmg.dbr.mybluehost.me
2024-09-16 06:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:36:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.thewayofthekingdom.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:41:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.kaabuzz.thematchmakingteam.com
2024-09-16 06:34
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 06:34:58 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: KaaBuzz — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>KaaBuzz — Coming Soon</title> <script src="https://kaabuzz.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kaabuzz.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kaabuzz.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.imperepoxy.com
2024-09-16 06:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:35:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://imperepoxy.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:39:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · vernastudio.com
2024-09-16 06:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:34:51 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:34:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Verna Studio — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Verna Studio — Coming Soon</title> <script src="https://vernastudio.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://vernastudio.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://vernastudio.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mti.nxb.mybluehost.me
2024-09-16 06:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:34:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:34:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://nurturemylist51.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nurturemylist51.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nurturemylist51.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · becan-ca.multicultural.com.br
2024-09-16 06:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:34:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://becan.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:34:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.avtgl.com
2024-09-16 06:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:34:49 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: AVT Global Logistics — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>AVT Global Logistics — Coming Soon</title> <script src="https://avtgl.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://avtgl.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://avtgl.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.beyondglioblastoma.atentforfour.com
2024-09-16 06:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:34:37 GMT Server: Apache Link: <https://beyondglioblastoma.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:39:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · pinoandpie.com
2024-09-16 06:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:34:27 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.pinoandpie.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.redheadlivesmatter.com
2024-09-16 06:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:34:20 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://redheadlivesmatter.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://redheadlivesmatter.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://redheadlivesmatter.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.gwblue.site
2024-09-16 06:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:34:20 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: GW Test Domain Site — Coming Soon <!DOCTYPE html> <html> <head> <meta name="viewport" content="width=device-width"> <title>GW Test Domain Site — Coming Soon</title> <script src="https://robinandvera.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url( "https://robinandvera.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/cs-bluehost-bg.jpg" ); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom:0; left:0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16px; font-size: 11px; top: 2px; } .bh_subscription_widget form .bh-inputs.email input[type="email"] { background-color: #fff; background-image: url( "https://robinandvera.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/icon-email.svg" ); background-position: 10px center; background-repeat: no-repeat; border: 1px solid #5B5B5B; border-radius: 3px; color: #5B5B5B; font-size: 11px; margin-right: 6px; min-width: 300px; padding: 14px 15px 14pxFound 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.doorbustersale.com
2024-09-16 06:33
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 06:33:24 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: DoorBusterSale — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>DoorBusterSale — Coming Soon</title> <script src="https://doorbustersale.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://doorbustersale.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://doorbustersale.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.remotejoblist.com
2024-09-16 06:33
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 06:33:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://remotejoblist.com/wp-json/>; rel="https://api.w.org/" host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.anthonycinque.com
2024-09-16 06:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:32:02 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Pingback: https://anthonycinque.com/xmlrpc.php X-Redirect-By: WordPress Set-Cookie: PHPSESSID=3d402ec261552904e2c1f94b13368274; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://anthonycinque.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · pqf.yfm.mybluehost.me
2024-09-16 06:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:31:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://melissashotelldmd.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:31:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.dgf.cyt.mybluehost.me
2024-09-16 06:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:31:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://theageofwisdom.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:31:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.iml.kes.mybluehost.me
2024-09-16 06:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:31:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:31:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://iml.kes.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://iml.kes.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://iml.kes.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · zyc.yhb.mybluehost.me
2024-09-16 06:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:31:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://clevervagabond.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:31:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.barbarahroos.com
2024-09-16 06:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:31:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://barbarahroos.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:36:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.padelcommunity.club
2024-09-16 06:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:31:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:31:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Padel Community Club — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Padel Community Club — Coming Soon</title> <script src="https://padelcommunity.club/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://padelcommunity.club/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://padelcommunity.club/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · website-b387fdd0.simplyfinn.com
2024-09-16 06:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:31:25 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:31:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Erin Lynne Photography — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Erin Lynne Photography — Coming Soon</title> <script src="https://njs.hbq.mybluehost.me/website_b387fdd0/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://njs.hbq.mybluehost.me/website_b387fdd0/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://njs.hbq.mybluehost.me/website_b387fdd0/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · zev.mvv.mybluehost.me
2024-09-16 06:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:31:21 GMT Server: Apache X-LiteSpeed-Tag: 217_HTTP.200,217_HTTP.301 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://bravaconsultancy.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · thv.qjk.mybluehost.me
2024-09-16 06:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:31:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://3d-it.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · edermaskinshop.hfy.ovo.mybluehost.me
2024-09-16 06:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:31:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://edermaskinshop.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:31:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.primroseground.com
2024-09-16 06:30
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · litraven.com
2024-09-16 06:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:30:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:30:48 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: LitRaven — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>LitRaven — Coming Soon</title> <script src="https://litraven.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://litraven.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://litraven.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.entrustedwithgrace.com
2024-09-16 06:30
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.stunncust.com
2024-09-16 06:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:28:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stunncust.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:28:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · ricamontespr.com
2024-09-16 06:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:28:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ricamontespr.com/wp-json/>; rel="https://api.w.org/", <https://ricamontespr.com/wp-json/wp/v2/pages/18>; rel="alternate"; title="JSON"; type="application/json", <https://ricamontespr.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:28:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.advancetreehealth.com
2024-09-16 06:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:28:25 GMT Server: Apache X-Pingback: https://www.advancedtreehealth.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.advancedtreehealth.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.dai.pgs.mybluehost.me
2024-09-16 06:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:28:24 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:28:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://leadershiprestoration.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://leadershiprestoration.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://leadershiprestoration.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · sethrwilson.com
2024-09-16 06:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:28:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sethrwilson.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/4t7Ve>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:32:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.theboozereviews.com
2024-09-16 06:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:27:55 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://theboozereviews.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jojoinfotech.com
2024-09-16 06:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:27:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jojoinfotech.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:27:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.etronixtt.com
2024-09-16 06:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:27:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://etronixtt.com/home/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:27:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · lnj.wgl.mybluehost.me
2024-09-16 06:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:27:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://lnj.wgl.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://wp.me/bfD7T>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:32:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Healing beyond hope <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>Healing beyond hope</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//secure.gravatar.com' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//v0.wordpress.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Healing beyond hope » Feed" href="https://lnj.wgl.mybluehost.me/feed/" /> <link rel="alternate" type="application/rss+xml" title="Healing beyond hope » Comments Feed" href="https://lnj.wgl.mybluehost.me/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v7.10.4 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No UA code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/lnj.wgl.mybluehost.me\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supportFound 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.therevolutionky.org
2024-09-16 06:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:27:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://therevolutionky.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:27:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · teacherdouble.com
2024-09-16 06:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:27:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://teacherdouble.com/wp-json/>; rel="https://api.w.org/", <https://teacherdouble.com/wp-json/wp/v2/pages/61>; rel="alternate"; type="application/json", <https://teacherdouble.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:27:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.naturallygoodlife.com
2024-09-16 06:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:27:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.naturallygoodlife.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.naturallygoodlife.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.naturallygoodlife.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:27:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.arcanawatch.com
2024-09-16 06:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:27:07 GMT Server: Apache Link: <https://arcanawatch.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:27:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.schindlerengineering.com
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:48 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: wp_wpfileupload_185cc1d4fdacc65f05d53fddae72db0a=kf9BFEtKfArFMfwRTszF2FREeLxB9Ocp; expires=Wed, 18 Sep 2024 06:26:48 GMT; Max-Age=172800; path=/public/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://schindlerengineering.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · billmoore.auroralightgraffiti.com
2024-09-16 06:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:26:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:26:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Bill Moore — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Bill Moore — Coming Soon</title> <script src="https://billmoore.auroralightgraffiti.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://billmoore.auroralightgraffiti.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://billmoore.auroralightgraffiti.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · drsexyann.com
2024-09-16 06:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:26:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://drsexyann.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/6Vpph>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:31:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.outtaroad.embraceherflow.com
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://outtaroad.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:26:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.czp.isd.mybluehost.me
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://czp.isd.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:26:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jwholesalespa.nlyh.org
2024-09-16 06:26
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 06:26:26 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jfp.vgr.mybluehost.me
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://idahocl.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:26:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · whitneyforeastpenn.com
2024-09-16 06:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:26:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://whitneyforeastpenn.com/wp-json/>; rel="https://api.w.org/", <https://whitneyforeastpenn.com/wp-json/wp/v2/pages/7>; rel="alternate"; title="JSON"; type="application/json", <https://whitneyforeastpenn.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:31:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.travelglobenow.com
2024-09-16 06:26
HTTP/1.1 502 Bad Gateway Date: Mon, 16 Sep 2024 06:26:26 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 559 host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 502 Bad Gateway <html> <head><title>502 Bad Gateway</title></head> <body> <center><h1>502 Bad Gateway</h1></center> <hr><center>nginx/1.21.6</center> </body> </html> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page --> <!-- a padding to disable MSIE and Chrome friendly error page -->
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jackbabbage.chiefsimplicityofficer.com
2024-09-16 06:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:26:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://jackbabbage.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/8jBMp>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.rve.vua.mybluehost.me
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tahitianinn.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 06:26:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 1 X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.philomathean.tv
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://philomathean.tv/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:26:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.website-b8e2bb48.simplyfinn.com
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anotherbrandcreativeco.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:26:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.neurostrategiesfx.com
2024-09-16 06:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:26:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://neurostrategiesfx.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.ngiscvsa.com
2024-09-16 06:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:25:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:25:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: North Georgia Investigative Solutions — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>North Georgia Investigative Solutions — Coming Soon</title> <script src="https://ngiscvsa.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ngiscvsa.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ngiscvsa.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.thewhitelightcollective.com
2024-09-16 06:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:25:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: 78a_HTTP.200,78a_HTTP.301 X-Redirect-By: WordPress Location: https://thewhitelightcollective.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.hopesforthepath.org
2024-09-16 06:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:25:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hopesforthepath.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:25:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · partnersteletherapy.com
2024-09-16 06:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:25:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://xdh.gsv.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:25:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.xum.ryb.mybluehost.me
2024-09-16 06:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:25:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ricamontespr.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:25:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.weightsandredemption.com
2024-09-16 06:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:25:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://weightsandredemption.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:25:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:80 · mail.latinvfr.org
2024-09-16 06:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:25:16 GMT Server: Apache Link: <http://www.latinvfr.org/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.blessingretailgroup.com
2024-09-16 06:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:24:47 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://blessingretailgroup.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · bravaconsultancy.com
2024-09-16 06:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:24:44 GMT Server: Apache X-LiteSpeed-Tag: 217_HTTP.200 Link: <https://bravaconsultancy.com/wp-json/>; rel="https://api.w.org/", <https://bravaconsultancy.com/wp-json/wp/v2/pages/8890>; rel="alternate"; title="JSON"; type="application/json", <https://bravaconsultancy.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.williamthepainter.com
2024-09-16 06:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:24:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://williamthepainter.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:24:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.razzlemarketing.com
2024-09-16 06:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:24:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://razzlemarketing.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:29:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.jordanwaugh.com
2024-09-16 06:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:24:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://jordanwaugh.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · genzintherealworld.com
2024-09-16 06:24
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:24:17 GMT Server: Apache Location: https://genzintherealworld.com/cgi-sys/suspendedpage.cgi Content-Length: 240 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://genzintherealworld.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.straightasasafetypin.com
2024-09-16 06:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:24:10 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://straightasasafetypin.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.pearlory.com
2024-09-16 06:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:24:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://dev.pearlory.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=9ef8a0088ed3975e7419f91181b4c707; path=/
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.improveyour20s.com
2024-09-16 06:24
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 06:24:02 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: How to improve your 20s — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>How to improve your 20s — Coming Soon</title> <script src="https://improveyour20s.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://improveyour20s.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://improveyour20s.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · lunacatena.com
2024-09-16 06:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:23:59 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: LunaCatena — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>LunaCatena — Coming Soon</title> <script src="https://lunacatena.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lunacatena.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lunacatena.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.overthinkingcomics.com
2024-09-16 06:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:23:41 GMT Server: Apache Link: <https://overthinkingcomics.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.kaitlinhenre.com
2024-09-16 06:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:23:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.kaitlinhenre.com/wp-json/>; rel="https://api.w.org/", <https://www.kaitlinhenre.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://www.kaitlinhenre.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:28:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.ypd.ajs.mybluehost.me
2024-09-16 06:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:23:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:23:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: AI-Enhanced Teacher's Toolbox — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>AI-Enhanced Teacher's Toolbox — Coming Soon</title> <script src="https://ypd.ajs.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ypd.ajs.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ypd.ajs.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · npw.qps.mybluehost.me
2024-09-16 06:23
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:23:30 GMT Server: Apache Location: https://npw.qps.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 239 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://npw.qps.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · uponaboard.com
2024-09-16 06:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:23:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://uponaboard.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · thesleepeasymethod.com
2024-09-16 06:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:22:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wholehomeandbodyhealth.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:22:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress content-Security-Policy: upgrade-insecure-requests X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · razzlemarketing.aniespizza.com
2024-09-16 06:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:22:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://razzlemarketing.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:27:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · rtv.cup.mybluehost.me
2024-09-16 06:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:22:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zenithsolutionsnm.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:22:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.flowgrounds.org
2024-09-16 06:21
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.onlinesellingsystems.us
2024-09-16 06:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:21:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://onlinesellingsystems.us/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:21:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.shellyannweeks.embraceherflow.com
2024-09-16 06:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:21:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://shellyannweeks.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:21:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.weightsandredemption.com
2024-09-16 06:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:20:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://weightsandredemption.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:20:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · hollowayandyoung.com
2024-09-16 06:20
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.buildingfluency.com
2024-09-16 06:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:19:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://buildingfluency.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:19:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · mail.btg.yzs.mybluehost.me
2024-09-16 06:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:18:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.grupoabindus.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=be32b7d128e3a0843d26cb0a453380a6; path=/; secure; HttpOnly Set-Cookie: wp_woocommerce_session_60ff857980523e40baf1eb9dd854dc18=t_4997a988f32c28f389d4e9d470f750%7C%7C1726640327%7C%7C1726636727%7C%7C008d122d96cfa7d1941cb0f47681e3c7; expires=Wed, 18 Sep 2024 06:18:47 GMT; Max-Age=172799; path=/; secure; HttpOnly Set-Cookie: yith_ywraq_session_60ff857980523e40baf1eb9dd854dc18=6a85e8b32f1768a827e7367317b32146%7C%7C1726640328%7C%7C1726636728%7C%7C9e8ad7b9e83ce9ac1863e6e40e69a779; expires=Wed, 18 Sep 2024 06:18:48 GMT; Max-Age=172800; path=/
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.floridatackleclub.com
2024-09-16 06:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:18:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://floridatackleclub.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:18:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · jojoinfotech.com
2024-09-16 06:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:18:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jojoinfotech.com/wp-json/>; rel="https://api.w.org/", <https://jojoinfotech.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://jojoinfotech.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:18:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.im4c.genasysinc.com
2024-09-16 06:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:17:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://im4c.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:17:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.wsg.fwo.mybluehost.me
2024-09-16 06:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:17:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marshavogel.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:17:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Connection: close
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.nvd.zhc.mybluehost.me
2024-09-16 06:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:17:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nvd.zhc.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:17:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.216.122:443 · www.sewingstudioshrewsbury.co.uk
2024-09-16 06:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:15:36 GMT Server: Apache X-Pingback: https://sewingcoursesshrewsbury.co.uk/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://sewingcoursesshrewsbury.co.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
autodiscover.bandeconcrete.comcpanel.bandeconcrete.comcpcalendars.bandeconcrete.comcpcontacts.bandeconcrete.commail.bandeconcrete.comwebdisk.bandeconcrete.comwebmail.bandeconcrete.com
autodiscover.seanneprud.comcpanel.seanneprud.comcpcalendars.seanneprud.comcpcontacts.seanneprud.commail.onlythevaliant.netmail.seanneprud.comonlythevaliant.netseanneprud.comwebdisk.seanneprud.comwebmail.seanneprud.comwww.onlythevaliant.netwww.seanneprud.com
autodiscover.themoreclub.comcpanel.themoreclub.comcpcalendars.themoreclub.comcpcontacts.themoreclub.commail.themoreclub.comthemoreclub.comthemoreclub.thematchmakingteam.comwebdisk.themoreclub.comwebmail.themoreclub.comwww.themoreclub.comwww.themoreclub.thematchmakingteam.com
autodiscover.cledygonzalez.comcledygonzalez.comcpanel.cledygonzalez.comcpcalendars.cledygonzalez.comcpcontacts.cledygonzalez.commail.cledygonzalez.comwebdisk.cledygonzalez.comwebmail.cledygonzalez.comwww.cledygonzalez.com
autodiscover.zekca.com.hkcpanel.zekca.com.hkcpcalendars.zekca.com.hkcpcontacts.zekca.com.hkmail.zekca.com.hkrcc.ubp.mybluehost.mewebdisk.zekca.com.hkwebmail.zekca.com.hkwww.zekca.com.hkzekca.com.hk
cpanel.val.wxt.mybluehost.memail.val.wxt.mybluehost.meval.wxt.mybluehost.mewebmail.val.wxt.mybluehost.mewww.val.wxt.mybluehost.me
autodiscover.jordanwaugh.comcpanel.jordanwaugh.comcpcalendars.jordanwaugh.comcpcontacts.jordanwaugh.comjordanwaugh.commail.jordanwaugh.comwebdisk.jordanwaugh.comwebmail.jordanwaugh.comwww.jordanwaugh.com
autodiscover.tammyhicksjackson.comautodiscover.wholeheartedwellnessalabama.comcpanel.tammyhicksjackson.comcpanel.wholeheartedwellnessalabama.comcpcalendars.tammyhicksjackson.comcpcalendars.wholeheartedwellnessalabama.comcpcontacts.tammyhicksjackson.comcpcontacts.wholeheartedwellnessalabama.commail.tammyhicksjackson.commail.wholeheartedwellnessalabama.comtammyhicksjackson.comwebdisk.tammyhicksjackson.comwebdisk.wholeheartedwellnessalabama.comwebmail.tammyhicksjackson.comwebmail.wholeheartedwellnessalabama.comwholeheartedwellnessalabama.comwholeheartedwellnessalabama.tammyhicksjackson.comwww.tammyhicksjackson.comwww.wholeheartedwellnessalabama.comwww.wholeheartedwellnessalabama.tammyhicksjackson.com
autodiscover.dbw.cyt.mybluehost.mecpanel.dbw.cyt.mybluehost.mecpcalendars.dbw.cyt.mybluehost.mecpcontacts.dbw.cyt.mybluehost.medbw.cyt.mybluehost.meembeddedmindset.comgabrielcybersecurity.commail.dbw.cyt.mybluehost.memail.embeddedmindset.commail.gabrielcybersecurity.comwebdisk.dbw.cyt.mybluehost.mewebmail.dbw.cyt.mybluehost.mewww.dbw.cyt.mybluehost.mewww.embeddedmindset.comwww.gabrielcybersecurity.com
americanteam.spaceautodiscover.americanteam.spaceautodiscover.thematchmakingteam.comcpanel.americanteam.spacecpanel.thematchmakingteam.comcpcalendars.americanteam.spacecpcalendars.thematchmakingteam.comcpcontacts.americanteam.spacecpcontacts.thematchmakingteam.comkpv.wog.mybluehost.memail.americanteam.spacemail.kpv.wog.mybluehost.memail.thematchmakingteam.comthematchmakingteam.comwebdisk.americanteam.spacewebdisk.thematchmakingteam.comwebmail.americanteam.spacewebmail.thematchmakingteam.comwebsite-753f19f8.thematchmakingteam.comwww.americanteam.spacewww.kpv.wog.mybluehost.mewww.thematchmakingteam.comwww.website-753f19f8.thematchmakingteam.com
autodiscover.laelgia.comcpanel.laelgia.comcpcalendars.laelgia.comcpcontacts.laelgia.comecommerce.laelgia.comlaelgia.commail.laelgia.commail.wjk.sty.mybluehost.mestartup.laelgia.comstartup01.laelgia.comwebdisk.laelgia.comwebmail.laelgia.comwjk.sty.mybluehost.mewww.ecommerce.laelgia.comwww.laelgia.comwww.startup.laelgia.comwww.startup01.laelgia.comwww.wjk.sty.mybluehost.mewww.zomokzomok.laelgia.comzomokzomok.laelgia.com
autodiscover.ddq.jdq.mybluehost.mecpanel.ddq.jdq.mybluehost.mecpcalendars.ddq.jdq.mybluehost.mecpcontacts.ddq.jdq.mybluehost.meddq.jdq.mybluehost.memail.ddq.jdq.mybluehost.memail.rebellatrix.comrebellatrix.comwebdisk.ddq.jdq.mybluehost.mewebmail.ddq.jdq.mybluehost.mewww.ddq.jdq.mybluehost.mewww.rebellatrix.com
autodiscover.jsu.vtl.mybluehost.mecpanel.jsu.vtl.mybluehost.mecpcalendars.jsu.vtl.mybluehost.mecpcontacts.jsu.vtl.mybluehost.mejsu.vtl.mybluehost.memail.jsu.vtl.mybluehost.memail.silverpuddleglum.comsilverpuddleglum.comwebdisk.jsu.vtl.mybluehost.mewebmail.jsu.vtl.mybluehost.mewww.jsu.vtl.mybluehost.mewww.silverpuddleglum.com
aahomerealty.comautodiscover.crd.rnz.mybluehost.mecpanel.crd.rnz.mybluehost.mecpcalendars.crd.rnz.mybluehost.mecpcontacts.crd.rnz.mybluehost.mecrd.rnz.mybluehost.memail.aahomerealty.commail.crd.rnz.mybluehost.mewebdisk.crd.rnz.mybluehost.mewebmail.crd.rnz.mybluehost.mewww.aahomerealty.comwww.crd.rnz.mybluehost.me
autodiscover.ofo.evx.mybluehost.mecpanel.ofo.evx.mybluehost.mecpcalendars.ofo.evx.mybluehost.mecpcontacts.ofo.evx.mybluehost.memail.ofo.evx.mybluehost.memail.rfimagingandcommunications.comofo.evx.mybluehost.merfimagingandcommunications.comwebdisk.ofo.evx.mybluehost.mewebmail.ofo.evx.mybluehost.mewww.ofo.evx.mybluehost.mewww.rfimagingandcommunications.com
autodiscover.bsl.abf.mybluehost.mebsl.abf.mybluehost.mecpanel.bsl.abf.mybluehost.mecpcalendars.bsl.abf.mybluehost.mecpcontacts.bsl.abf.mybluehost.memail.bsl.abf.mybluehost.memail.steppinginpurpose.comsteppinginpurpose.comwebdisk.bsl.abf.mybluehost.mewebmail.bsl.abf.mybluehost.mewww.bsl.abf.mybluehost.mewww.steppinginpurpose.com
artsbiotica.comartsbiotica.spircen.comautodiscover.artsbiotica.comautodiscover.spircen.comcpanel.artsbiotica.comcpanel.spircen.comcpcalendars.artsbiotica.comcpcalendars.spircen.comcpcontacts.artsbiotica.comcpcontacts.spircen.comipt.wgl.mybluehost.memail.artsbiotica.commail.ipt.wgl.mybluehost.memail.spircen.comspircen.comwebdisk.artsbiotica.comwebdisk.spircen.comwebmail.artsbiotica.comwebmail.spircen.comwww.artsbiotica.comwww.artsbiotica.spircen.comwww.ipt.wgl.mybluehost.mewww.spircen.com
autodiscover.whitestone.institutecpanel.whitestone.institutecpcalendars.whitestone.institutecpcontacts.whitestone.institutekunmatch.thematchmakingteam.commail.whitestone.institutemvm111team.thematchmakingteam.comna000zeq.thematchmakingteam.comnaz111eq.thematchmakingteam.comriz111qa.thematchmakingteam.comrizqa.thematchmakingteam.comwebdisk.whitestone.institutewebmail.whitestone.institutewhitestone-institute.thematchmakingteam.comwhitestone.institutewww.kunmatch.thematchmakingteam.comwww.mvm111team.thematchmakingteam.comwww.na000zeq.thematchmakingteam.comwww.naz111eq.thematchmakingteam.comwww.riz111qa.thematchmakingteam.comwww.rizqa.thematchmakingteam.comwww.whitestone-institute.thematchmakingteam.comwww.whitestone.institute
autodiscover.liz-jackson.comcpanel.liz-jackson.comcpcalendars.liz-jackson.comcpcontacts.liz-jackson.comliz-jackson.commail.liz-jackson.comwebdisk.liz-jackson.comwebmail.liz-jackson.comwww.liz-jackson.com
assertif.usautodiscover.assertif.uscpanel.assertif.uscpcalendars.assertif.uscpcontacts.assertif.usmail.assertif.uswebdisk.assertif.uswebmail.assertif.uswww.assertif.us
levinsonforeastpenn.orgmail.levinsonforeastpenn.orgwww.levinsonforeastpenn.org
autodiscover.humansalike.comclubboring.comcpanel.humansalike.comcpcalendars.humansalike.comcpcontacts.humansalike.comhumansalike.commail.clubboring.commail.humansalike.commail.neurostrategiesfx.commail.qfs.yhn.mybluehost.meneurostrategiesfx.comqfs.yhn.mybluehost.mewebdisk.humansalike.comwebmail.humansalike.comwww.clubboring.comwww.humansalike.comwww.neurostrategiesfx.comwww.qfs.yhn.mybluehost.me
ashokalagardens.comautodiscover.idx.oao.mybluehost.mecpanel.idx.oao.mybluehost.mecpcalendars.idx.oao.mybluehost.mecpcontacts.idx.oao.mybluehost.meidx.oao.mybluehost.memail.ashokalagardens.commail.idx.oao.mybluehost.mewebdisk.idx.oao.mybluehost.mewebmail.idx.oao.mybluehost.mewww.ashokalagardens.comwww.idx.oao.mybluehost.me
autodiscover.fzr.tdd.mybluehost.mecpanel.fzr.tdd.mybluehost.mecpcalendars.fzr.tdd.mybluehost.mecpcontacts.fzr.tdd.mybluehost.mefzr.tdd.mybluehost.mekaliskaclean.commail.fzr.tdd.mybluehost.memail.kaliskaclean.comwebdisk.fzr.tdd.mybluehost.mewebmail.fzr.tdd.mybluehost.mewww.fzr.tdd.mybluehost.mewww.kaliskaclean.com
autodiscover.securingyourfamily.comcpanel.securingyourfamily.comcpcalendars.securingyourfamily.comcpcontacts.securingyourfamily.commail.securingyourfamily.comsecuringyourfamily.comwebdisk.securingyourfamily.comwebmail.securingyourfamily.comwww.securingyourfamily.com
autodiscover.tangerineeatery.comcpanel.tangerineeatery.comcpcalendars.tangerineeatery.comcpcontacts.tangerineeatery.commail.tangerineeatery.comtangerineeatery.comwebdisk.tangerineeatery.comwebmail.tangerineeatery.comwww.tangerineeatery.com
cpanel.thegraphiteline.comcpcalendars.thegraphiteline.comcpcontacts.thegraphiteline.commail.thegraphiteline.comthegraphiteline.comwebdisk.thegraphiteline.comwebmail.thegraphiteline.comwww.thegraphiteline.com
autodiscover.evr.ths.mybluehost.mebksbmpa.comcpanel.evr.ths.mybluehost.mecpcalendars.evr.ths.mybluehost.mecpcontacts.evr.ths.mybluehost.meevr.ths.mybluehost.memail.bksbmpa.commail.evr.ths.mybluehost.mewebdisk.evr.ths.mybluehost.mewebmail.evr.ths.mybluehost.mewww.bksbmpa.comwww.evr.ths.mybluehost.me
autodiscover.unitechcomputersnorthwest.co.ukcpanel.unitechcomputersnorthwest.co.ukcpcalendars.unitechcomputersnorthwest.co.ukcpcontacts.unitechcomputersnorthwest.co.ukmail.unitechcomputersnorthwest.co.ukunitechcomputersnorthwest-co-uk.unitechcomputers.co.ukunitechcomputersnorthwest.co.ukwebdisk.unitechcomputersnorthwest.co.ukwebmail.unitechcomputersnorthwest.co.ukwww.unitechcomputersnorthwest-co-uk.unitechcomputers.co.ukwww.unitechcomputersnorthwest.co.uk
cpanel.rebushealth.comcpcalendars.rebushealth.comcpcontacts.rebushealth.compragmaticfund.compragmaticfund.mkadvisory.comrebushealth.comrebushealth.mkadvisory.comwebdisk.rebushealth.comwebmail.rebushealth.comwww.pragmaticfund.comwww.pragmaticfund.mkadvisory.comwww.rebushealth.comwww.rebushealth.mkadvisory.com
autodiscover.firststepimpact.comautodiscover.livinglifeyouthwellness.comcpanel.firststepimpact.comcpanel.livinglifeyouthwellness.comcpcalendars.firststepimpact.comcpcontacts.firststepimpact.comcpcontacts.livinglifeyouthwellness.comfirststepimpact.comlivinglifeyouthwellness.commail.firststepimpact.commail.livinglifeyouthwellness.commail.yuo.mbc.mybluehost.mewebdisk.firststepimpact.comwebmail.firststepimpact.comwebmail.livinglifeyouthwellness.comwebsite-185d22be.livinglifeyouthwellness.comwww.firststepimpact.comwww.livinglifeyouthwellness.comwww.website-185d22be.livinglifeyouthwellness.comwww.yuo.mbc.mybluehost.meyuo.mbc.mybluehost.me
autodiscover.btg.yzs.mybluehost.mebtg.yzs.mybluehost.mecpanel.btg.yzs.mybluehost.mecpcalendars.btg.yzs.mybluehost.mecpcontacts.btg.yzs.mybluehost.megrupoabindus.commail.btg.yzs.mybluehost.memail.grupoabindus.comwebdisk.btg.yzs.mybluehost.mewebmail.btg.yzs.mybluehost.mewww.btg.yzs.mybluehost.mewww.grupoabindus.com
autodiscover.stevenrychen.comcpanel.stevenrychen.comcpcalendars.stevenrychen.comcpcontacts.stevenrychen.commail.stevenrychen.comstevenrychen.comwebdisk.stevenrychen.comwebmail.stevenrychen.comwww.stevenrychen.com
billmoore.auroralightgraffiti.comwww.billmoore.auroralightgraffiti.com
autodiscover.tsc.coo.mybluehost.mecanadaimmihelps.comcpanel.tsc.coo.mybluehost.mecpcalendars.tsc.coo.mybluehost.mecpcontacts.tsc.coo.mybluehost.memail.canadaimmihelps.commail.tsc.coo.mybluehost.metsc.coo.mybluehost.mewebdisk.tsc.coo.mybluehost.mewebmail.tsc.coo.mybluehost.mewww.canadaimmihelps.comwww.tsc.coo.mybluehost.me
autodiscover.futech.clcpanel.futech.clcpcalendars.futech.clcpcontacts.futech.clfutech.clmail.futech.clwebdisk.futech.clwebmail.futech.clwww.futech.cl
autodiscover.iml.kes.mybluehost.mecpanel.iml.kes.mybluehost.mecpcalendars.iml.kes.mybluehost.mecpcontacts.iml.kes.mybluehost.meiml.kes.mybluehost.memail.iml.kes.mybluehost.mewebdisk.iml.kes.mybluehost.mewebmail.iml.kes.mybluehost.mewww.iml.kes.mybluehost.me
autodiscover.martechcreative.comcpanel.martechcreative.comcpcalendars.martechcreative.comcpcontacts.martechcreative.commartechcreative.comwebdisk.martechcreative.comwebmail.martechcreative.comwww.martechcreative.com
autodiscover.jackbabbage.comautodiscover.k6nnl.comcpanel.jackbabbage.comcpanel.k6nnl.comcpcalendars.jackbabbage.comcpcalendars.k6nnl.comcpcontacts.jackbabbage.comcpcontacts.k6nnl.comjackbabbage.chiefsimplicityofficer.comjackbabbage.comk6nnl.chiefsimplicityofficer.comk6nnl.commail.jackbabbage.commail.k6nnl.comwebdisk.jackbabbage.comwebdisk.k6nnl.comwebmail.jackbabbage.comwebmail.k6nnl.comwww.jackbabbage.chiefsimplicityofficer.comwww.jackbabbage.comwww.k6nnl.chiefsimplicityofficer.comwww.k6nnl.com
anotherbrandcreativeco.comautodiscover.anotherbrandcreativeco.comcpanel.anotherbrandcreativeco.comcpcalendars.anotherbrandcreativeco.comcpcontacts.anotherbrandcreativeco.commail.anotherbrandcreativeco.comwebdisk.anotherbrandcreativeco.comwebmail.anotherbrandcreativeco.comwebsite-b8e2bb48.simplyfinn.comwww.anotherbrandcreativeco.comwww.website-b8e2bb48.simplyfinn.com
autodiscover.fotografia-gallery.comcpanel.fotografia-gallery.comcpcalendars.fotografia-gallery.comcpcontacts.fotografia-gallery.comfotografia-gallery.commail.fotografia-gallery.comwebdisk.fotografia-gallery.comwebmail.fotografia-gallery.comwebsite-e7a6b7e6.rightslaw.orgwww.fotografia-gallery.comwww.website-e7a6b7e6.rightslaw.org
autodiscover.sjqart.comcpanel.sjqart.comcpcalendars.sjqart.comcpcontacts.sjqart.commail.sjqart.comsjqart.comwebdisk.sjqart.comwebmail.sjqart.comwww.sjqart.com
autodiscover.dgy.goc.mybluehost.mecontainstore.cocpanel.dgy.goc.mybluehost.mecpcalendars.dgy.goc.mybluehost.mecpcontacts.dgy.goc.mybluehost.medgy.goc.mybluehost.memail.containstore.comail.dgy.goc.mybluehost.mewebdisk.dgy.goc.mybluehost.mewebmail.dgy.goc.mybluehost.mewww.containstore.cowww.dgy.goc.mybluehost.me
autodiscover.razzlemarketing.comcpanel.razzlemarketing.comcpcalendars.razzlemarketing.comcpcontacts.razzlemarketing.comrazzlemarketing.aniespizza.comrazzlemarketing.comwebdisk.razzlemarketing.comwebmail.razzlemarketing.comwww.razzlemarketing.aniespizza.comwww.razzlemarketing.com
cpanel.startguides.netcpcalendars.startguides.netcpcontacts.startguides.netmail.startguides.netstartguides.nettentme.startguides.netwebdisk.startguides.netwebmail.startguides.netwww.startguides.netwww.tentme.startguides.net
autodiscover.sportsnews-swiss.chcpanel.sportsnews-swiss.chcpcalendars.sportsnews-swiss.chcpcontacts.sportsnews-swiss.chmail.sportsnews-swiss.chsportsnews-swiss.chwebdisk.sportsnews-swiss.chwebmail.sportsnews-swiss.chwww.sportsnews-swiss.ch
autodiscover.courtneycoffey.comcourtneycoffey.comcourtneycoffey.simplycolorguard.comcpanel.courtneycoffey.comcpanel.simplycolorguard.comcpcalendars.courtneycoffey.comcpcalendars.simplycolorguard.comcpcontacts.courtneycoffey.comcpcontacts.simplycolorguard.commail.courtneycoffey.commail.simplycolorguard.comsimplycolorguard.comwebdisk.courtneycoffey.comwebdisk.simplycolorguard.comwebmail.courtneycoffey.comwebmail.simplycolorguard.comwww.courtneycoffey.comwww.courtneycoffey.simplycolorguard.comwww.simplycolorguard.com
autodiscover.greenobsessionnursery.comcpanel.greenobsessionnursery.comcpcalendars.greenobsessionnursery.comcpcontacts.greenobsessionnursery.comgreenobsessionnursery.commail.greenobsessionnursery.comwebdisk.greenobsessionnursery.comwebmail.greenobsessionnursery.comwww.greenobsessionnursery.com
autodiscover.msquiromasajes.comautodiscover.noemarti.comcpanel.msquiromasajes.comcpanel.noemarti.comcpcalendars.msquiromasajes.comcpcalendars.noemarti.comcpcontacts.msquiromasajes.comcpcontacts.noemarti.commail.msquiromasajes.commail.noemarti.commsquiromasajes.commsquiromasajes.noemarti.comnoemarti.comwebdisk.msquiromasajes.comwebdisk.noemarti.comwebmail.msquiromasajes.comwebmail.noemarti.comwww.msquiromasajes.comwww.msquiromasajes.noemarti.comwww.noemarti.com
autodiscover.familybackyardadventures.comcpanel.familybackyardadventures.comcpcalendars.familybackyardadventures.comcpcontacts.familybackyardadventures.comfamilybackyardadventures.commail.familybackyardadventures.comwebdisk.familybackyardadventures.comwebmail.familybackyardadventures.comwww.familybackyardadventures.com
autodiscover.mll.kqm.mybluehost.mecpanel.mll.kqm.mybluehost.mecpcalendars.mll.kqm.mybluehost.mecpcontacts.mll.kqm.mybluehost.meinklingvideo.commail.inklingvideo.commail.mll.kqm.mybluehost.memll.kqm.mybluehost.mewebdisk.mll.kqm.mybluehost.mewebmail.mll.kqm.mybluehost.mewww.inklingvideo.comwww.mll.kqm.mybluehost.me
autodiscover.hatchersmith.comcpanel.hatchersmith.comcpcalendars.hatchersmith.comcpcontacts.hatchersmith.comhatchersmith.commail.hatchersmith.comwebdisk.hatchersmith.comwebmail.hatchersmith.comwebsite-d5a36bd5.cop.mzi.mybluehost.mewww.hatchersmith.comwww.website-d5a36bd5.cop.mzi.mybluehost.me
autodiscover.jfp.vgr.mybluehost.mecpanel.jfp.vgr.mybluehost.mecpcalendars.jfp.vgr.mybluehost.mecpcontacts.jfp.vgr.mybluehost.meidahocl.comjfp.vgr.mybluehost.memail.idahocl.commail.jfp.vgr.mybluehost.mewebdisk.jfp.vgr.mybluehost.mewebmail.jfp.vgr.mybluehost.mewww.idahocl.comwww.jfp.vgr.mybluehost.me
pawsitivelyfitadventures.comwww.pawsitivelyfitadventures.com
subdomain.radhakrishna.cawww.subdomain.radhakrishna.ca
autodiscover.tjq.ijo.mybluehost.mecpanel.tjq.ijo.mybluehost.mecpcalendars.tjq.ijo.mybluehost.mecpcontacts.tjq.ijo.mybluehost.memail.tjq.ijo.mybluehost.memail.vorcast.orgtjq.ijo.mybluehost.mevorcast.orgwebdisk.tjq.ijo.mybluehost.mewebmail.tjq.ijo.mybluehost.mewww.tjq.ijo.mybluehost.mewww.vorcast.org
atentinthewoods.atentforfour.comatentinthewoods.comautodiscover.atentinthewoods.comcpanel.atentinthewoods.comcpcalendars.atentinthewoods.comcpcontacts.atentinthewoods.commail.atentinthewoods.comwebdisk.atentinthewoods.comwebmail.atentinthewoods.comwww.atentinthewoods.atentforfour.comwww.atentinthewoods.com
autodiscover.monioweddings.comcpanel.monioweddings.comcpcalendars.monioweddings.comcpcontacts.monioweddings.commail.monioweddings.comwebdisk.monioweddings.comwebmail.monioweddings.com
autodiscover.lifewithvernandjoli.comcpanel.lifewithvernandjoli.comcpcalendars.lifewithvernandjoli.comcpcontacts.lifewithvernandjoli.comlifewithvernandjoli.commail.lifewithvernandjoli.comwebdisk.lifewithvernandjoli.comwebmail.lifewithvernandjoli.comwww.lifewithvernandjoli.com
autodiscover.meltcville.comcpanel.meltcville.comcpcalendars.meltcville.comcpcontacts.meltcville.commail.meltcville.commeltcville.comwebdisk.meltcville.comwebmail.meltcville.comwww.meltcville.com
autodiscover.shittybooks.comcpanel.shittybooks.comcpcalendars.shittybooks.comcpcontacts.shittybooks.commail.shittybooks.comshittybooks.comshittybooks.dwicefox.comwebdisk.shittybooks.comwebmail.shittybooks.comwww.shittybooks.comwww.shittybooks.dwicefox.com
autodiscover.roadrevelations.orgcpanel.roadrevelations.orgcpcalendars.roadrevelations.orgcpcontacts.roadrevelations.orgmail.roadrevelations.orgroadrevelations.orgwebdisk.roadrevelations.orgwebmail.roadrevelations.orgwww.roadrevelations.org
autodiscover.slackersguidetohappiness.comcpanel.slackersguidetohappiness.comcpcalendars.slackersguidetohappiness.comcpcontacts.slackersguidetohappiness.commail.slackersguidetohappiness.commail.sunshinespaulding.comslackersguidetohappiness.comsunshinespaulding.comwebdisk.slackersguidetohappiness.comwebmail.slackersguidetohappiness.comwww.slackersguidetohappiness.comwww.sunshinespaulding.com
autodiscover.migukedit.comcpanel.migukedit.comcpcalendars.migukedit.comcpcontacts.migukedit.commail.migukedit.commigukedit.commigukedit.travelglobenow.comwebdisk.migukedit.comwebmail.migukedit.comwww.migukedit.comwww.migukedit.travelglobenow.com
autodiscover.fjj.duj.mybluehost.mecpanel.fjj.duj.mybluehost.mecpcalendars.fjj.duj.mybluehost.mecpcontacts.fjj.duj.mybluehost.mefjj.duj.mybluehost.memail.fjj.duj.mybluehost.mewebdisk.fjj.duj.mybluehost.mewebmail.fjj.duj.mybluehost.mewww.fjj.duj.mybluehost.me
autodiscover.drsexyann.comautodiscover.embraceherflow.comcpanel.drsexyann.comcpanel.embraceherflow.comcpcalendars.drsexyann.comcpcalendars.embraceherflow.comcpcontacts.drsexyann.comcpcontacts.embraceherflow.comdrsexyann.comdrsexyann.embraceherflow.comembraceherflow.commail.drsexyann.commail.embraceherflow.comwebdisk.drsexyann.comwebdisk.embraceherflow.comwebmail.drsexyann.comwebmail.embraceherflow.comwww.drsexyann.comwww.drsexyann.embraceherflow.comwww.embraceherflow.com
autodiscover.jwholesalespa.comcpanel.jwholesalespa.comcpcalendars.jwholesalespa.comcpcontacts.jwholesalespa.comjwholesalespa.comjwholesalespa.nlyh.orgmail.jwholesalespa.comwebdisk.jwholesalespa.comwebmail.jwholesalespa.comwww.jwholesalespa.comwww.jwholesalespa.nlyh.org
autodiscover.bmm.isd.mybluehost.mebmm.isd.mybluehost.mecpanel.bmm.isd.mybluehost.mecpcalendars.bmm.isd.mybluehost.mecpcontacts.bmm.isd.mybluehost.mekimchikisses.commail.bmm.isd.mybluehost.memail.kimchikisses.comwebdisk.bmm.isd.mybluehost.mewebmail.bmm.isd.mybluehost.mewww.bmm.isd.mybluehost.mewww.kimchikisses.com
autodiscover.leavingchristianity.netautodiscover.withinthekingdom.comcpanel.leavingchristianity.netcpanel.withinthekingdom.comcpcalendars.leavingchristianity.netcpcalendars.withinthekingdom.comcpcontacts.leavingchristianity.netcpcontacts.withinthekingdom.comleavingchristianity-net.pmg.dbr.mybluehost.meleavingchristianity.netmail.leavingchristianity.netmail.withinthekingdom.comwebdisk.leavingchristianity.netwebdisk.withinthekingdom.comwebmail.leavingchristianity.netwebmail.withinthekingdom.comwithinthekingdom.comwithinthekingdom.pmg.dbr.mybluehost.mewww.leavingchristianity-net.pmg.dbr.mybluehost.mewww.leavingchristianity.netwww.withinthekingdom.comwww.withinthekingdom.pmg.dbr.mybluehost.me
dealers-marketing.moveyoutoday.comwww.dealers-marketing.moveyoutoday.com
autodiscover.nlyh.orgautodiscover.primroseground.comcpanel.nlyh.orgcpanel.primroseground.comcpcalendars.nlyh.orgcpcalendars.primroseground.comcpcontacts.nlyh.orgcpcontacts.primroseground.commail.nlyh.orgmail.primroseground.comnlyh.orgprimroseground.comprimroseground.nlyh.orgwebdisk.nlyh.orgwebdisk.primroseground.comwebmail.nlyh.orgwebmail.primroseground.comwww.nlyh.orgwww.primroseground.comwww.primroseground.nlyh.org
autodiscover.cinetyka.mgcinetyka-mg.andcorp.orgcinetyka.mgcpanel.cinetyka.mgcpcalendars.cinetyka.mgcpcontacts.cinetyka.mgmail.cinetyka.mgwebdisk.cinetyka.mgwebmail.cinetyka.mgwww.cinetyka-mg.andcorp.orgwww.cinetyka.mg
autodiscover.rmt.zga.mybluehost.mebloomsrentals.comcpanel.rmt.zga.mybluehost.mecpcalendars.rmt.zga.mybluehost.mecpcontacts.rmt.zga.mybluehost.memail.rmt.zga.mybluehost.mermt.zga.mybluehost.mewebdisk.rmt.zga.mybluehost.mewebmail.rmt.zga.mybluehost.mewww.rmt.zga.mybluehost.me
autodiscover.hss.lcd.mybluehost.mecpanel.hss.lcd.mybluehost.mecpcalendars.hss.lcd.mybluehost.mecpcontacts.hss.lcd.mybluehost.mehss.lcd.mybluehost.memail.hss.lcd.mybluehost.memail.ushoneybeehealthsurvey.infoushoneybeehealthsurvey.infowebdisk.hss.lcd.mybluehost.mewebmail.hss.lcd.mybluehost.mewww.hss.lcd.mybluehost.mewww.ushoneybeehealthsurvey.info
defendeastpenn.commail.defendeastpenn.comwww.defendeastpenn.com
autodiscover.greenvalleylandscapingma-ri.comcpanel.greenvalleylandscapingma-ri.comcpcalendars.greenvalleylandscapingma-ri.comcpcontacts.greenvalleylandscapingma-ri.comgreenvalleylandscapingma-ri.commail.greenvalleylandscapingma-ri.commail.xperttreeservicesma-ri.comwebdisk.greenvalleylandscapingma-ri.comwebmail.greenvalleylandscapingma-ri.comwww.greenvalleylandscapingma-ri.comwww.xperttreeservicesma-ri.comxperttreeservicesma-ri.com
autodiscover.berenicelefebvre.comberenicelefebvre.comcpanel.berenicelefebvre.comcpcalendars.berenicelefebvre.comcpcontacts.berenicelefebvre.commail.berenicelefebvre.comwebdisk.berenicelefebvre.comwebmail.berenicelefebvre.comwww.berenicelefebvre.com
autodiscover.ldb.psw.mybluehost.mecpanel.ldb.psw.mybluehost.mecpcalendars.ldb.psw.mybluehost.mecpcontacts.ldb.psw.mybluehost.meepicchronicles.caldb.psw.mybluehost.memail.epicchronicles.camail.ldb.psw.mybluehost.mewebdisk.ldb.psw.mybluehost.mewebmail.ldb.psw.mybluehost.mewww.epicchronicles.cawww.ldb.psw.mybluehost.me
autodiscover.brandengill.comautodiscover.overthinkingcomics.combrandengill.combrandengill.seanneprud.comcpanel.brandengill.comcpanel.overthinkingcomics.comcpcalendars.brandengill.comcpcalendars.overthinkingcomics.comcpcontacts.brandengill.comcpcontacts.overthinkingcomics.comcup-a-swamp.seanneprud.commail.brandengill.commail.overthinkingcomics.comoverthinkingcomics.comoverthinkingcomics.seanneprud.comwebdisk.brandengill.comwebdisk.overthinkingcomics.comwebmail.brandengill.comwebmail.overthinkingcomics.comwww.brandengill.comwww.brandengill.seanneprud.comwww.cup-a-swamp.seanneprud.comwww.overthinkingcomics.comwww.overthinkingcomics.seanneprud.com
autodiscover.improveyour20s.comcpanel.improveyour20s.comcpcalendars.improveyour20s.comcpcontacts.improveyour20s.comimproveyour20s.commail.improveyour20s.comwebdisk.improveyour20s.comwebmail.improveyour20s.comwww.improveyour20s.com
autodiscover.keatonlannert.comcpanel.keatonlannert.comcpcalendars.keatonlannert.comcpcontacts.keatonlannert.comkeatonlannert.commail.keatonlannert.comwebdisk.keatonlannert.comwebmail.keatonlannert.comwww.keatonlannert.com
autodiscover.cadeauchocolat.comcadeauchocolat.comcpanel.cadeauchocolat.comcpcalendars.cadeauchocolat.comcpcontacts.cadeauchocolat.commail.cadeauchocolat.comwebdisk.cadeauchocolat.comwebmail.cadeauchocolat.comwebsite-3c332e22.xly.czh.mybluehost.mewww.cadeauchocolat.comwww.website-3c332e22.xly.czh.mybluehost.me
autodiscover.saltycentral.comcpanel.saltycentral.comcpcalendars.saltycentral.comcpcontacts.saltycentral.commail.saltycentral.comsaltycentral.comwebdisk.saltycentral.comwebmail.saltycentral.comwww.saltycentral.com
autodiscover.bobbymoen.combobbymoen.comcpanel.bobbymoen.comcpcalendars.bobbymoen.comcpcontacts.bobbymoen.commail.bobbymoen.comwebdisk.bobbymoen.comwebmail.bobbymoen.comwww.bobbymoen.com
autodiscover.fjb.gro.mybluehost.mecpanel.fjb.gro.mybluehost.mecpcalendars.fjb.gro.mybluehost.mecpcontacts.fjb.gro.mybluehost.mefjb.gro.mybluehost.mejesustrustinginhim.camail.fjb.gro.mybluehost.memail.jesustrustinginhim.cawebdisk.fjb.gro.mybluehost.mewebmail.fjb.gro.mybluehost.mewww.fjb.gro.mybluehost.mewww.jesustrustinginhim.ca
autodiscover.milehighsquares.orgcpanel.milehighsquares.orgcpcalendars.milehighsquares.orgcpcontacts.milehighsquares.orgmail.milehighsquares.orgmilehighsquares.orgwebdisk.milehighsquares.orgwebmail.milehighsquares.orgwww.milehighsquares.org
autodiscover.radhakrishna.caautodiscover.vedictantra.cabridaldressesbykiran.cacpanel.radhakrishna.cacpanel.vedictantra.cacpcalendars.radhakrishna.cacpcalendars.vedictantra.cacpcontacts.radhakrishna.cacpcontacts.vedictantra.camail.bridaldressesbykiran.camail.radhakrishna.camail.vedictantra.caradhakrishna-ca.vedictantra.caradhakrishna.cavedictantra.cawebdisk.radhakrishna.cawebdisk.vedictantra.cawebmail.radhakrishna.cawebmail.vedictantra.cawww.bridaldressesbykiran.cawww.radhakrishna-ca.vedictantra.cawww.radhakrishna.cawww.vedictantra.ca
autodiscover.awx.rew.mybluehost.meawx.rew.mybluehost.mebolbiethebear.comcpanel.awx.rew.mybluehost.mecpcalendars.awx.rew.mybluehost.mecpcontacts.awx.rew.mybluehost.memail.awx.rew.mybluehost.mewebdisk.awx.rew.mybluehost.mewebmail.awx.rew.mybluehost.mewww.awx.rew.mybluehost.mewww.bolbiethebear.com
cpanel.novacountertopsusa.comcpcalendars.novacountertopsusa.comcpcontacts.novacountertopsusa.commail.novacountertopsusa.comwebdisk.novacountertopsusa.comwebmail.novacountertopsusa.com
cpanel.vnv.sty.mybluehost.memail.vnv.sty.mybluehost.mevnv.sty.mybluehost.mewebmail.vnv.sty.mybluehost.mewww.vnv.sty.mybluehost.me
autodiscover.myh.rwl.mybluehost.mebeauheyman.comcpanel.myh.rwl.mybluehost.mecpcalendars.myh.rwl.mybluehost.mecpcontacts.myh.rwl.mybluehost.meletthebunsbake.commail.beauheyman.commail.letthebunsbake.commail.myh.rwl.mybluehost.memyh.rwl.mybluehost.mewebdisk.myh.rwl.mybluehost.mewebmail.myh.rwl.mybluehost.mewww.beauheyman.comwww.letthebunsbake.comwww.myh.rwl.mybluehost.me
autodiscover.cdi.pmc.mybluehost.mecdi.pmc.mybluehost.mecpanel.cdi.pmc.mybluehost.mecpcalendars.cdi.pmc.mybluehost.mecpcontacts.cdi.pmc.mybluehost.mefonvilletreeservice.commail.cdi.pmc.mybluehost.memail.fonvilletreeservice.comwebdisk.cdi.pmc.mybluehost.mewebmail.cdi.pmc.mybluehost.mewww.cdi.pmc.mybluehost.mewww.fonvilletreeservice.com
autodiscover.dermatologiajimenez.comcpanel.dermatologiajimenez.comcpcalendars.dermatologiajimenez.comcpcontacts.dermatologiajimenez.comdermatologiajimenez.comdermatologiajimenez.hfy.ovo.mybluehost.memail.dermatologiajimenez.comwebdisk.dermatologiajimenez.comwebmail.dermatologiajimenez.comwww.dermatologiajimenez.comwww.dermatologiajimenez.hfy.ovo.mybluehost.me
autodiscover.faronassociates.comcpanel.faronassociates.comcpcalendars.faronassociates.comcpcontacts.faronassociates.comfaronassociates.comfaronassociates.snscontractors.commail.faronassociates.comwebdisk.faronassociates.comwebmail.faronassociates.comwww.faronassociates.comwww.faronassociates.snscontractors.com
autodiscover.themightyoakes.comcpanel.themightyoakes.comcpcalendars.themightyoakes.comcpcontacts.themightyoakes.commail.themightyoakes.comthemightyoakes.comwebdisk.themightyoakes.comwebmail.themightyoakes.comwww.themightyoakes.com
anothersunnyday.usautodiscover.anothersunnyday.uscpanel.anothersunnyday.uscpcalendars.anothersunnyday.uscpcontacts.anothersunnyday.uswebdisk.anothersunnyday.uswebmail.anothersunnyday.uswww.anothersunnyday.us
autodiscover.superpsychicroyale.comcpanel.superpsychicroyale.comcpcalendars.superpsychicroyale.comcpcontacts.superpsychicroyale.commail.superpsychicroyale.comsuperpsychicroyale.comwebdisk.superpsychicroyale.comwebmail.superpsychicroyale.comwww.superpsychicroyale.com
autodiscover.chr.vql.mybluehost.mechr.vql.mybluehost.mecpanel.chr.vql.mybluehost.mecpcalendars.chr.vql.mybluehost.mecpcontacts.chr.vql.mybluehost.memail.chr.vql.mybluehost.mewebdisk.chr.vql.mybluehost.mewebmail.chr.vql.mybluehost.mewww.chr.vql.mybluehost.me
autodiscover.discgolfaround.comcpanel.discgolfaround.comcpcalendars.discgolfaround.comcpcontacts.discgolfaround.comdiscgolfaround.commail.discgolfaround.comwebdisk.discgolfaround.comwebmail.discgolfaround.comwww.discgolfaround.com
autodiscover.nmk.dhy.mybluehost.mecpanel.nmk.dhy.mybluehost.mecpcalendars.nmk.dhy.mybluehost.mecpcontacts.nmk.dhy.mybluehost.memail.nmk.dhy.mybluehost.memail.wowexpress.orgnmk.dhy.mybluehost.mewebdisk.nmk.dhy.mybluehost.mewebmail.nmk.dhy.mybluehost.mewowexpress.orgwww.nmk.dhy.mybluehost.mewww.wowexpress.org
autodiscover.pinoandpie.comautodiscover.slinkyandmoose.comcpanel.pinoandpie.comcpanel.slinkyandmoose.comcpcalendars.pinoandpie.comcpcalendars.slinkyandmoose.comcpcontacts.pinoandpie.comcpcontacts.slinkyandmoose.commail.pinoandpie.commail.slinkyandmoose.compinoandpie.comslinkyandmoose.comslinkyandmoose.pinoandpie.comwebdisk.pinoandpie.comwebdisk.slinkyandmoose.comwebmail.pinoandpie.comwebmail.slinkyandmoose.comwww.pinoandpie.comwww.slinkyandmoose.comwww.slinkyandmoose.pinoandpie.com
leesoverseas.laelgia.comwww.leesoverseas.laelgia.com
autodiscover.gabesiegal.comcpanel.gabesiegal.comcpcalendars.gabesiegal.comcpcontacts.gabesiegal.comgabesiegal.commail.gabesiegal.comwebdisk.gabesiegal.comwebmail.gabesiegal.comwww.gabesiegal.com
autodiscover.growinggreatsouls.comcpanel.growinggreatsouls.comcpcalendars.growinggreatsouls.comcpcontacts.growinggreatsouls.comgrowinggreatsouls.commail.growinggreatsouls.comwebdisk.growinggreatsouls.comwebmail.growinggreatsouls.comwww.growinggreatsouls.com
aiwtd.comaiwtd.nlyh.orgautodiscover.aiwtd.comcpanel.aiwtd.comcpcalendars.aiwtd.comcpcontacts.aiwtd.commail.aiwtd.comwebdisk.aiwtd.comwebmail.aiwtd.comwww.aiwtd.comwww.aiwtd.nlyh.org
autodiscover.zsr.oxd.mybluehost.mecpanel.zsr.oxd.mybluehost.mecpcalendars.zsr.oxd.mybluehost.mecpcontacts.zsr.oxd.mybluehost.megalezmarketing.commail.galezmarketing.commail.zsr.oxd.mybluehost.mewebdisk.zsr.oxd.mybluehost.mewebmail.zsr.oxd.mybluehost.mewww.galezmarketing.comwww.zsr.oxd.mybluehost.mezsr.oxd.mybluehost.me
autodiscover.radiantmindtherapy.comcpanel.radiantmindtherapy.comcpcalendars.radiantmindtherapy.comcpcontacts.radiantmindtherapy.commail.radiantmindtherapy.comradiantmindtherapy.comwebdisk.radiantmindtherapy.comwebmail.radiantmindtherapy.comwebsite-cea4c429.accessibledbt.comwww.radiantmindtherapy.comwww.website-cea4c429.accessibledbt.com
autodiscover.thewhitelightcollective.comcpanel.thewhitelightcollective.comcpcalendars.thewhitelightcollective.comcpcontacts.thewhitelightcollective.commail.thewhitelightcollective.comthewhitelightcollective.comwebdisk.thewhitelightcollective.comwebmail.thewhitelightcollective.comwww.thewhitelightcollective.com
autodiscover.trafficfreegh.comcpanel.trafficfreegh.comcpcalendars.trafficfreegh.comcpcontacts.trafficfreegh.comgzp.xng.mybluehost.memail.gzp.xng.mybluehost.memail.trafficfreegh.comtrafficfreegh.comwebdisk.trafficfreegh.comwebmail.trafficfreegh.comwww.gzp.xng.mybluehost.mewww.trafficfreegh.com
autodiscover.prayerpointpress.comautodiscover.vyf.svi.mybluehost.mecpanel.prayerpointpress.comcpanel.vyf.svi.mybluehost.mecpcalendars.prayerpointpress.comcpcalendars.vyf.svi.mybluehost.mecpcontacts.prayerpointpress.comcpcontacts.vyf.svi.mybluehost.memail.prayerpointpress.commail.vyf.svi.mybluehost.meprayerpointpress.comprayerpointpress.vyf.svi.mybluehost.mevyf.svi.mybluehost.mewebdisk.prayerpointpress.comwebdisk.vyf.svi.mybluehost.mewebmail.prayerpointpress.comwebmail.vyf.svi.mybluehost.mewww.prayerpointpress.comwww.prayerpointpress.vyf.svi.mybluehost.mewww.vyf.svi.mybluehost.me
autodiscover.crystalaccountsnig.comcpanel.crystalaccountsnig.comcpcalendars.crystalaccountsnig.comcpcontacts.crystalaccountsnig.comcrystalaccountsnig.christinescreatives.comcrystalaccountsnig.commail.christinescreatives.commail.crystalaccountsnig.comwebdisk.crystalaccountsnig.comwebmail.crystalaccountsnig.comwww.crystalaccountsnig.christinescreatives.comwww.crystalaccountsnig.comwww.mail.christinescreatives.com
autodiscover.im4c.comcpanel.im4c.comcpcalendars.im4c.comcpcontacts.im4c.comim4c.comim4c.genasysinc.commail.im4c.comwebdisk.im4c.comwebmail.im4c.comwww.im4c.comwww.im4c.genasysinc.com
autodiscover.mindfulequanimity.comcpanel.mindfulequanimity.comcpcalendars.mindfulequanimity.comcpcontacts.mindfulequanimity.commail.mindfulequanimity.commail.xoi.ooe.mybluehost.memindfulequanimity.comwebdisk.mindfulequanimity.comwebmail.mindfulequanimity.comwww.mindfulequanimity.comwww.xoi.ooe.mybluehost.mexoi.ooe.mybluehost.me
prepamasters-com.mte.uzz.mybluehost.meprepamasters.comwww.prepamasters-com.mte.uzz.mybluehost.me
autodiscover.parkramz.comcpanel.parkramz.comcpcalendars.parkramz.comcpcontacts.parkramz.commail.parkramz.comparkramz.amenired.comparkramz.comwebdisk.parkramz.comwebmail.parkramz.comwww.parkramz.amenired.comwww.parkramz.com
autodiscover.beyondglioblastoma.combeyondglioblastoma.atentforfour.combeyondglioblastoma.comcpanel.beyondglioblastoma.comcpcalendars.beyondglioblastoma.comcpcontacts.beyondglioblastoma.commail.beyondglioblastoma.comwebdisk.beyondglioblastoma.comwebmail.beyondglioblastoma.comwww.beyondglioblastoma.atentforfour.comwww.beyondglioblastoma.com
autodiscover.thb.bpj.mybluehost.mecpanel.thb.bpj.mybluehost.mecpcalendars.thb.bpj.mybluehost.mecpcontacts.thb.bpj.mybluehost.meemmasteinbeckromance.commail.thb.bpj.mybluehost.methb.bpj.mybluehost.mewebdisk.thb.bpj.mybluehost.mewebmail.thb.bpj.mybluehost.mewww.emmasteinbeckromance.comwww.thb.bpj.mybluehost.me
autodiscover.elm-rc.comcpanel.elm-rc.comcpcalendars.elm-rc.comcpcontacts.elm-rc.comelm-rc.commail.elm-rc.comwebdisk.elm-rc.comwebmail.elm-rc.comwww.elm-rc.com
autodiscover.xcf.wvs.mybluehost.mecpanel.xcf.wvs.mybluehost.mecpcalendars.xcf.wvs.mybluehost.mecpcontacts.xcf.wvs.mybluehost.memail.razahandymanservices.commail.xcf.wvs.mybluehost.merazahandymanservices.comwebdisk.xcf.wvs.mybluehost.mewebmail.xcf.wvs.mybluehost.mewww.razahandymanservices.comwww.xcf.wvs.mybluehost.mexcf.wvs.mybluehost.me
autodiscover.montcopatchpro.comcpanel.montcopatchpro.comcpcalendars.montcopatchpro.comcpcontacts.montcopatchpro.commail.montcopatchpro.commontcopatchpro.comwebdisk.montcopatchpro.comwebmail.montcopatchpro.comwww.montcopatchpro.com
autodiscover.loveandwar.comcpanel.loveandwar.comcpcalendars.loveandwar.comcpcontacts.loveandwar.comloveandwar-com.pkk.xvd.mybluehost.meloveandwar.commail.loveandwar.comwebdisk.loveandwar.comwebmail.loveandwar.comwww.loveandwar-com.pkk.xvd.mybluehost.mewww.loveandwar.com
autodiscover.configjon.comconfigjon.comconfigjon.infoconfigjon.netconfigjon.orgconfigured.techcpanel.configjon.comcpcalendars.configjon.comcpcontacts.configjon.commail.configjon.commail.configjon.infomail.configjon.netmail.configjon.orgmail.configured.techwebdisk.configjon.comwebmail.configjon.comwww.configjon.comwww.configjon.infowww.configjon.netwww.configjon.orgwww.configured.tech
autodiscover.doorbustersale.comautodiscover.kaabuzz.comcpanel.doorbustersale.comcpanel.kaabuzz.comcpcalendars.doorbustersale.comcpcalendars.kaabuzz.comcpcontacts.doorbustersale.comcpcontacts.kaabuzz.comdoorbustersale.comdoorbustersale.thematchmakingteam.comkaabuzz.comkaabuzz.thematchmakingteam.commail.doorbustersale.commail.kaabuzz.comwebdisk.doorbustersale.comwebdisk.kaabuzz.comwebmail.doorbustersale.comwebmail.kaabuzz.comwww.doorbustersale.comwww.doorbustersale.thematchmakingteam.comwww.kaabuzz.comwww.kaabuzz.thematchmakingteam.com
autodiscover.ivuemedia.comautodiscover.ivuerobotics.comcpanel.ivuemedia.comcpanel.ivuerobotics.comcpcalendars.ivuemedia.comcpcalendars.ivuerobotics.comcpcontacts.ivuemedia.comcpcontacts.ivuerobotics.comivuemedia.comivuemedia.ivuerobotics.comivuerobotics.commail.ivuemedia.commail.ivuerobotics.comwebdisk.ivuemedia.comwebdisk.ivuerobotics.comwebmail.ivuemedia.comwebmail.ivuerobotics.comwww.ivuemedia.comwww.ivuemedia.ivuerobotics.comwww.ivuerobotics.com
cpanel.gbts-llc.comcpcalendars.gbts-llc.comcpcontacts.gbts-llc.comgbts-llc.commail.gbts-llc.comwebdisk.gbts-llc.comwebmail.gbts-llc.comwww.gbts-llc.com
autodiscover.nbtrades.comcpanel.nbtrades.comcpcalendars.nbtrades.comcpcontacts.nbtrades.commail.nbtrades.comnbtrades.comnbtrades.thematchmakingteam.comwebdisk.nbtrades.comwebmail.nbtrades.comwww.nbtrades.comwww.nbtrades.thematchmakingteam.com
old.pavedc.org
autodiscover.badassloops.combadassloops.combadassloops.willragano.comcpanel.badassloops.comcpcalendars.badassloops.comcpcontacts.badassloops.commail.badassloops.comwebdisk.badassloops.comwebmail.badassloops.comwww.badassloops.comwww.badassloops.willragano.com
autodiscover.grape-experiences.comcpanel.grape-experiences.comcpcalendars.grape-experiences.comcpcontacts.grape-experiences.comgrape-experiences.commail.grape-experiences.comwebdisk.grape-experiences.comwebmail.grape-experiences.comwww.grape-experiences.com
autodiscover.dmwoodturners.comcpanel.dmwoodturners.comcpcalendars.dmwoodturners.comcpcontacts.dmwoodturners.comdmwoodturners.commail.dmwoodturners.comwebdisk.dmwoodturners.comwebmail.dmwoodturners.comwww.dmwoodturners.com
bumclues.schindlerengineering.comwww.bumclues.schindlerengineering.com
autodiscover.shy.lcd.mybluehost.mecpanel.shy.lcd.mybluehost.mecpcalendars.shy.lcd.mybluehost.mecpcontacts.shy.lcd.mybluehost.meeleventy-one.commail.eleventy-one.commail.shy.lcd.mybluehost.meshy.lcd.mybluehost.mewebdisk.shy.lcd.mybluehost.mewebmail.shy.lcd.mybluehost.mewww.eleventy-one.comwww.shy.lcd.mybluehost.me
autodiscover.inspirednationonline.comcpanel.inspirednationonline.comcpcalendars.inspirednationonline.comcpcontacts.inspirednationonline.cominspirednationonline.commail.inspirednationonline.comwebdisk.inspirednationonline.comwebmail.inspirednationonline.comwww.inspirednationonline.com
autodiscover.ljx.ryb.mybluehost.mecpanel.ljx.ryb.mybluehost.mecpcalendars.ljx.ryb.mybluehost.mecpcontacts.ljx.ryb.mybluehost.meljx.ryb.mybluehost.memail.ljx.ryb.mybluehost.memail.silkbeautyfromqi.comsilkbeautyfromqi.comwebdisk.ljx.ryb.mybluehost.mewebmail.ljx.ryb.mybluehost.mewww.ljx.ryb.mybluehost.mewww.silkbeautyfromqi.com
autodiscover.cht.jvd.mybluehost.mecht.jvd.mybluehost.mecpanel.cht.jvd.mybluehost.mecpcalendars.cht.jvd.mybluehost.mecpcontacts.cht.jvd.mybluehost.mejanellelynnrn.commail.cht.jvd.mybluehost.memail.janellelynnrn.comwebdisk.cht.jvd.mybluehost.mewebmail.cht.jvd.mybluehost.mewww.cht.jvd.mybluehost.mewww.janellelynnrn.com
autodiscover.heidischubert.comcpanel.heidischubert.comcpcalendars.heidischubert.comcpcontacts.heidischubert.comheidischubert.comlivingthehlife.commail.heidischubert.commail.livingthehlife.comwebdisk.heidischubert.comwebmail.heidischubert.comwww.heidischubert.comwww.livingthehlife.com
autodiscover.enf.ihj.mybluehost.mecpanel.enf.ihj.mybluehost.mecpcalendars.enf.ihj.mybluehost.mecpcontacts.enf.ihj.mybluehost.meenf.ihj.mybluehost.memail.bat-trac.commail.enf.ihj.mybluehost.mewebdisk.enf.ihj.mybluehost.mewebmail.enf.ihj.mybluehost.mewww.enf.ihj.mybluehost.me
autodiscover.xmw.pan.mybluehost.mecpanel.xmw.pan.mybluehost.mecpcalendars.xmw.pan.mybluehost.mecpcontacts.xmw.pan.mybluehost.memail.xmw.pan.mybluehost.mewebdisk.xmw.pan.mybluehost.mewebmail.xmw.pan.mybluehost.mewww.xmw.pan.mybluehost.mexmw.pan.mybluehost.me
autodiscover.chiefsimplicityofficer.comautodiscover.tinker1881.comchiefsimplicityofficer.comcpanel.chiefsimplicityofficer.comcpanel.tinker1881.comcpcalendars.chiefsimplicityofficer.comcpcalendars.tinker1881.comcpcontacts.chiefsimplicityofficer.comcpcontacts.tinker1881.commail.chiefsimplicityofficer.commail.tinker1881.comtinker1881.chiefsimplicityofficer.comtinker1881.comwebdisk.chiefsimplicityofficer.comwebdisk.tinker1881.comwebmail.chiefsimplicityofficer.comwebmail.tinker1881.comwww.chiefsimplicityofficer.comwww.tinker1881.chiefsimplicityofficer.comwww.tinker1881.com
cpanel.secondcityfireprotection.comcpcalendars.secondcityfireprotection.comcpcontacts.secondcityfireprotection.commail.secondcityfireprotection.comsecondcityfireprotection.comwebdisk.secondcityfireprotection.comwebmail.secondcityfireprotection.comwww.secondcityfireprotection.com
autodiscover.votersrighttoknow.orgcpanel.votersrighttoknow.orgcpcalendars.votersrighttoknow.orgcpcontacts.votersrighttoknow.orgmail.votersrighttoknow.orgvotersrighttoknow.orgwebdisk.votersrighttoknow.orgwebmail.votersrighttoknow.orgwww.votersrighttoknow.org
autodiscover.dearricky.comcpanel.dearricky.comcpcalendars.dearricky.comcpcontacts.dearricky.comdearricky.commail.dearricky.comwebdisk.dearricky.comwebmail.dearricky.comwww.dearricky.com
autodiscover.ohanaparents.comcpanel.ohanaparents.comcpcalendars.ohanaparents.comcpcontacts.ohanaparents.commail.ohanadoulas.commail.ohanaparents.commail.seattledoulapartners.comohanadoulas.comohanaparents.comseattledoulapartners.comwebdisk.ohanaparents.comwebmail.ohanaparents.comwww.ohanadoulas.comwww.ohanaparents.comwww.seattledoulapartners.com
autodiscover.aze.bwk.mybluehost.meaze.bwk.mybluehost.mecpanel.aze.bwk.mybluehost.mecpcalendars.aze.bwk.mybluehost.mecpcontacts.aze.bwk.mybluehost.mehrsfashionllc.commail.aze.bwk.mybluehost.memail.hrsfashionllc.comwebdisk.aze.bwk.mybluehost.mewebmail.aze.bwk.mybluehost.mewww.aze.bwk.mybluehost.mewww.hrsfashionllc.com
autodiscover.badenvillagepharmacy.comautodiscover.pharmasavebadenvillagepharmacy.combadenvillagepharmacy.combadenvillagepharmacy.westmountplacepharmacy.comcpanel.badenvillagepharmacy.comcpanel.pharmasavebadenvillagepharmacy.comcpcalendars.badenvillagepharmacy.comcpcalendars.pharmasavebadenvillagepharmacy.comcpcontacts.badenvillagepharmacy.comcpcontacts.pharmasavebadenvillagepharmacy.commail.badenvillagepharmacy.commail.pharmasavebadenvillagepharmacy.compharmasavebadenvillagepharmacy.compharmasavebadenvillagepharmacy.westmountplacepharmacy.comtest.westmountplacepharmacy.comwebdisk.badenvillagepharmacy.comwebdisk.pharmasavebadenvillagepharmacy.comwebmail.badenvillagepharmacy.comwebmail.pharmasavebadenvillagepharmacy.comwww.badenvillagepharmacy.comwww.badenvillagepharmacy.westmountplacepharmacy.comwww.pharmasavebadenvillagepharmacy.comwww.pharmasavebadenvillagepharmacy.westmountplacepharmacy.comwww.test.westmountplacepharmacy.com
autodiscover.hopesforthepath.orgcpanel.hopesforthepath.orgcpcalendars.hopesforthepath.orgcpcontacts.hopesforthepath.orghopesforthepath.orgmail.hopesforthepath.orgwebdisk.hopesforthepath.orgwebmail.hopesforthepath.orgwebsite-d965dad7.gandtideas.comwww.hopesforthepath.orgwww.website-d965dad7.gandtideas.com
autodiscover.brennanforpa.combrennanforpa.comcpanel.brennanforpa.comcpcalendars.brennanforpa.comcpcontacts.brennanforpa.commail.brennanforpa.comwebdisk.brennanforpa.comwebmail.brennanforpa.comwww.brennanforpa.com
autodiscover.southernlehightogether.comcpanel.southernlehightogether.comcpcalendars.southernlehightogether.comcpcontacts.southernlehightogether.commail.southernlehightogether.comsouthernlehightogether.comwebdisk.southernlehightogether.comwebmail.southernlehightogether.comwww.southernlehightogether.com
autodiscover.sgw.ihj.mybluehost.meautodiscover.ssscolumbia.orgcpanel.sgw.ihj.mybluehost.mecpanel.ssscolumbia.orgcpcalendars.sgw.ihj.mybluehost.mecpcalendars.ssscolumbia.orgcpcontacts.sgw.ihj.mybluehost.mecpcontacts.ssscolumbia.orgmail.sgw.ihj.mybluehost.memail.ssscolumbia.orgsgw.ihj.mybluehost.messscolumbia-org.sgw.ihj.mybluehost.messscolumbia.orgwebdisk.sgw.ihj.mybluehost.mewebdisk.ssscolumbia.orgwebmail.sgw.ihj.mybluehost.mewebmail.ssscolumbia.orgwww.sgw.ihj.mybluehost.mewww.ssscolumbia-org.sgw.ihj.mybluehost.mewww.ssscolumbia.org
autodiscover.wfh.tdd.mybluehost.mecpanel.wfh.tdd.mybluehost.mecpcalendars.wfh.tdd.mybluehost.mecpcontacts.wfh.tdd.mybluehost.meheraextension.commail.heraextension.commail.wfh.tdd.mybluehost.mewebdisk.wfh.tdd.mybluehost.mewebmail.wfh.tdd.mybluehost.mewfh.tdd.mybluehost.mewww.heraextension.comwww.wfh.tdd.mybluehost.me
cpanel.grupolazaro.comcpcalendars.grupolazaro.comcpcontacts.grupolazaro.comgrupolazaro.commail.grupolazaro.comwebdisk.grupolazaro.comwebmail.grupolazaro.comwww.grupolazaro.com
autodiscover.driftlessrevival.comautodiscover.littlefeetbigworld.blogcpanel.driftlessrevival.comcpanel.littlefeetbigworld.blogcpcalendars.driftlessrevival.comcpcalendars.littlefeetbigworld.blogcpcontacts.driftlessrevival.comcpcontacts.littlefeetbigworld.blogdriftlessrevival.comdriftlessrevival.whippoorwill.colittlefeetbigworld-blog.whippoorwill.colittlefeetbigworld.blogmail.driftlessrevival.commail.littlefeetbigworld.blogwebdisk.driftlessrevival.comwebdisk.littlefeetbigworld.blogwebmail.driftlessrevival.comwebmail.littlefeetbigworld.blogwww.driftlessrevival.comwww.driftlessrevival.whippoorwill.cowww.littlefeetbigworld-blog.whippoorwill.cowww.littlefeetbigworld.blog
autodiscover.b-koolkatsrocks-collier.netautodiscover.boriginallifecoach.comb-koolkatsrocks-collier-net.bcollierp2f.comb-koolkatsrocks-collier.netboriginallifecoach.bcollierp2f.comboriginallifecoach.comcpanel.b-koolkatsrocks-collier.netcpanel.boriginallifecoach.comcpcalendars.b-koolkatsrocks-collier.netcpcalendars.boriginallifecoach.comcpcontacts.b-koolkatsrocks-collier.netcpcontacts.boriginallifecoach.commail.b-koolkatsrocks-collier.netmail.boriginallifecoach.comwebdisk.b-koolkatsrocks-collier.netwebdisk.boriginallifecoach.comwebmail.b-koolkatsrocks-collier.netwebmail.boriginallifecoach.comwww.b-koolkatsrocks-collier-net.bcollierp2f.comwww.b-koolkatsrocks-collier.netwww.boriginallifecoach.bcollierp2f.comwww.boriginallifecoach.com
ancernetwork.orgautodiscover.ancernetwork.orgcpanel.ancernetwork.orgcpcalendars.ancernetwork.orgcpcontacts.ancernetwork.orgmail.ancernetwork.orgwebdisk.ancernetwork.orgwebmail.ancernetwork.orgwww.ancernetwork.org
autodiscover.mah.rfn.mybluehost.mecpanel.mah.rfn.mybluehost.mecpcalendars.mah.rfn.mybluehost.mecpcontacts.mah.rfn.mybluehost.memah.rfn.mybluehost.memail.mah.rfn.mybluehost.memail.thebrilliantfool.comthebrilliantfool.comwebdisk.mah.rfn.mybluehost.mewebmail.mah.rfn.mybluehost.mewww.mah.rfn.mybluehost.mewww.thebrilliantfool.com
autodiscover.litraven.comautodiscover.philomathean.tvcpanel.litraven.comcpanel.philomathean.tvcpcalendars.litraven.comcpcalendars.philomathean.tvcpcontacts.litraven.comcpcontacts.philomathean.tvlitraven.commail.litraven.commail.ome.nah.mybluehost.memail.philomathean.tvome.nah.mybluehost.mephilomathean.tvwebdisk.litraven.comwebdisk.philomathean.tvwebmail.litraven.comwebmail.philomathean.tvwebsite-41f92733.litraven.comwww.litraven.comwww.ome.nah.mybluehost.mewww.philomathean.tvwww.website-41f92733.litraven.com
revolvt.comwww.revolvt.com
autodiscover.qarnis.comcpanel.qarnis.comcpcalendars.qarnis.comcpcontacts.qarnis.commail.qarnis.comqarnis.comqarnis.lfc.twv.mybluehost.methekonzept-ca.lfc.twv.mybluehost.mewebdisk.qarnis.comwebmail.qarnis.comwww.qarnis.comwww.qarnis.lfc.twv.mybluehost.mewww.thekonzept-ca.lfc.twv.mybluehost.me
centralkitchenla.comcpanel.centralkitchenla.comcpcalendars.centralkitchenla.comcpcontacts.centralkitchenla.commail.centralkitchenla.comwebdisk.centralkitchenla.comwebmail.centralkitchenla.comwww.centralkitchenla.com
autodiscover.skyscrapers.todaycpanel.skyscrapers.todaycpcalendars.skyscrapers.todaycpcontacts.skyscrapers.todaymail.skyscrapers.todayskyscrapers.todaywebdisk.skyscrapers.todaywebmail.skyscrapers.todaywebsite-faff2f2d.thematchmakingteam.comwww.skyscrapers.todaywww.website-faff2f2d.thematchmakingteam.com
autodiscover.schindlerengineering.comcpanel.schindlerengineering.comcpcalendars.schindlerengineering.comcpcontacts.schindlerengineering.commail.schindlerengineering.comschindlerengineering.comwebdisk.schindlerengineering.comwebmail.schindlerengineering.comwww.schindlerengineering.com
website-f4f68066.simplyfinn.comwww.website-f4f68066.simplyfinn.com
airr-na.orgautodiscover.airr-na.orgcpanel.airr-na.orgcpcalendars.airr-na.orgcpcontacts.airr-na.orgmail.airr-na.orgwebdisk.airr-na.orgwebmail.airr-na.orgwww.airr-na.org
autodiscover.campustocorporatellc.comcampustocorporatellc.comcpanel.campustocorporatellc.comcpcalendars.campustocorporatellc.comcpcontacts.campustocorporatellc.commail.campustocorporatellc.comwebdisk.campustocorporatellc.comwebmail.campustocorporatellc.comwww.campustocorporatellc.com
www.zealium.mediazealium.media
autodiscover.creatimartcr.comcpanel.creatimartcr.comcpcalendars.creatimartcr.comcpcontacts.creatimartcr.comcreatimartcr.commail.creatimartcr.comwebdisk.creatimartcr.comwebmail.creatimartcr.comwww.creatimartcr.com
autodiscover.bahaiteacher.orgbahaiteacher.orgcpanel.bahaiteacher.orgcpcalendars.bahaiteacher.orgcpcontacts.bahaiteacher.orgmail.bahaiteacher.orgwebdisk.bahaiteacher.orgwebmail.bahaiteacher.orgwww.bahaiteacher.org
autodiscover.mediakrsolutions.comcpanel.mediakrsolutions.comcpcalendars.mediakrsolutions.comcpcontacts.mediakrsolutions.commail.mediakrsolutions.commediakrsolutions.comwebdisk.mediakrsolutions.comwebmail.mediakrsolutions.comwebsite-da2d9bdc.qok.pan.mybluehost.mewww.mediakrsolutions.comwww.website-da2d9bdc.qok.pan.mybluehost.me
advancedtreehealth.comadvancetreehealth.comautodiscover.advancedtreehealth.comcpanel.advancedtreehealth.comcpcalendars.advancedtreehealth.comcpcontacts.advancedtreehealth.commail.advancedtreehealth.commail.advancetreehealth.comwebdisk.advancedtreehealth.comwebmail.advancedtreehealth.comwww.advancedtreehealth.comwww.advancetreehealth.com
autodiscover.newcomfortinc.comcpanel.newcomfortinc.comcpcalendars.newcomfortinc.comcpcontacts.newcomfortinc.commail.newcomfortinc.comnewcomfortinc.comwebdisk.newcomfortinc.comwebmail.newcomfortinc.comwww.newcomfortinc.com
autodiscover.naturallygoodlife.comcpanel.naturallygoodlife.comcpcalendars.naturallygoodlife.comcpcontacts.naturallygoodlife.commail.naturallygoodlife.comnaturallygoodlife.comwebdisk.naturallygoodlife.comwebmail.naturallygoodlife.comwww.naturallygoodlife.com
mail.thesleepeasymethod.commail.wholehomeandbodyhealth.comthesleepeasymethod.comwebmail.wholehomeandbodyhealth.comwholehomeandbodyhealth.comwww.wholehomeandbodyhealth.com
autodiscover.roofsaversco.comcpanel.roofsaversco.comcpcalendars.roofsaversco.comcpcontacts.roofsaversco.commail.roofsaversco.commail.roofsaverscolorado.comroofsaversco.comroofsaverscolorado.comwebdisk.roofsaversco.comwebmail.roofsaversco.comwww.roofsaversco.comwww.roofsaverscolorado.com
autodiscover.yqr.bzx.mybluehost.mecpanel.yqr.bzx.mybluehost.mecpcalendars.yqr.bzx.mybluehost.mecpcontacts.yqr.bzx.mybluehost.memail.yqr.bzx.mybluehost.mewebdisk.yqr.bzx.mybluehost.mewebmail.yqr.bzx.mybluehost.mewww.yqr.bzx.mybluehost.meyqr.bzx.mybluehost.me
en.cydefi.comwww.en.cydefi.com
autodiscover.aysphiladelphia.comaysphiladelphia.comcpanel.aysphiladelphia.comcpcalendars.aysphiladelphia.comcpcontacts.aysphiladelphia.commail.aysphiladelphia.comwebdisk.aysphiladelphia.comwebmail.aysphiladelphia.comwww.aysphiladelphia.com
cpanel.rve.vua.mybluehost.mecpcalendars.rve.vua.mybluehost.mecpcontacts.rve.vua.mybluehost.memail.rve.vua.mybluehost.memail.tahitianinn.comrve.vua.mybluehost.metahitianinn.comwebdisk.rve.vua.mybluehost.mewebmail.rve.vua.mybluehost.mewww.rve.vua.mybluehost.mewww.tahitianinn.com
autodiscover.insideoutcareer.comcpanel.insideoutcareer.comcpcalendars.insideoutcareer.comcpcontacts.insideoutcareer.cominsideoutcareer.commail.insideoutcareer.comwebdisk.insideoutcareer.comwebmail.insideoutcareer.comwww.insideoutcareer.com
autodiscover.nwgroutworks.comcpanel.nwgroutworks.comcpcalendars.nwgroutworks.comcpcontacts.nwgroutworks.commail.nwgroutworks.comnwgroutworks.comwebdisk.nwgroutworks.comwebmail.nwgroutworks.comwww.nwgroutworks.com
autodiscover.xrk.get.mybluehost.mecpanel.xrk.get.mybluehost.mecpcalendars.xrk.get.mybluehost.mecpcontacts.xrk.get.mybluehost.memail.rrcompany.comail.xrk.get.mybluehost.merrcompany.cowebdisk.xrk.get.mybluehost.mewebmail.xrk.get.mybluehost.mewww.rrcompany.cowww.xrk.get.mybluehost.mexrk.get.mybluehost.me
autodiscover.fairmount-heights.orgautodiscover.ronhalbertproductions.comcpanel.fairmount-heights.orgcpanel.ronhalbertproductions.comcpcalendars.fairmount-heights.orgcpcalendars.ronhalbertproductions.comcpcontacts.fairmount-heights.orgcpcontacts.ronhalbertproductions.comfairmount-heights-org.ronhalbertproductions.comfairmount-heights.orgmail.fairmount-heights.orgmail.ronhalbertproductions.comronhalbertproductions.comwebdisk.fairmount-heights.orgwebdisk.ronhalbertproductions.comwebmail.fairmount-heights.orgwebmail.ronhalbertproductions.comwww.fairmount-heights-org.ronhalbertproductions.comwww.fairmount-heights.orgwww.ronhalbertproductions.com
autodiscover.mte.uzz.mybluehost.mecpanel.mte.uzz.mybluehost.mecpcalendars.mte.uzz.mybluehost.mecpcontacts.mte.uzz.mybluehost.memail.mte.uzz.mybluehost.memte.uzz.mybluehost.methechefdinnerclub.comwebdisk.mte.uzz.mybluehost.mewebmail.mte.uzz.mybluehost.mewww.mte.uzz.mybluehost.me
autodiscover.hkx.yek.mybluehost.mecpanel.hkx.yek.mybluehost.mecpcalendars.hkx.yek.mybluehost.mecpcontacts.hkx.yek.mybluehost.mefr3domnow.comhkx.yek.mybluehost.memail.fr3domnow.commail.hkx.yek.mybluehost.mewebdisk.hkx.yek.mybluehost.mewebmail.hkx.yek.mybluehost.mewww.fr3domnow.comwww.hkx.yek.mybluehost.me
autodiscover.transcendinghorizonsmarketing.comcpanel.transcendinghorizonsmarketing.comcpcalendars.transcendinghorizonsmarketing.comcpcontacts.transcendinghorizonsmarketing.commail.thesavannahoakswinery.commail.transcendinghorizonsmarketing.comthesavannahoakswinery.comtranscendinghorizonsmarketing.comwebdisk.transcendinghorizonsmarketing.comwebmail.transcendinghorizonsmarketing.comwww.thesavannahoakswinery.comwww.transcendinghorizonsmarketing.com
autodiscover.thelifewhispers.comcpanel.thelifewhispers.comcpcalendars.thelifewhispers.comcpcontacts.thelifewhispers.comwebdisk.thelifewhispers.com
autodiscover.kal.tdd.mybluehost.mecpanel.kal.tdd.mybluehost.mecpcalendars.kal.tdd.mybluehost.mecpcontacts.kal.tdd.mybluehost.medigitaleyearmor.comkal.tdd.mybluehost.memail.digitaleyearmor.commail.kal.tdd.mybluehost.mewebdisk.kal.tdd.mybluehost.mewebmail.kal.tdd.mybluehost.mewww.digitaleyearmor.comwww.kal.tdd.mybluehost.me
website-8dc5acf0.livinglifeyouthwellness.comwww.website-8dc5acf0.livinglifeyouthwellness.com
autodiscover.lauradevaisher.comcpanel.lauradevaisher.comcpcalendars.lauradevaisher.comcpcontacts.lauradevaisher.comlauradevaisher.commail.lauradevaisher.comwebdisk.lauradevaisher.comwebmail.lauradevaisher.comwww.lauradevaisher.com
autodiscover.bryangarde.comautodiscover.on-garde.combryangarde.combryangarde.on-garde.comcalvingarde.comcpanel.bryangarde.comcpanel.on-garde.comcpcalendars.bryangarde.comcpcalendars.on-garde.comcpcontacts.bryangarde.comcpcontacts.on-garde.commail.bryangarde.commail.calvingarde.commail.on-garde.comon-garde.comwebdisk.bryangarde.comwebdisk.on-garde.comwebmail.bryangarde.comwebmail.on-garde.comwww.bryangarde.comwww.bryangarde.on-garde.comwww.calvingarde.comwww.on-garde.com
autodiscover.seefeldtlab.orgcpanel.seefeldtlab.orgcpcalendars.seefeldtlab.orgcpcontacts.seefeldtlab.orgmail.seefeldtlab.orgseefeldtlab.orgwebdisk.seefeldtlab.orgwebmail.seefeldtlab.orgwww.seefeldtlab.org
daviddtaylor.commail.daviddtaylor.comwww.daviddtaylor.com
cpanel.isaacbutler.comcpcalendars.isaacbutler.comcpcontacts.isaacbutler.comisaacbutler.commail.isaacbutler.comwebdisk.isaacbutler.comwebmail.isaacbutler.comwww.isaacbutler.com
autodiscover.collaborativemba.orgcollaborativemba.comcollaborativemba.orgcpanel.collaborativemba.orgcpcalendars.collaborativemba.orgcpcontacts.collaborativemba.orgmail.collaborativemba.commail.collaborativemba.orgwebdisk.collaborativemba.orgwebmail.collaborativemba.orgwww.collaborativemba.comwww.collaborativemba.org
autodiscover.relationalchristianity.comcpanel.relationalchristianity.comcpcalendars.relationalchristianity.comcpcontacts.relationalchristianity.commail.relationalchristianity.comrelationalchristianity.comwebdisk.relationalchristianity.comwebmail.relationalchristianity.comwww.relationalchristianity.com
cpanel.upro1.comcpcalendars.upro1.comcpcontacts.upro1.commail.upro1.commail.upro1.netupro1.netwebdisk.upro1.comwebmail.upro1.comwww.upro1.net
autodiscover.mandalainteriordesigns.comcpanel.mandalainteriordesigns.comcpcalendars.mandalainteriordesigns.comcpcontacts.mandalainteriordesigns.commail.mandalainteriordesigns.commandalainteriordesigns.comwebdisk.mandalainteriordesigns.comwebmail.mandalainteriordesigns.comwww.mandalainteriordesigns.com
cpanel.domaininuse.comdomaininuse.comgrv.zzm.mybluehost.memail.domaininuse.commail.grv.zzm.mybluehost.memail.unexplaineddepths.comunexplaineddepths.comwebmail.domaininuse.comwww.domaininuse.comwww.grv.zzm.mybluehost.mewww.unexplaineddepths.com
autodiscover.middleschoolkingdom.comcpanel.middleschoolkingdom.comcpcalendars.middleschoolkingdom.comcpcontacts.middleschoolkingdom.commail.middleschoolkingdom.commiddleschoolkingdom.gandtideas.comwebdisk.middleschoolkingdom.comwebmail.middleschoolkingdom.comwww.middleschoolkingdom.gandtideas.com
autodiscover.wyr.lcd.mybluehost.mecpanel.wyr.lcd.mybluehost.mecpcalendars.wyr.lcd.mybluehost.mecpcontacts.wyr.lcd.mybluehost.meemmacorriganfilm.commail.emmacorriganfilm.commail.wyr.lcd.mybluehost.mewebdisk.wyr.lcd.mybluehost.mewebmail.wyr.lcd.mybluehost.mewww.emmacorriganfilm.comwww.wyr.lcd.mybluehost.mewyr.lcd.mybluehost.me
apknowledgehub.comautodiscover.mjj.prc.mybluehost.mecpanel.mjj.prc.mybluehost.mecpcalendars.mjj.prc.mybluehost.mecpcontacts.mjj.prc.mybluehost.memail.apknowledgehub.commail.mjj.prc.mybluehost.memjj.prc.mybluehost.mewebdisk.mjj.prc.mybluehost.mewebmail.mjj.prc.mybluehost.mewww.apknowledgehub.comwww.mjj.prc.mybluehost.me
website-657d527b.laelgia.comwww.website-657d527b.laelgia.com
cpanel.wallylambdesign.comcpcalendars.wallylambdesign.comcpcontacts.wallylambdesign.commail.wallylambdesign.comwallylambdesign.comwebdisk.wallylambdesign.comwebmail.wallylambdesign.comwww.wallylambdesign.com
autodiscover.frontlinecustomprinting.comcpanel.frontlinecustomprinting.comcpcalendars.frontlinecustomprinting.comcpcontacts.frontlinecustomprinting.comfrontlinecustomprinting.commail.frontlinecustomprinting.comwebdisk.frontlinecustomprinting.comwebmail.frontlinecustomprinting.comwww.frontlinecustomprinting.com
autodiscover.muratarslanoglu.comcpanel.muratarslanoglu.comcpcalendars.muratarslanoglu.comcpcontacts.muratarslanoglu.commail.muratarslanoglu.commuratarslanoglu.comwebdisk.muratarslanoglu.comwebmail.muratarslanoglu.comwww.muratarslanoglu.com
autodiscover.maxbloom.comcpanel.maxbloom.comcpcalendars.maxbloom.comcpcontacts.maxbloom.commail.maxbloom.commaxbloom.comwebdisk.maxbloom.comwebmail.maxbloom.comwww.maxbloom.com
cpanel.diversifiedequipmentinc.comcpcalendars.diversifiedequipmentinc.comcpcontacts.diversifiedequipmentinc.comdiversifiedequipmentinc.commail.diversifiedequipmentinc.comnew.diversifiedequipmentinc.comwebdisk.diversifiedequipmentinc.comwebmail.diversifiedequipmentinc.comwww.diversifiedequipmentinc.comwww.new.diversifiedequipmentinc.com
autodiscover.sewingcoursesshrewsbury.co.ukcpanel.sewingcoursesshrewsbury.co.ukcpcalendars.sewingcoursesshrewsbury.co.ukcpcontacts.sewingcoursesshrewsbury.co.ukmail.sewingcoursesshrewsbury.co.uksewingcoursesshrewsbury.co.ukwebdisk.sewingcoursesshrewsbury.co.ukwebmail.sewingcoursesshrewsbury.co.ukwww.sewingcoursesshrewsbury.co.uk
autodiscover.fiveonthego.comcpanel.fiveonthego.comcpcalendars.fiveonthego.comcpcontacts.fiveonthego.comfiveonthego.commail.fiveonthego.comwebdisk.fiveonthego.comwebmail.fiveonthego.comwww.fiveonthego.com
autodiscover.demirpinar.comcpanel.demirpinar.comcpcalendars.demirpinar.comcpcontacts.demirpinar.comdemirpinar.commail.demirpinar.comwebdisk.demirpinar.comwebmail.demirpinar.comwww.demirpinar.com
autodiscover.simplyunderstood.comcpanel.simplyunderstood.comcpcalendars.simplyunderstood.comcpcontacts.simplyunderstood.commail.simplyunderstood.comsimplyunderstood.comwebdisk.simplyunderstood.comwebmail.simplyunderstood.comwww.simplyunderstood.com
autodiscover.zog.ufe.mybluehost.mecpanel.zog.ufe.mybluehost.mecpcalendars.zog.ufe.mybluehost.mecpcontacts.zog.ufe.mybluehost.memail.zog.ufe.mybluehost.memicdrop.onewebdisk.zog.ufe.mybluehost.mewebmail.zog.ufe.mybluehost.mewww.micdrop.onewww.zog.ufe.mybluehost.mezog.ufe.mybluehost.me
autodiscover.i-prettybeautystudio.comcpanel.i-prettybeautystudio.comcpcalendars.i-prettybeautystudio.comcpcontacts.i-prettybeautystudio.comdaa.mke.mybluehost.mei-prettybeautystudio.comiprettygirl.commail.daa.mke.mybluehost.memail.i-prettybeautystudio.commail.iprettygirl.comwebdisk.i-prettybeautystudio.comwebmail.i-prettybeautystudio.comwww.daa.mke.mybluehost.mewww.i-prettybeautystudio.comwww.iprettygirl.com
cpanel.yla.joe.mybluehost.mekayleebeeckmansfotografie.commail.kayleebeeckmansfotografie.commail.yla.joe.mybluehost.mewebmail.yla.joe.mybluehost.mewww.kayleebeeckmansfotografie.comwww.yla.joe.mybluehost.meyla.joe.mybluehost.me
autodiscover.kassargroup.comcpanel.kassargroup.comcpcalendars.kassargroup.comcpcontacts.kassargroup.comkassargroup.comkassargroup2.bravaconsultancy.commail.kassargroup.comwebdisk.kassargroup.comwebmail.kassargroup.comwww.kassargroup.comwww.kassargroup2.bravaconsultancy.com
autodiscover.haysolar.com.aucpanel.haysolar.com.aucpcalendars.haysolar.com.aucpcontacts.haysolar.com.auhaysolar.com.aumail.haysolar.com.auwebdisk.haysolar.com.auwebmail.haysolar.com.auwww.haysolar.com.au
tool.plannexcg.comwww.tool.plannexcg.com
autodiscover.imdsspecialists.comcpanel.imdsspecialists.comcpcalendars.imdsspecialists.comcpcontacts.imdsspecialists.comimdsspecialists.comimdsspecialists.imdslynnhelp.commail.imdsspecialists.comwebdisk.imdsspecialists.comwebmail.imdsspecialists.comwww.imdsspecialists.comwww.imdsspecialists.imdslynnhelp.com
autodiscover.monomovement.orgcpanel.monomovement.orgcpcalendars.monomovement.orgcpcontacts.monomovement.orgmail.monomovement.orgmonomovement-org.thematchmakingteam.commonomovement.orgwebdisk.monomovement.orgwebmail.monomovement.orgwww.monomovement-org.thematchmakingteam.comwww.monomovement.org
autodiscover.cop.mzi.mybluehost.mecop.mzi.mybluehost.mecpanel.cop.mzi.mybluehost.mecpcalendars.cop.mzi.mybluehost.mecpcontacts.cop.mzi.mybluehost.memail.cop.mzi.mybluehost.mewebdisk.cop.mzi.mybluehost.mewebmail.cop.mzi.mybluehost.mewww.cop.mzi.mybluehost.me
cpanel.mve.ldj.mybluehost.memail.mve.ldj.mybluehost.memve.ldj.mybluehost.mewebmail.mve.ldj.mybluehost.mewww.mve.ldj.mybluehost.me
artjefferson.comautodiscover.artjefferson.comcpanel.artjefferson.comcpcalendars.artjefferson.comcpcontacts.artjefferson.commail.artjefferson.comwebdisk.artjefferson.comwebmail.artjefferson.comwww.artjefferson.com
autodiscover.rte.qps.mybluehost.mecpanel.rte.qps.mybluehost.mecpcalendars.rte.qps.mybluehost.mecpcontacts.rte.qps.mybluehost.memail.rte.qps.mybluehost.merte.qps.mybluehost.mewebdisk.rte.qps.mybluehost.mewebmail.rte.qps.mybluehost.mewww.rte.qps.mybluehost.me
autodiscover.cometpluto.comcometpluto.comcpanel.cometpluto.comcpcalendars.cometpluto.comcpcontacts.cometpluto.commail.cometpluto.comwebdisk.cometpluto.comwebmail.cometpluto.comwww.cometpluto.com
autodiscover.tankardsaweigh.comcpanel.tankardsaweigh.comcpcalendars.tankardsaweigh.comcpcontacts.tankardsaweigh.commail.tankardsaweigh.comtankardsaweigh.chiefsimplicityofficer.comtankardsaweigh.comwebdisk.tankardsaweigh.comwebmail.tankardsaweigh.comwww.tankardsaweigh.chiefsimplicityofficer.comwww.tankardsaweigh.com
allprofencingplus.comautodiscover.allprofencingplus.comcpanel.allprofencingplus.comcpcalendars.allprofencingplus.comcpcontacts.allprofencingplus.commail.allprofencingplus.comwebdisk.allprofencingplus.comwebmail.allprofencingplus.comwww.allprofencingplus.com
cybersecurealaska.orgdyu.kzx.mybluehost.memail.dyu.kzx.mybluehost.mewww.cybersecurealaska.orgwww.dyu.kzx.mybluehost.me
autodiscover.bizfornurses.combizfornurses.comcpanel.bizfornurses.comcpcalendars.bizfornurses.comcpcontacts.bizfornurses.comink.bli.mybluehost.memail.bizfornurses.commail.ink.bli.mybluehost.mewebdisk.bizfornurses.comwebmail.bizfornurses.comwww.bizfornurses.comwww.ink.bli.mybluehost.me
autodiscover.karenchavez.comcpanel.karenchavez.comcpcalendars.karenchavez.comcpcontacts.karenchavez.comkarenchavez.commail.karenchavez.comtransfer.karenchavez.comwebdisk.karenchavez.comwebmail.karenchavez.comwww.karenchavez.comwww.transfer.karenchavez.com
autodiscover.uft.psw.mybluehost.mecpanel.uft.psw.mybluehost.mecpcalendars.uft.psw.mybluehost.mecpcontacts.uft.psw.mybluehost.memail.uft.psw.mybluehost.memail.wupple.netuft.psw.mybluehost.mewebdisk.uft.psw.mybluehost.mewebmail.uft.psw.mybluehost.mewupple.netwww.uft.psw.mybluehost.mewww.wupple.net
autodiscover.teammcgloin-delevieforpsu.comcpanel.teammcgloin-delevieforpsu.comcpcalendars.teammcgloin-delevieforpsu.comcpcontacts.teammcgloin-delevieforpsu.commail.teammcgloin-delevieforpsu.comteammcgloin-delevieforpsu.comwebdisk.teammcgloin-delevieforpsu.comwebmail.teammcgloin-delevieforpsu.comwww.teammcgloin-delevieforpsu.com
autodiscover.bronxanimalhospital.comautodiscover.morrisparkvet.combronxanimalhospital-com.morrisparkvet.combronxanimalhospital.comcpanel.bronxanimalhospital.comcpanel.morrisparkvet.comcpcalendars.bronxanimalhospital.comcpcalendars.morrisparkvet.comcpcontacts.bronxanimalhospital.comcpcontacts.morrisparkvet.commail.bronxanimalhospital.commail.morrisparkvet.commorrisparkvet.comwebdisk.bronxanimalhospital.comwebdisk.morrisparkvet.comwebmail.bronxanimalhospital.comwebmail.morrisparkvet.comwww.bronxanimalhospital-com.morrisparkvet.comwww.bronxanimalhospital.comwww.morrisparkvet.com
autodiscover.nikahnama.siteautodiscover.spicesindia.cacpanel.nikahnama.sitecpanel.spicesindia.cacpcalendars.nikahnama.sitecpcalendars.spicesindia.cacpcontacts.nikahnama.sitecpcontacts.spicesindia.camail.nikahnama.sitemail.spicesindia.canikahnama-site.vedictantra.canikahnama.sitespicesindia-ca.vedictantra.caspicesindia.catemp.vedictantra.cawebdisk.nikahnama.sitewebdisk.spicesindia.cawebmail.nikahnama.sitewebmail.spicesindia.cawww.nikahnama-site.vedictantra.cawww.nikahnama.sitewww.spicesindia-ca.vedictantra.cawww.spicesindia.cawww.temp.vedictantra.ca
autodiscover.pqg.ssy.mybluehost.mecpanel.pqg.ssy.mybluehost.mecpcalendars.pqg.ssy.mybluehost.mecpcontacts.pqg.ssy.mybluehost.memail.pqg.ssy.mybluehost.memountainviewrecovery.orgpqg.ssy.mybluehost.mewebdisk.pqg.ssy.mybluehost.mewebmail.pqg.ssy.mybluehost.mewww.mountainviewrecovery.orgwww.pqg.ssy.mybluehost.me
autodiscover.nir.qhd.mybluehost.mechiton.storecpanel.nir.qhd.mybluehost.mecpcalendars.nir.qhd.mybluehost.mecpcontacts.nir.qhd.mybluehost.memail.chiton.storemail.nir.qhd.mybluehost.menir.qhd.mybluehost.mewebdisk.nir.qhd.mybluehost.mewebmail.nir.qhd.mybluehost.mewww.chiton.storewww.nir.qhd.mybluehost.me
autodiscover.wwy.ano.mybluehost.mecpanel.wwy.ano.mybluehost.mecpcalendars.wwy.ano.mybluehost.mecpcontacts.wwy.ano.mybluehost.memail.powerplus.twmail.wwy.ano.mybluehost.mepowerplus.twwebdisk.wwy.ano.mybluehost.mewebmail.wwy.ano.mybluehost.mewww.powerplus.twwww.wwy.ano.mybluehost.mewwy.ano.mybluehost.me
cpanel.westlakechineseacademy.orgcpcalendars.westlakechineseacademy.orgcpcontacts.westlakechineseacademy.orgmail.westlakechineseacademy.orgwebdisk.westlakechineseacademy.orgwebmail.westlakechineseacademy.orgwestlakechineseacademy.orgwww.westlakechineseacademy.org
ascend.gwblue.siteautodiscover.gwblue.sitecpanel.gwblue.sitecpcalendars.gwblue.sitecpcontacts.gwblue.sitegwblue-site.pkk.xvd.mybluehost.megwblue.siteloveandwar.gwblue.sitemail.gwblue.sitemsukkar.gwblue.siteredbeard.gwblue.sitetest.gwblue.sitewebdisk.gwblue.sitewebmail.gwblue.sitewww.ascend.gwblue.sitewww.gwblue-site.pkk.xvd.mybluehost.mewww.gwblue.sitewww.loveandwar.gwblue.sitewww.msukkar.gwblue.sitewww.redbeard.gwblue.sitewww.test.gwblue.site
autodiscover.muguetphotography.comcpanel.muguetphotography.comcpcalendars.muguetphotography.comcpcontacts.muguetphotography.commail.muguetphotography.commuguetphotography.commuguetphotography.lfc.twv.mybluehost.mewebdisk.muguetphotography.comwebmail.muguetphotography.comwww.muguetphotography.comwww.muguetphotography.lfc.twv.mybluehost.me
autodiscover.theeverydayhousewife.comcpanel.theeverydayhousewife.comcpcalendars.theeverydayhousewife.comcpcontacts.theeverydayhousewife.commail.theeverydayhousewife.comtheeverydayhousewife.comwebdisk.theeverydayhousewife.comwebmail.theeverydayhousewife.comwww.theeverydayhousewife.com
cpanel.evepackaging.comcpcalendars.evepackaging.comcpcontacts.evepackaging.comevecustompackaging.comevepackaging.commail.evecustompackaging.commail.evepackaging.comwebdisk.evepackaging.comwebmail.evepackaging.comwww.evecustompackaging.comwww.evepackaging.com
autodiscover.soo.fuh.mybluehost.mecpanel.soo.fuh.mybluehost.mecpcalendars.soo.fuh.mybluehost.mecpcontacts.soo.fuh.mybluehost.memail.soo.fuh.mybluehost.memail.worthwhilelife.orgsoo.fuh.mybluehost.mewebdisk.soo.fuh.mybluehost.mewebmail.soo.fuh.mybluehost.meworthwhilelife.orgwww.soo.fuh.mybluehost.mewww.worthwhilelife.org
autodiscover.jcc.qfv.mybluehost.mecpanel.jcc.qfv.mybluehost.mecpcalendars.jcc.qfv.mybluehost.mecpcontacts.jcc.qfv.mybluehost.mefridanelkenrealestate.comjcc.qfv.mybluehost.memail.fridanelkenrealestate.commail.jcc.qfv.mybluehost.mewebdisk.jcc.qfv.mybluehost.mewebmail.jcc.qfv.mybluehost.mewww.fridanelkenrealestate.comwww.jcc.qfv.mybluehost.me
autodiscover.vivianasoto.comcpanel.vivianasoto.comcpcalendars.vivianasoto.comcpcontacts.vivianasoto.commail.vivianasoto.comvivianasoto.comvivianasoto.thelifewhispers.comvivianasoto.vivianasoto.comwebdisk.vivianasoto.comwebmail.vivianasoto.comwww.vivianasoto.comwww.vivianasoto.thelifewhispers.comwww.vivianasoto.vivianasoto.com
autodiscover.dreamcatcherflyfishing.comcpanel.dreamcatcherflyfishing.comcpcalendars.dreamcatcherflyfishing.comcpcontacts.dreamcatcherflyfishing.comdreamcatcherflyfishing.commail.dreamcatcherflyfishing.comwebdisk.dreamcatcherflyfishing.comwebmail.dreamcatcherflyfishing.comwww.dreamcatcherflyfishing.com
autodiscover.mvmteam.comautodiscover.nazeq.comcpanel.mvmteam.comcpanel.nazeq.comcpcalendars.mvmteam.comcpcalendars.nazeq.comcpcontacts.mvmteam.comcpcontacts.nazeq.commail.mvmteam.commail.nazeq.commvmteam.commvmteam.thematchmakingteam.comnazeq.comnazeq.thematchmakingteam.comwebdisk.mvmteam.comwebdisk.nazeq.comwebmail.mvmteam.comwebmail.nazeq.comwww.mvmteam.comwww.mvmteam.thematchmakingteam.comwww.nazeq.comwww.nazeq.thematchmakingteam.com
arizonaroanhorses.comautodiscover.arizonaroanhorses.comazfqhc.comblueroanquarterhorsesinarizona.comcpanel.arizonaroanhorses.comcpcalendars.arizonaroanhorses.comcpcontacts.arizonaroanhorses.commail.arizonaroanhorses.commail.azfqhc.commail.blueroanquarterhorsesinarizona.comwebdisk.arizonaroanhorses.comwebmail.arizonaroanhorses.comwww.arizonaroanhorses.comwww.azfqhc.comwww.blueroanquarterhorsesinarizona.com
ibahai.orgmail.ibahai.orgmail.wcb.tvd.mybluehost.mewcb.tvd.mybluehost.mewww.ibahai.orgwww.wcb.tvd.mybluehost.me
mail.rez.lbn.mybluehost.merez.lbn.mybluehost.mewww.rez.lbn.mybluehost.me
*.bluehost.combluehost.com
annakaytolberk.comautodiscover.annakaytolberk.comcpanel.annakaytolberk.comcpcalendars.annakaytolberk.comcpcontacts.annakaytolberk.commail.annakaytolberk.comwebdisk.annakaytolberk.comwebmail.annakaytolberk.comwww.annakaytolberk.com
autodiscover.kzt.iml.mybluehost.mecpanel.kzt.iml.mybluehost.mecpcalendars.kzt.iml.mybluehost.mecpcontacts.kzt.iml.mybluehost.mekzt.iml.mybluehost.memail.kzt.iml.mybluehost.memail.monetizingmama.commonetizingmama.comwebdisk.kzt.iml.mybluehost.mewebmail.kzt.iml.mybluehost.mewww.kzt.iml.mybluehost.mewww.monetizingmama.com
aml.ano.mybluehost.meautodiscover.aml.ano.mybluehost.mecpanel.aml.ano.mybluehost.mecpcalendars.aml.ano.mybluehost.mecpcontacts.aml.ano.mybluehost.memail.aml.ano.mybluehost.memail.xavierguri.comwebdisk.aml.ano.mybluehost.mewebmail.aml.ano.mybluehost.mewww.aml.ano.mybluehost.mewww.xavierguri.comxavierguri.com
autodiscover.vgp.tta.mybluehost.mecpanel.vgp.tta.mybluehost.mecpcalendars.vgp.tta.mybluehost.mecpcontacts.vgp.tta.mybluehost.memail.newchildschool.commail.vgp.tta.mybluehost.menewchildschool.comvgp.tta.mybluehost.mewebdisk.vgp.tta.mybluehost.mewebmail.vgp.tta.mybluehost.mewww.newchildschool.comwww.vgp.tta.mybluehost.me
autodiscover.yra.wyz.mybluehost.mecpanel.yra.wyz.mybluehost.mecpcalendars.yra.wyz.mybluehost.mecpcontacts.yra.wyz.mybluehost.memail.yearroundroadcare.commail.yra.wyz.mybluehost.mewebdisk.yra.wyz.mybluehost.mewebmail.yra.wyz.mybluehost.mewww.yearroundroadcare.comwww.yra.wyz.mybluehost.meyearroundroadcare.comyra.wyz.mybluehost.me
aniespizza.comautodiscover.aniespizza.comcpanel.aniespizza.comcpcalendars.aniespizza.comcpcontacts.aniespizza.commail.aniespizza.comwebdisk.aniespizza.comwebmail.aniespizza.comwww.aniespizza.com
autodiscover.duettoeventi.comcpanel.duettoeventi.comcpcalendars.duettoeventi.comcpcontacts.duettoeventi.comduettoeventi.commail.duettoeventi.comwebdisk.duettoeventi.comwebmail.duettoeventi.comwww.duettoeventi.com
autodiscover.onlinesellingsystems.uscpanel.onlinesellingsystems.uscpcalendars.onlinesellingsystems.uscpcontacts.onlinesellingsystems.usmail.onlinesellingsystems.usonlinesellingsystems.uswebdisk.onlinesellingsystems.uswebmail.onlinesellingsystems.uswww.onlinesellingsystems.us
autodiscover.qualicumwellnesspartnersgroup.comautodiscover.yourbrainrules.comcpanel.qualicumwellnesspartnersgroup.comcpanel.yourbrainrules.comcpcalendars.qualicumwellnesspartnersgroup.comcpcalendars.yourbrainrules.comcpcontacts.qualicumwellnesspartnersgroup.comcpcontacts.yourbrainrules.commail.qualicumwellnesspartnersgroup.comqualicumwellnesspartnersgroup.comqualicumwellnesspartnersgroup.yourbrainrules.comwebdisk.qualicumwellnesspartnersgroup.comwebdisk.yourbrainrules.comwebmail.qualicumwellnesspartnersgroup.comwebmail.yourbrainrules.comwww.qualicumwellnesspartnersgroup.comwww.qualicumwellnesspartnersgroup.yourbrainrules.comwww.yourbrainrules.comyourbrainrules.com
autodiscover.whynotgifted.comcpanel.whynotgifted.comcpcalendars.whynotgifted.comcpcontacts.whynotgifted.commail.whynotgifted.comwebdisk.whynotgifted.comwebmail.whynotgifted.comwhynotgifted.comwww.whynotgifted.com
autodiscover.cdc.jvd.mybluehost.mecdc.jvd.mybluehost.mecpanel.cdc.jvd.mybluehost.mecpcalendars.cdc.jvd.mybluehost.mecpcontacts.cdc.jvd.mybluehost.memail.cdc.jvd.mybluehost.mewebdisk.cdc.jvd.mybluehost.mewebmail.cdc.jvd.mybluehost.mewww.cdc.jvd.mybluehost.me
charlesjmorganmdpsychiatry.comwww.charlesjmorganmdpsychiatry.com
cpanel.michaelklotz.comcpcalendars.michaelklotz.comcpcontacts.michaelklotz.commichaelklotz.commichaelklotz.mkadvisory.comwebdisk.michaelklotz.comwebmail.michaelklotz.comwww.michaelklotz.comwww.michaelklotz.mkadvisory.com
autodiscover.tce.qby.mybluehost.mecpanel.tce.qby.mybluehost.mecpcalendars.tce.qby.mybluehost.mecpcontacts.tce.qby.mybluehost.memail.projectevan.commail.tce.qby.mybluehost.meprojectevan.comtce.qby.mybluehost.mewebdisk.tce.qby.mybluehost.mewebmail.tce.qby.mybluehost.mewww.projectevan.comwww.tce.qby.mybluehost.me
autodiscover.qas.wbq.mybluehost.mecpanel.qas.wbq.mybluehost.mecpcalendars.qas.wbq.mybluehost.mecpcontacts.qas.wbq.mybluehost.memail.qas.wbq.mybluehost.memail.tripsactions.onlineqas.wbq.mybluehost.metripsactions.onlinewebdisk.qas.wbq.mybluehost.mewebmail.qas.wbq.mybluehost.mewww.qas.wbq.mybluehost.mewww.tripsactions.online
autodiscover.uponaboard.comcpanel.uponaboard.comcpcalendars.uponaboard.comcpcontacts.uponaboard.commail.uponaboard.comuponaboard.comuponaboard.livinglifeyouthwellness.comwebdisk.uponaboard.comwebmail.uponaboard.comwww.uponaboard.comwww.uponaboard.livinglifeyouthwellness.com
autodiscover.aze.zhc.mybluehost.meaze.zhc.mybluehost.mecpanel.aze.zhc.mybluehost.mecpcalendars.aze.zhc.mybluehost.mecpcontacts.aze.zhc.mybluehost.meeasyrecruitnow.commail.aze.zhc.mybluehost.memail.easyrecruitnow.comwebdisk.aze.zhc.mybluehost.mewebmail.aze.zhc.mybluehost.mewww.aze.zhc.mybluehost.mewww.easyrecruitnow.com
autodiscover.zpv.ops.mybluehost.mecpanel.zpv.ops.mybluehost.mecpcalendars.zpv.ops.mybluehost.mecpcontacts.zpv.ops.mybluehost.mejenniferlbullercpa.commail.jenniferlbullercpa.commail.zpv.ops.mybluehost.mewebdisk.zpv.ops.mybluehost.mewebmail.zpv.ops.mybluehost.mewww.jenniferlbullercpa.comwww.zpv.ops.mybluehost.mezpv.ops.mybluehost.me
autodiscover.wrv.ops.mybluehost.mecpanel.wrv.ops.mybluehost.mecpcalendars.wrv.ops.mybluehost.mecpcontacts.wrv.ops.mybluehost.memagis.jesuits.eumail.magis.jesuits.eumail.wrv.ops.mybluehost.mewebdisk.wrv.ops.mybluehost.mewebmail.wrv.ops.mybluehost.mewrv.ops.mybluehost.mewww.magis.jesuits.euwww.wrv.ops.mybluehost.me
autodiscover.fgt.wgl.mybluehost.mecpanel.fgt.wgl.mybluehost.mecpcalendars.fgt.wgl.mybluehost.mecpcontacts.fgt.wgl.mybluehost.mefgt.wgl.mybluehost.memail.fgt.wgl.mybluehost.mewebdisk.fgt.wgl.mybluehost.mewebmail.fgt.wgl.mybluehost.mewww.fgt.wgl.mybluehost.me
autodiscover.ykj.qdt.mybluehost.mecpanel.ykj.qdt.mybluehost.mecpcalendars.ykj.qdt.mybluehost.mecpcontacts.ykj.qdt.mybluehost.mehavefridayeveryday.commail.havefridayeveryday.commail.ykj.qdt.mybluehost.mewebdisk.ykj.qdt.mybluehost.mewebmail.ykj.qdt.mybluehost.mewww.havefridayeveryday.comwww.ykj.qdt.mybluehost.meykj.qdt.mybluehost.me
autodiscover.ctmracing.comcpanel.ctmracing.comcpcalendars.ctmracing.comcpcontacts.ctmracing.comctmracing.commail.ctmracing.comwebdisk.ctmracing.comwebmail.ctmracing.comwww.ctmracing.com
autodiscover.bluehivecreative.combluehivecreative.combxr.ccw.mybluehost.mecpanel.bluehivecreative.comcpcalendars.bluehivecreative.comcpcontacts.bluehivecreative.commail.bluehivecreative.commail.bxr.ccw.mybluehost.merealestate.bluehivecreative.comtesttest.bluehivecreative.comtraining-ground.bluehivecreative.comwebdisk.bluehivecreative.comwebmail.bluehivecreative.comweddings.bluehivecreative.comwww.bluehivecreative.comwww.bxr.ccw.mybluehost.mewww.realestate.bluehivecreative.comwww.testtest.bluehivecreative.comwww.training-ground.bluehivecreative.comwww.weddings.bluehivecreative.com
autodiscover.showmefreight.comcpanel.showmefreight.comcpcalendars.showmefreight.comcpcontacts.showmefreight.commail.showmefreight.comshowmefreight.comwebdisk.showmefreight.comwebmail.showmefreight.comwww.showmefreight.com
autodiscover.campsongs.comcampsongs.comcpanel.campsongs.comcpcalendars.campsongs.comcpcontacts.campsongs.commail.campsongs.commail.nuthatchleos.comnuthatchleos.comwebdisk.campsongs.comwebmail.campsongs.comwww.campsongs.comwww.nuthatchleos.com
analyticallens.atentforfour.comanalyticallens.comautodiscover.analyticallens.comcpanel.analyticallens.comcpcalendars.analyticallens.comcpcontacts.analyticallens.commail.analyticallens.comwebdisk.analyticallens.comwebmail.analyticallens.comwww.analyticallens.atentforfour.comwww.analyticallens.com
autodiscover.clintfirstbaptist.orgclintfirstbaptist.orgcpanel.clintfirstbaptist.orgcpcalendars.clintfirstbaptist.orgcpcontacts.clintfirstbaptist.orgmail.clintfirstbaptist.orgwebdisk.clintfirstbaptist.orgwebmail.clintfirstbaptist.orgwww.clintfirstbaptist.org
caosville.comwww.caosville.com
autodiscover.mkadvisory.comcpanel.mkadvisory.comcpcalendars.mkadvisory.comcpcontacts.mkadvisory.commkadvisory.comwebdisk.mkadvisory.comwebmail.mkadvisory.comwww.mkadvisory.com
parentsmakinganinvestment.com
autodiscover.beginagain.sitebeginagain.sitecpanel.beginagain.sitecpcalendars.beginagain.sitecpcontacts.beginagain.sitemail.beginagain.sitewebdisk.beginagain.sitewebmail.beginagain.sitewww.beginagain.site
autodiscover.outtaroad.comcpanel.outtaroad.comcpcalendars.outtaroad.comcpcontacts.outtaroad.commail.outtaroad.comouttaroad.comouttaroad.embraceherflow.comwebdisk.outtaroad.comwebmail.outtaroad.comwww.outtaroad.comwww.outtaroad.embraceherflow.com
ashotofpetrone.comashotofpetrone.transcendinghorizonsmarketing.comautodiscover.ashotofpetrone.comcpanel.ashotofpetrone.comcpcalendars.ashotofpetrone.comcpcontacts.ashotofpetrone.commail.ashotofpetrone.comwebdisk.ashotofpetrone.comwebmail.ashotofpetrone.comwww.ashotofpetrone.comwww.ashotofpetrone.transcendinghorizonsmarketing.com
alphabetcorner.comautodiscover.nuo.oez.mybluehost.mecpanel.nuo.oez.mybluehost.mecpcalendars.nuo.oez.mybluehost.mecpcontacts.nuo.oez.mybluehost.memail.alphabetcorner.commail.nuo.oez.mybluehost.menuo.oez.mybluehost.mewebdisk.nuo.oez.mybluehost.mewebmail.nuo.oez.mybluehost.mewww.alphabetcorner.comwww.nuo.oez.mybluehost.me
autodiscover.littrellelectric.comcpanel.littrellelectric.comcpcalendars.littrellelectric.comcpcontacts.littrellelectric.comlittrellelectric.commail.littrellelectric.comwebdisk.littrellelectric.comwebmail.littrellelectric.comwww.littrellelectric.com
alabamadrivethroughtesting.gandtideas.comautodiscover.gandtideas.comautodiscover.lifeisnotatest.comcpanel.gandtideas.comcpanel.lifeisnotatest.comcpcalendars.gandtideas.comcpcalendars.lifeisnotatest.comcpcontacts.gandtideas.comcpcontacts.lifeisnotatest.comgandtideas.comlifeisnotatest.comlifeisnotatest.gandtideas.comllminterview-org.gandtideas.commail.gandtideas.commail.lifeisnotatest.comwebdisk.gandtideas.comwebdisk.lifeisnotatest.comwebmail.gandtideas.comwebmail.lifeisnotatest.comwww.alabamadrivethroughtesting.gandtideas.comwww.gandtideas.comwww.lifeisnotatest.comwww.lifeisnotatest.gandtideas.comwww.llminterview-org.gandtideas.com
autodiscover.drdeblevy.comcpanel.drdeblevy.comcpcalendars.drdeblevy.comcpcontacts.drdeblevy.comdrdeblevy.comdrdeblevy.com.aumail.drdeblevy.commail.drdeblevy.com.auwebdisk.drdeblevy.comwebmail.drdeblevy.comwww.drdeblevy.comwww.drdeblevy.com.au
buloy.nh-bluehost3.comwww.buloy.nh-bluehost3.com
autodiscover.umx.hsk.mybluehost.mechristianfiction101.comcpanel.umx.hsk.mybluehost.mecpcalendars.umx.hsk.mybluehost.mecpcontacts.umx.hsk.mybluehost.memail.christianfiction101.commail.umx.hsk.mybluehost.meumx.hsk.mybluehost.mewebdisk.umx.hsk.mybluehost.mewebmail.umx.hsk.mybluehost.mewww.christianfiction101.comwww.umx.hsk.mybluehost.me
autodiscover.tjw.bjl.mybluehost.mecpanel.tjw.bjl.mybluehost.mecpcalendars.tjw.bjl.mybluehost.mecpcontacts.tjw.bjl.mybluehost.mejnoblespeak.commail.jnoblespeak.commail.tjw.bjl.mybluehost.metjw.bjl.mybluehost.mewebdisk.tjw.bjl.mybluehost.mewebmail.tjw.bjl.mybluehost.mewww.jnoblespeak.comwww.tjw.bjl.mybluehost.me
autodiscover.njj.ano.mybluehost.mecpanel.njj.ano.mybluehost.mecpcalendars.njj.ano.mybluehost.mecpcontacts.njj.ano.mybluehost.memail.njj.ano.mybluehost.menjj.ano.mybluehost.mewebdisk.njj.ano.mybluehost.mewebmail.njj.ano.mybluehost.mewww.njj.ano.mybluehost.me
autodiscover.elevatedbecoming.comcpanel.elevatedbecoming.comcpcalendars.elevatedbecoming.comcpcontacts.elevatedbecoming.comelevatedbecoming.commail.elevatedbecoming.comwebdisk.elevatedbecoming.comwebmail.elevatedbecoming.comwww.elevatedbecoming.com
autodiscover.triginc.orgcpanel.triginc.orgcpcalendars.triginc.orgcpcontacts.triginc.orgtriginc.orgwebdisk.triginc.orgwebmail.triginc.orgwww.triginc.org
autodiscover.qhg.yfm.mybluehost.mecpanel.qhg.yfm.mybluehost.mecpcalendars.qhg.yfm.mybluehost.mecpcontacts.qhg.yfm.mybluehost.memail.mandeepstratigies.commail.qhg.yfm.mybluehost.memandeepstratigies.comqhg.yfm.mybluehost.mewebdisk.qhg.yfm.mybluehost.mewebmail.qhg.yfm.mybluehost.mewww.mandeepstratigies.comwww.qhg.yfm.mybluehost.me
autodiscover.gematriasports.comcpanel.gematriasports.comcpcalendars.gematriasports.comcpcontacts.gematriasports.comgematriasports.commail.gematriasports.commail.sportsgematria.comsportsgematria.comwebdisk.gematriasports.comwebmail.gematriasports.comwww.gematriasports.comwww.sportsgematria.com
autodiscover.eccecalla.comautodiscover.prodermalwellness.comcpanel.eccecalla.comcpanel.prodermalwellness.comcpcalendars.eccecalla.comcpcalendars.prodermalwellness.comcpcontacts.eccecalla.comcpcontacts.prodermalwellness.comeccecalla.comeccecalla.spircen.commail.eccecalla.commail.prodermalwellness.comprodermalwellness.comprodermalwellness.spircen.comwebdisk.eccecalla.comwebdisk.prodermalwellness.comwebmail.eccecalla.comwebmail.prodermalwellness.comwww.eccecalla.comwww.eccecalla.spircen.comwww.prodermalwellness.comwww.prodermalwellness.spircen.com
autodiscover.matjararabi.netcpanel.matjararabi.netcpcalendars.matjararabi.netcpcontacts.matjararabi.netmail.matjararabi.netmatjararabi.netwebdisk.matjararabi.netwebmail.matjararabi.netwebsite-8d7ad8db.qqk.jwp.mybluehost.mewww.matjararabi.netwww.website-8d7ad8db.qqk.jwp.mybluehost.me
autodiscover.nps.bow.mybluehost.mecpanel.nps.bow.mybluehost.mecpcalendars.nps.bow.mybluehost.mecpcontacts.nps.bow.mybluehost.memail.nps.bow.mybluehost.memail.siliangz.comnps.bow.mybluehost.mesiliangz.comwebdisk.nps.bow.mybluehost.mewebmail.nps.bow.mybluehost.mewww.nps.bow.mybluehost.mewww.siliangz.com
autodiscover.sxj.mhd.mybluehost.mecpanel.sxj.mhd.mybluehost.mecpcalendars.sxj.mhd.mybluehost.mecpcontacts.sxj.mhd.mybluehost.memail.sxj.mhd.mybluehost.mesxj.mhd.mybluehost.mewebdisk.sxj.mhd.mybluehost.mewebmail.sxj.mhd.mybluehost.mewww.sxj.mhd.mybluehost.me
autodiscover.tnc.swq.mybluehost.mecpanel.tnc.swq.mybluehost.mecpcalendars.tnc.swq.mybluehost.mecpcontacts.tnc.swq.mybluehost.memail.rodnreelfishing.commail.tnc.swq.mybluehost.merodnreelfishing.comtnc.swq.mybluehost.mewebdisk.tnc.swq.mybluehost.mewebmail.tnc.swq.mybluehost.mewww.rodnreelfishing.comwww.tnc.swq.mybluehost.me
cpanel.irevealhealth.comcpcalendars.irevealhealth.comirevealhealth.comwww.irevealhealth.com
autodiscover.kristenknepper.comcpanel.kristenknepper.comcpcalendars.kristenknepper.comcpcontacts.kristenknepper.comkristenknepper.commail.kristenknepper.commail.worklikeagirl.cowebdisk.kristenknepper.comwebmail.kristenknepper.comworklikeagirl.cowww.kristenknepper.comwww.worklikeagirl.co
autodiscover.ykl.thm.mybluehost.mecpanel.ykl.thm.mybluehost.mecpcalendars.ykl.thm.mybluehost.mecpcontacts.ykl.thm.mybluehost.melwolfeauthor.commail.lwolfeauthor.commail.ykl.thm.mybluehost.mewebdisk.ykl.thm.mybluehost.mewebmail.ykl.thm.mybluehost.mewww.lwolfeauthor.comwww.ykl.thm.mybluehost.meykl.thm.mybluehost.me
autodiscover.uaj.tdd.mybluehost.mecpanel.uaj.tdd.mybluehost.mecpcalendars.uaj.tdd.mybluehost.mecpcontacts.uaj.tdd.mybluehost.memail.uaj.tdd.mybluehost.meuaj.tdd.mybluehost.mewebdisk.uaj.tdd.mybluehost.mewebmail.uaj.tdd.mybluehost.mewww.uaj.tdd.mybluehost.me
autodiscover.szf.rxg.mybluehost.mecpanel.szf.rxg.mybluehost.mecpcalendars.szf.rxg.mybluehost.mecpcontacts.szf.rxg.mybluehost.memail.nana22.commail.szf.rxg.mybluehost.menana22.comszf.rxg.mybluehost.mewebdisk.szf.rxg.mybluehost.mewebmail.szf.rxg.mybluehost.mewww.nana22.comwww.szf.rxg.mybluehost.me
autodiscover.hvx.xjs.mybluehost.meautodiscover.shrineandrepublic.comcpanel.hvx.xjs.mybluehost.mecpanel.shrineandrepublic.comcpcalendars.hvx.xjs.mybluehost.mecpcalendars.shrineandrepublic.comcpcontacts.hvx.xjs.mybluehost.mecpcontacts.shrineandrepublic.comhvx.xjs.mybluehost.memail.hvx.xjs.mybluehost.memail.shrineandrepublic.comshrineandrepublic.comshrineandrepublic.hvx.xjs.mybluehost.mewebdisk.hvx.xjs.mybluehost.mewebdisk.shrineandrepublic.comwebmail.hvx.xjs.mybluehost.mewebmail.shrineandrepublic.comwww.hvx.xjs.mybluehost.mewww.shrineandrepublic.comwww.shrineandrepublic.hvx.xjs.mybluehost.me
autodiscover.nnh.zbc.mybluehost.mecpanel.nnh.zbc.mybluehost.mecpcalendars.nnh.zbc.mybluehost.mecpcontacts.nnh.zbc.mybluehost.melegaceeproductions.commail.legaceeproductions.commail.nnh.zbc.mybluehost.mennh.zbc.mybluehost.mewebdisk.nnh.zbc.mybluehost.mewebmail.nnh.zbc.mybluehost.mewww.legaceeproductions.comwww.nnh.zbc.mybluehost.me
cpanel.imperepoxy.comcpcalendars.imperepoxy.comimperepoxy.commail.imperepoxy.comwebmail.imperepoxy.comwww.imperepoxy.com
autodiscover.gbb.tdd.mybluehost.mecentradex.cocpanel.gbb.tdd.mybluehost.mecpcalendars.gbb.tdd.mybluehost.mecpcontacts.gbb.tdd.mybluehost.megbb.tdd.mybluehost.memail.gbb.tdd.mybluehost.mewebdisk.gbb.tdd.mybluehost.mewebmail.gbb.tdd.mybluehost.mewww.centradex.cowww.gbb.tdd.mybluehost.me
autodiscover.tmh.qdt.mybluehost.mecpanel.tmh.qdt.mybluehost.mecpcalendars.tmh.qdt.mybluehost.mecpcontacts.tmh.qdt.mybluehost.memail.tmh.qdt.mybluehost.metmh.qdt.mybluehost.mewebdisk.tmh.qdt.mybluehost.mewebmail.tmh.qdt.mybluehost.mewww.tmh.qdt.mybluehost.me
autodiscover.journalofpornography.comcpanel.journalofpornography.comcpcalendars.journalofpornography.comcpcontacts.journalofpornography.comjournalofpornography.commail.journalofpornography.comwebdisk.journalofpornography.comwebmail.journalofpornography.comwebsite-3d20b3bc.dwicefox.comwww.journalofpornography.comwww.website-3d20b3bc.dwicefox.com
autodiscover.schindlerscrapandsalvage.comcpanel.schindlerscrapandsalvage.comcpcalendars.schindlerscrapandsalvage.comcpcontacts.schindlerscrapandsalvage.commail.schindlerscrapandsalvage.comrecycling.schindlerengineering.comschindlerscrapandsalvage.comschindlerscrapandsalvage.schindlerengineering.comwebdisk.schindlerscrapandsalvage.comwebmail.schindlerscrapandsalvage.comwww.recycling.schindlerengineering.comwww.schindlerscrapandsalvage.comwww.schindlerscrapandsalvage.schindlerengineering.com
autodiscover.ste.tdd.mybluehost.mecpanel.ste.tdd.mybluehost.mecpcalendars.ste.tdd.mybluehost.mecpcontacts.ste.tdd.mybluehost.memail.pedgeaccounting.commail.ste.tdd.mybluehost.mepedgeaccounting.comste.tdd.mybluehost.mewebdisk.ste.tdd.mybluehost.mewebmail.ste.tdd.mybluehost.mewww.pedgeaccounting.comwww.ste.tdd.mybluehost.me
allboybootytrain.comcpanel.allboybootytrain.comcpcalendars.allboybootytrain.comwww.allboybootytrain.com
autodiscover.erd1music.comcpanel.erd1music.comcpcalendars.erd1music.comcpcontacts.erd1music.comerd1music.commail.erd1music.comwebdisk.erd1music.comwebmail.erd1music.comwww.erd1music.com
autodiscover.rtv.cup.mybluehost.mecpanel.rtv.cup.mybluehost.mecpcalendars.rtv.cup.mybluehost.mecpcontacts.rtv.cup.mybluehost.memail.rtv.cup.mybluehost.memail.zenithsolutionsnm.comrtv.cup.mybluehost.mewebdisk.rtv.cup.mybluehost.mewebmail.rtv.cup.mybluehost.mewww.rtv.cup.mybluehost.mewww.zenithsolutionsnm.comzenithsolutionsnm.com
autodiscover.decghana.orgautodiscover.stunncust.comcpanel.decghana.orgcpanel.stunncust.comcpcalendars.decghana.orgcpcalendars.stunncust.comcpcontacts.decghana.orgcpcontacts.stunncust.comdecghana-org.stunncust.comdecghana.orgmail.decghana.orgmail.stunncust.compvdgh-org.stunncust.comstunncust.comtry12-digital.stunncust.comwebdisk.decghana.orgwebdisk.stunncust.comwebmail.decghana.orgwebmail.stunncust.comwww.decghana-org.stunncust.comwww.decghana.orgwww.pvdgh-org.stunncust.comwww.stunncust.comwww.try12-digital.stunncust.com
autodiscover.tmx.bpj.mybluehost.mecpanel.tmx.bpj.mybluehost.mecpcalendars.tmx.bpj.mybluehost.mecpcontacts.tmx.bpj.mybluehost.memail.tmx.bpj.mybluehost.metmx.bpj.mybluehost.mewebdisk.tmx.bpj.mybluehost.mewebmail.tmx.bpj.mybluehost.mewww.tmx.bpj.mybluehost.me
autodiscover.opulent.goldcpanel.opulent.goldcpcalendars.opulent.goldcpcontacts.opulent.goldmail.opulent.goldopulent.goldwebdisk.opulent.goldwebmail.opulent.goldwebsite-e179aedd.thematchmakingteam.comwww.opulent.goldwww.website-e179aedd.thematchmakingteam.com
autodiscover.thesaltypaddle.comcpanel.thesaltypaddle.comcpcalendars.thesaltypaddle.comcpcontacts.thesaltypaddle.commail.thesaltypaddle.comthesaltypaddle.comwebdisk.thesaltypaddle.comwebmail.thesaltypaddle.comwww.thesaltypaddle.com
autodiscover.jak.ano.mybluehost.mecpanel.jak.ano.mybluehost.mecpcalendars.jak.ano.mybluehost.mecpcontacts.jak.ano.mybluehost.mefuneka-shop.comjak.ano.mybluehost.memail.funeka-shop.commail.jak.ano.mybluehost.mewebdisk.jak.ano.mybluehost.mewebmail.jak.ano.mybluehost.mewww.funeka-shop.comwww.jak.ano.mybluehost.me
autodiscover.kcr.pju.mybluehost.mecpanel.kcr.pju.mybluehost.mecpcalendars.kcr.pju.mybluehost.mecpcontacts.kcr.pju.mybluehost.mejacksoneducationservices.comkcr.pju.mybluehost.memail.jacksoneducationservices.commail.kcr.pju.mybluehost.mewebdisk.kcr.pju.mybluehost.mewebmail.kcr.pju.mybluehost.mewww.jacksoneducationservices.comwww.kcr.pju.mybluehost.me
autodiscover.gdd.cjs.mybluehost.mecpanel.gdd.cjs.mybluehost.mecpcalendars.gdd.cjs.mybluehost.mecpcontacts.gdd.cjs.mybluehost.megdd.cjs.mybluehost.memail.gdd.cjs.mybluehost.memail.plantbookusa.complantbookusa.comwebdisk.gdd.cjs.mybluehost.mewebmail.gdd.cjs.mybluehost.mewww.gdd.cjs.mybluehost.mewww.plantbookusa.com
cpanel.eaviationnews.comcpcalendars.eaviationnews.comcpcontacts.eaviationnews.comeaviationnews.commail.eaviationnews.comwebdisk.eaviationnews.comwebmail.eaviationnews.comwww.eaviationnews.com
dronesivue.ivuerobotics.comwww.dronesivue.ivuerobotics.com
autodiscover.michmondo.comcpanel.michmondo.comcpcalendars.michmondo.comcpcontacts.michmondo.commail.michmondo.commichmondo.comwebdisk.michmondo.comwebmail.michmondo.comwww.michmondo.com
autodiscover.xvm.cup.mybluehost.mecpanel.xvm.cup.mybluehost.mecpcalendars.xvm.cup.mybluehost.mecpcontacts.xvm.cup.mybluehost.memail.thegtmnetwork.commail.xvm.cup.mybluehost.methegtmnetwork.comwebdisk.xvm.cup.mybluehost.mewebmail.xvm.cup.mybluehost.mewww.xvm.cup.mybluehost.mexvm.cup.mybluehost.me
aayaproductionsny.comautodiscover.aayaproductionsny.comcpanel.aayaproductionsny.comcpcalendars.aayaproductionsny.comcpcontacts.aayaproductionsny.commail.aayaproductionsny.comwebdisk.aayaproductionsny.comwebmail.aayaproductionsny.comwww.aayaproductionsny.com
autodiscover.keywomeninchrist.comcpanel.keywomeninchrist.comcpcalendars.keywomeninchrist.comcpcontacts.keywomeninchrist.comkeywomeninchrist.commail.keywomeninchrist.comwebdisk.keywomeninchrist.comwebmail.keywomeninchrist.comwww.keywomeninchrist.com
autodiscover.instincxbyanayanicole.comcpanel.instincxbyanayanicole.comcpcalendars.instincxbyanayanicole.comcpcontacts.instincxbyanayanicole.cominstincxbyanayanicole.commail.instincxbyanayanicole.comwebdisk.instincxbyanayanicole.comwebmail.instincxbyanayanicole.comwww.instincxbyanayanicole.com
autodiscover.redheadlivesmatter.comcpanel.redheadlivesmatter.comcpcalendars.redheadlivesmatter.comcpcontacts.redheadlivesmatter.commail.redheadlivesmatter.comredheadlivesmatter.comwebdisk.redheadlivesmatter.comwebmail.redheadlivesmatter.comwww.redheadlivesmatter.com
autodiscover.recon-logic.comcpanel.recon-logic.comcpcalendars.recon-logic.comcpcontacts.recon-logic.commail.recon-logic.comrecon-logic.comwebdisk.recon-logic.comwebmail.recon-logic.comwww.recon-logic.com
autodiscover.jhairstudio.cacpanel.jhairstudio.cacpcalendars.jhairstudio.cacpcontacts.jhairstudio.cajhairstudio.camail.jhairstudio.camemoriesproject.laelgia.comwebdisk.jhairstudio.cawebmail.jhairstudio.cawebsite-ffd99dc8.laelgia.comwww.jhairstudio.cawww.memoriesproject.laelgia.comwww.website-ffd99dc8.laelgia.com
eliterazor.comwww.eliterazor.com
autodiscover.uyw.fmr.mybluehost.mecpanel.uyw.fmr.mybluehost.mecpcalendars.uyw.fmr.mybluehost.mecpcontacts.uyw.fmr.mybluehost.medavidwong.com.hkmail.davidwong.com.hkmail.uyw.fmr.mybluehost.meuyw.fmr.mybluehost.mewebdisk.uyw.fmr.mybluehost.mewebmail.uyw.fmr.mybluehost.mewww.davidwong.com.hkwww.uyw.fmr.mybluehost.me
autodiscover.lyubastudio.co.ukcpanel.lyubastudio.co.ukcpcalendars.lyubastudio.co.ukcpcontacts.lyubastudio.co.uklyubastudio.co.ukmail.lyubastudio.co.ukwebdisk.lyubastudio.co.ukwebmail.lyubastudio.co.ukwww.lyubastudio.co.uk
alexketo.comcpanel.alexketo.comcpcalendars.alexketo.comcpcontacts.alexketo.comfvvs.alexketo.comjyjjty.alexketo.comrfds.alexketo.comwebdisk.alexketo.comwebmail.alexketo.comwww.alexketo.comwww.fvvs.alexketo.comwww.jyjjty.alexketo.comwww.rfds.alexketo.com
autodiscover.thepositiveself.netautodiscover.thewayofthekingdom.comcpanel.thepositiveself.netcpanel.thewayofthekingdom.comcpcalendars.thepositiveself.netcpcalendars.thewayofthekingdom.comcpcontacts.thepositiveself.netcpcontacts.thewayofthekingdom.commail.thepositiveself.netmail.thewayofthekingdom.comthepositiveself-net.pmg.dbr.mybluehost.methepositiveself.netthewayofthekingdom.comthewayofthekingdom.pmg.dbr.mybluehost.mewebdisk.thepositiveself.netwebdisk.thewayofthekingdom.comwebmail.thepositiveself.netwebmail.thewayofthekingdom.comwww.thepositiveself-net.pmg.dbr.mybluehost.mewww.thepositiveself.netwww.thewayofthekingdom.comwww.thewayofthekingdom.pmg.dbr.mybluehost.me
autodiscover.padelcommunity.clubautodiscover.vernastudio.comcpanel.padelcommunity.clubcpanel.vernastudio.comcpcalendars.padelcommunity.clubcpcalendars.vernastudio.comcpcontacts.padelcommunity.clubcpcontacts.vernastudio.commail.padelcommunity.clubmail.vernastudio.compadelcommunity.clubvernastudio.comwebdisk.padelcommunity.clubwebdisk.vernastudio.comwebmail.padelcommunity.clubwebmail.vernastudio.comwebsite-19a5aebc.bravaconsultancy.comwebsite-26132de6.bravaconsultancy.comwww.padelcommunity.clubwww.vernastudio.comwww.website-19a5aebc.bravaconsultancy.comwww.website-26132de6.bravaconsultancy.com
autodiscover.mti.nxb.mybluehost.mecpanel.mti.nxb.mybluehost.mecpcalendars.mti.nxb.mybluehost.mecpcontacts.mti.nxb.mybluehost.memail.mti.nxb.mybluehost.memail.nurturemylist51.commti.nxb.mybluehost.menurturemylist51.comwebdisk.mti.nxb.mybluehost.mewebmail.mti.nxb.mybluehost.mewebsite-5d7abf39.mti.nxb.mybluehost.mewww.mti.nxb.mybluehost.mewww.nurturemylist51.comwww.website-5d7abf39.mti.nxb.mybluehost.me
autodiscover.becan.cabecan-ca.multicultural.com.brbecan.cacpanel.becan.cacpcalendars.becan.cacpcontacts.becan.cacross-cultural-expat.multicultural.com.brlearninghub.becan.camail.becan.cawebdisk.becan.cawebmail.becan.cawww.becan-ca.multicultural.com.brwww.becan.cawww.cross-cultural-expat.multicultural.com.brwww.learninghub.becan.ca
avtgl.comcpanel.avtgl.comcpcalendars.avtgl.comcpcontacts.avtgl.commail.avtgl.comwebdisk.avtgl.comwebmail.avtgl.comwww.avtgl.com
autodiscover.blurblab.comautodiscover.remotejoblist.comblurblab.comblurblab.travelglobenow.comcpanel.blurblab.comcpanel.remotejoblist.comcpcalendars.blurblab.comcpcalendars.remotejoblist.comcpcontacts.blurblab.comcpcontacts.remotejoblist.commail.blurblab.commail.remotejoblist.comremotejoblist.comremotejoblist.travelglobenow.comwebdisk.blurblab.comwebdisk.remotejoblist.comwebmail.blurblab.comwebmail.remotejoblist.comwww.blurblab.comwww.blurblab.travelglobenow.comwww.remotejoblist.comwww.remotejoblist.travelglobenow.com
anthonycinque.comautodiscover.anthonycinque.comcpanel.anthonycinque.comcpcalendars.anthonycinque.comcpcontacts.anthonycinque.comholiday.anthonycinque.commail.anthonycinque.comwebdisk.anthonycinque.comwebmail.anthonycinque.comwww.anthonycinque.comwww.holiday.anthonycinque.com
autodiscover.pqf.yfm.mybluehost.mecpanel.pqf.yfm.mybluehost.mecpcalendars.pqf.yfm.mybluehost.mecpcontacts.pqf.yfm.mybluehost.memail.melissashotelldmd.commail.pqf.yfm.mybluehost.memelissashotelldmd.compqf.yfm.mybluehost.mewebdisk.pqf.yfm.mybluehost.mewebmail.pqf.yfm.mybluehost.mewww.melissashotelldmd.comwww.pqf.yfm.mybluehost.me
autodiscover.dgf.cyt.mybluehost.mecpanel.dgf.cyt.mybluehost.mecpcalendars.dgf.cyt.mybluehost.mecpcontacts.dgf.cyt.mybluehost.medgf.cyt.mybluehost.memail.dgf.cyt.mybluehost.memail.theageofwisdom.comtheageofwisdom.comwebdisk.dgf.cyt.mybluehost.mewebmail.dgf.cyt.mybluehost.mewww.dgf.cyt.mybluehost.mewww.theageofwisdom.com
autodiscover.zyc.yhb.mybluehost.meclevervagabond.comcpanel.zyc.yhb.mybluehost.mecpcalendars.zyc.yhb.mybluehost.mecpcontacts.zyc.yhb.mybluehost.memail.clevervagabond.commail.zyc.yhb.mybluehost.mewebdisk.zyc.yhb.mybluehost.mewebmail.zyc.yhb.mybluehost.mewww.clevervagabond.comwww.zyc.yhb.mybluehost.mezyc.yhb.mybluehost.me
autodiscover.barbarahroos.combarbarahroos.comcpanel.barbarahroos.comcpcalendars.barbarahroos.comcpcontacts.barbarahroos.commail.barbarahroos.comwebdisk.barbarahroos.comwebmail.barbarahroos.comwww.barbarahroos.com
website-b387fdd0.simplyfinn.comwww.website-b387fdd0.simplyfinn.com
autodiscover.bravaconsultancy.comautodiscover.thehearty.combravaconsultancy.comcpanel.bravaconsultancy.comcpanel.thehearty.comcpcalendars.bravaconsultancy.comcpcalendars.thehearty.comcpcontacts.bravaconsultancy.comcpcontacts.thehearty.commail.bravaconsultancy.commail.thehearty.commail.zev.mvv.mybluehost.methehearty.comwebdisk.bravaconsultancy.comwebdisk.thehearty.comwebmail.bravaconsultancy.comwebmail.thehearty.comwebsite-11b63d0d.bravaconsultancy.comwww.bravaconsultancy.comwww.thehearty.comwww.website-11b63d0d.bravaconsultancy.comwww.zev.mvv.mybluehost.mezev.mvv.mybluehost.me
3d-it.netautodiscover.thv.qjk.mybluehost.mecpanel.thv.qjk.mybluehost.mecpcalendars.thv.qjk.mybluehost.mecpcontacts.thv.qjk.mybluehost.memail.3d-it.netmail.thv.qjk.mybluehost.methv.qjk.mybluehost.mewebdisk.thv.qjk.mybluehost.mewebmail.thv.qjk.mybluehost.mewww.3d-it.netwww.thv.qjk.mybluehost.me
autodiscover.edermaskinshop.comcpanel.edermaskinshop.comcpcalendars.edermaskinshop.comcpcontacts.edermaskinshop.comedermaskinshop.comedermaskinshop.hfy.ovo.mybluehost.memail.edermaskinshop.comwebdisk.edermaskinshop.comwebmail.edermaskinshop.comwww.edermaskinshop.comwww.edermaskinshop.hfy.ovo.mybluehost.me
autodiscover.entrustedwithgrace.comcpanel.entrustedwithgrace.comcpcalendars.entrustedwithgrace.comcpcontacts.entrustedwithgrace.comentrustedwithgrace.commail.entrustedwithgrace.comwebdisk.entrustedwithgrace.comwebmail.entrustedwithgrace.comwww.entrustedwithgrace.com
autodiscover.xum.ryb.mybluehost.mecpanel.xum.ryb.mybluehost.mecpcalendars.xum.ryb.mybluehost.mecpcontacts.xum.ryb.mybluehost.memail.ricamontespr.commail.xum.ryb.mybluehost.mericamontespr.comwebdisk.xum.ryb.mybluehost.mewebmail.xum.ryb.mybluehost.mewww.ricamontespr.comwww.xum.ryb.mybluehost.mexum.ryb.mybluehost.me
autodiscover.dai.pgs.mybluehost.mecpanel.dai.pgs.mybluehost.mecpcalendars.dai.pgs.mybluehost.mecpcontacts.dai.pgs.mybluehost.medai.pgs.mybluehost.meleadershiprestoration.commail.dai.pgs.mybluehost.memail.leadershiprestoration.comwebdisk.dai.pgs.mybluehost.mewebmail.dai.pgs.mybluehost.mewww.dai.pgs.mybluehost.mewww.leadershiprestoration.com
autodiscover.sethrwilson.comcpanel.sethrwilson.comcpcalendars.sethrwilson.comcpcontacts.sethrwilson.comdadhackshow.sethrwilson.commail.sethrwilson.comsethrwilson.comwebdisk.sethrwilson.comwebmail.sethrwilson.comwww.sethrwilson.com
autodiscover.lwi.zhr.mybluehost.meautodiscover.theboozereviews.comcpanel.lwi.zhr.mybluehost.mecpanel.theboozereviews.comcpcalendars.lwi.zhr.mybluehost.mecpcalendars.theboozereviews.comcpcontacts.lwi.zhr.mybluehost.mecpcontacts.theboozereviews.comlwi.zhr.mybluehost.melwizhrmybluehostme.transcendinghorizonsmarketing.commail.lwi.zhr.mybluehost.memail.theboozereviews.comtheboozereviews.comtheboozereviews.transcendinghorizonsmarketing.comwebdisk.lwi.zhr.mybluehost.mewebdisk.theboozereviews.comwebmail.lwi.zhr.mybluehost.mewebmail.theboozereviews.comwww.lwi.zhr.mybluehost.mewww.lwizhrmybluehostme.transcendinghorizonsmarketing.comwww.theboozereviews.comwww.theboozereviews.transcendinghorizonsmarketing.com
autodiscover.uir.ouf.mybluehost.mecpanel.uir.ouf.mybluehost.mecpcalendars.uir.ouf.mybluehost.mecpcontacts.uir.ouf.mybluehost.mejojoinfotech.commail.jojoinfotech.commail.uir.ouf.mybluehost.meuir.ouf.mybluehost.mewebdisk.uir.ouf.mybluehost.mewebmail.uir.ouf.mybluehost.mewww.jojoinfotech.comwww.uir.ouf.mybluehost.me
autodiscover.etronixtt.comcpanel.etronixtt.comcpcalendars.etronixtt.comcpcontacts.etronixtt.cometronixtt.commail.etronixtt.comwebdisk.etronixtt.comwebmail.etronixtt.comwww.etronixtt.com
autodiscover.lnj.wgl.mybluehost.mecpanel.lnj.wgl.mybluehost.mecpcalendars.lnj.wgl.mybluehost.mecpcontacts.lnj.wgl.mybluehost.melnj.wgl.mybluehost.memail.lnj.wgl.mybluehost.mewebdisk.lnj.wgl.mybluehost.mewebmail.lnj.wgl.mybluehost.mewww.lnj.wgl.mybluehost.me
cpanel.therevolutionky.orgcpcalendars.therevolutionky.orgtherevolutionky.orgwww.therevolutionky.org
autodiscover.teacherdouble.comcpanel.teacherdouble.comcpcalendars.teacherdouble.comcpcontacts.teacherdouble.commail.teacherdouble.comteacherdouble.comwebdisk.teacherdouble.comwebmail.teacherdouble.comwww.teacherdouble.com
arcanawatch.usxw666.comautodiscover.arcanawatch.comcpcalendars.arcanawatch.comcpcontacts.arcanawatch.commail.arcanawatch.comwebdisk.arcanawatch.comwww.arcanawatch.usxw666.com
autodiscover.czp.isd.mybluehost.mecpanel.czp.isd.mybluehost.mecpcalendars.czp.isd.mybluehost.mecpcontacts.czp.isd.mybluehost.meczp.isd.mybluehost.memail.czp.isd.mybluehost.mewebdisk.czp.isd.mybluehost.mewebmail.czp.isd.mybluehost.mewww.czp.isd.mybluehost.me
autodiscover.whitneyforeastpenn.comcpanel.whitneyforeastpenn.comcpcalendars.whitneyforeastpenn.comcpcontacts.whitneyforeastpenn.commail.whitneyforeastpenn.comwebdisk.whitneyforeastpenn.comwebmail.whitneyforeastpenn.comwhitneyforeastpenn.comwww.whitneyforeastpenn.com
autodiscover.travelglobenow.comcoinflow.travelglobenow.comcpanel.travelglobenow.comcpcalendars.travelglobenow.comcpcontacts.travelglobenow.commail.travelglobenow.comwebdisk.travelglobenow.comwebmail.travelglobenow.comwww.coinflow.travelglobenow.com
autodiscover.ngiscvsa.comcpanel.ngiscvsa.comcpcalendars.ngiscvsa.comcpcontacts.ngiscvsa.commail.ngiscvsa.comngiscvsa.comwebdisk.ngiscvsa.comwebmail.ngiscvsa.comwww.ngiscvsa.com
autodiscover.xdh.gsv.mybluehost.mecpanel.xdh.gsv.mybluehost.mecpcalendars.xdh.gsv.mybluehost.mecpcontacts.xdh.gsv.mybluehost.memail.xdh.gsv.mybluehost.mepartnersteletherapy.comwebdisk.xdh.gsv.mybluehost.mewebmail.xdh.gsv.mybluehost.mewww.partnersteletherapy.comwww.xdh.gsv.mybluehost.mexdh.gsv.mybluehost.me
cpanel.weightsandredemption.comcpcalendars.weightsandredemption.comcpcontacts.weightsandredemption.commail.weightsandredemption.comwebdisk.weightsandredemption.comwebmail.weightsandredemption.comweightsandredemption.comwww.weightsandredemption.com
autodiscover.blessingretailgroup.comblessingretailgroup.comblessingretailgroup.michaelblessing.cocpanel.blessingretailgroup.comcpcalendars.blessingretailgroup.comcpcontacts.blessingretailgroup.commail.blessingretailgroup.comwebdisk.blessingretailgroup.comwebmail.blessingretailgroup.comwww.blessingretailgroup.comwww.blessingretailgroup.michaelblessing.co
autodiscover.williamthepainter.comcpanel.williamthepainter.comcpcalendars.williamthepainter.comcpcontacts.williamthepainter.commail.williamthepainter.comwebdisk.williamthepainter.comwebmail.williamthepainter.comwebsite-7acc3c5b.geg.yfm.mybluehost.mewilliamthepainter.comwww.website-7acc3c5b.geg.yfm.mybluehost.mewww.williamthepainter.com
autodiscover.genzintherealworld.comcpanel.genzintherealworld.comcpcalendars.genzintherealworld.comcpcontacts.genzintherealworld.comgenzintherealworld.commail.genzintherealworld.comwebdisk.genzintherealworld.comwebmail.genzintherealworld.comwww.genzintherealworld.com
autodiscover.straightasasafetypin.comcpanel.straightasasafetypin.comcpcalendars.straightasasafetypin.comcpcontacts.straightasasafetypin.commail.straightasasafetypin.comstraightasasafetypin.comwebdisk.straightasasafetypin.comwebmail.straightasasafetypin.comwww.straightasasafetypin.com
autodiscover.pearlory.comcpcalendars.pearlory.comcpcontacts.pearlory.commail.pearlory.comwebdisk.pearlory.com
autodiscover.lunacatena.comcpanel.lunacatena.comcpcalendars.lunacatena.comcpcontacts.lunacatena.comlunacatena.commail.lunacatena.comwebdisk.lunacatena.comwebmail.lunacatena.comwww.lunacatena.com
autodiscover.kaitlinhenre.comcpanel.kaitlinhenre.comcpcalendars.kaitlinhenre.comcpcontacts.kaitlinhenre.comdefinitelynotadeveloper-tech.kaitlinhenre.comkaitlinhenre.commail.kaitlinhenre.comwebdisk.kaitlinhenre.comwebmail.kaitlinhenre.comwww.definitelynotadeveloper-tech.kaitlinhenre.comwww.kaitlinhenre.com
autodiscover.ypd.ajs.mybluehost.mecpanel.ypd.ajs.mybluehost.mecpcalendars.ypd.ajs.mybluehost.mecpcontacts.ypd.ajs.mybluehost.memail.ypd.ajs.mybluehost.mewebdisk.ypd.ajs.mybluehost.mewebmail.ypd.ajs.mybluehost.mewww.ypd.ajs.mybluehost.meypd.ajs.mybluehost.me
autodiscover.npw.qps.mybluehost.mecpanel.npw.qps.mybluehost.mecpcalendars.npw.qps.mybluehost.mecpcontacts.npw.qps.mybluehost.memail.npw.qps.mybluehost.menpw.qps.mybluehost.mewebdisk.npw.qps.mybluehost.mewebmail.npw.qps.mybluehost.mewww.mail.npw.qps.mybluehost.mewww.npw.qps.mybluehost.me
autodiscover.flowgrounds.orgcpanel.flowgrounds.orgcpcalendars.flowgrounds.orgcpcontacts.flowgrounds.orgflowgrounds.orgmail.flowgrounds.orgwebdisk.flowgrounds.orgwebmail.flowgrounds.orgwebsite-b64bd23a.yqr.bzx.mybluehost.mewww.flowgrounds.orgwww.website-b64bd23a.yqr.bzx.mybluehost.me
autodiscover.shellyannweeks.comcpanel.shellyannweeks.comcpcalendars.shellyannweeks.comcpcontacts.shellyannweeks.commail.shellyannweeks.comshellyannweeks.comshellyannweeks.embraceherflow.comwebdisk.shellyannweeks.comwebmail.shellyannweeks.comwww.shellyannweeks.comwww.shellyannweeks.embraceherflow.com
autodiscover.hollowayandyoung.comcpanel.hollowayandyoung.comcpcalendars.hollowayandyoung.comcpcontacts.hollowayandyoung.comhollowayandyoung.commail.hollowayandyoung.comwebdisk.hollowayandyoung.comwebmail.hollowayandyoung.comwww.hollowayandyoung.com
autodiscover.buildingfluency.combuildingfluency.comcpanel.buildingfluency.comcpcalendars.buildingfluency.comcpcontacts.buildingfluency.commail.buildingfluency.comwebdisk.buildingfluency.comwebmail.buildingfluency.comwww.buildingfluency.com
floridatackleclub.xls.fls.mybluehost.mewww.floridatackleclub.xls.fls.mybluehost.me
autodiscover.wsg.fwo.mybluehost.mecpanel.wsg.fwo.mybluehost.mecpcalendars.wsg.fwo.mybluehost.mecpcontacts.wsg.fwo.mybluehost.memail.marshavogel.commail.wsg.fwo.mybluehost.memarshavogel.comwebdisk.wsg.fwo.mybluehost.mewebmail.wsg.fwo.mybluehost.mewsg.fwo.mybluehost.mewww.marshavogel.comwww.wsg.fwo.mybluehost.me
autodiscover.nvd.zhc.mybluehost.mecpanel.nvd.zhc.mybluehost.mecpcalendars.nvd.zhc.mybluehost.mecpcontacts.nvd.zhc.mybluehost.memail.nvd.zhc.mybluehost.menvd.zhc.mybluehost.mewebdisk.nvd.zhc.mybluehost.mewebmail.nvd.zhc.mybluehost.mewww.nvd.zhc.mybluehost.me
autodiscover.sewingstudioshrewsbury.co.ukcpanel.sewingstudioshrewsbury.co.ukcpcalendars.sewingstudioshrewsbury.co.ukcpcontacts.sewingstudioshrewsbury.co.ukmail.sewingstudioshrewsbury.co.uksewingstudioshrewsbury.co.ukwebdisk.sewingstudioshrewsbury.co.ukwebmail.sewingstudioshrewsbury.co.ukwww.sewingstudioshrewsbury.co.uk
Domain summary
mail.szf.rxg.mybluehost.me 8 nana22.com 6 www.dreamcatcherflyfishing.com 6 mail.dreamcatcherflyfishing.com 5 dreamcatcherflyfishing.com 5 mail.nana22.com 5 tbogolf.com 4 leesoverseas.com 4 meeting.integratests.com 4 test.sushiheavenpenticton.ca 4 www.meeting.integratests.com 4 www.test.sushiheavenpenticton.ca 4 leesoverseas.laelgia.com 4 www.leesoverseas.com 4 www.leesoverseas.laelgia.com 4 www.nana22.com 4 mail.leesoverseas.com 4 mail.globalnexusinitiative.org 3 globalnexusinitiative.org 3 test.leesoverseas.com 3 mail.tbogolf.com 3 www.test.leesoverseas.com 3 mail.hhfurnitureanddesign.com 2 mail.jestelab.org 2 www.qio.hsj.mybluehost.me 2 www.monicakirkcpa.com 2 mail.monicakirkcpa.com 2 leesoverseas-net.laelgia.com 2 www.leesoverseas-net.laelgia.com 2 mail.qio.hsj.mybluehost.me 2 www.ibahai.org 2 fairmount-heights-org.ronhalbertproductions.com 2 mail.wcb.tvd.mybluehost.me 3 www.edlanger.com 2 edlanger.com 2 mail.edlanger.com 2 www.homesickandwestbound.com 2 www.fairmount-heights-org.ronhalbertproductions.com 2 sushiheavenpenticton-ca.laelgia.com 2 www.sushiheavenpenticton-ca.laelgia.com 2 briancaylor.com 2 www.chiragrvaiddds.com 2 www.stay.bwamgosh.com 2 www.briancaylor.com 2 jj-joy.com 2 collaborativemba.com 2 blog.bwamgosh.com 2 wcb.tvd.mybluehost.me 2 www.fairmount-heights.org 2 mail.briancaylor.com 2 www.hhfurnitureanddesign.com 2 www.toscaflowers.com 2 mail.sabiman.ng 2 monicakirkcpa.com 2 fairmount-heights.org 2 ward4.net 2 mail.sushiheavenpenticton.ca 2 www.globalnexusinitiative.org 2 mail.vincentgates.com 2 mail.collaborativemba.org 2 www.willragano.com 2 www.jj-joy.com 2 www.ward4.net 2 ibahai.org 2 mail.jj-joy.com 2 sushiheavenpenticton.ca 2 s-crump.com 2 mail.fairmount-heights.org 2 hhfurnitureanddesign.com 2 lastnightswork.com 2 www.jestelab.org 2 www.dbullmedical.windanseabeach.org 2 stay.bwamgosh.com 2 www.blog.bwamgosh.com 2 willragano.com 2 taied.com 2 mail.taied.com 2 mail.toscaflowers.com 2 sushiheavenpenticton.laelgia.com 2 mail.chiragrvaiddds.com 2 www.wcb.tvd.mybluehost.me 2 mail.collaborativemba.com 2 www.sushiheavenpenticton.laelgia.com 2 www.s-crump.com 2 mail.cs.laelgia.com 2 www.sushiheavenpenticton.ca 2 mail.ward4.net 2 jj-joy.laelgia.com 2 www.collaborativemba.org 2 www.taied.com 2 dbullmedical.windanseabeach.org 2 www.tbogolf.com 2 www.collaborativemba.com 2 mail.willragano.com 2 website-d17477dc.laelgia.com 2 www.website-d17477dc.laelgia.com 2 mail.s-crump.com 2 jestelab.org 2 www.jj-joy.laelgia.com 2 collaborativemba.org 2 www.etronixtt.com 2 mail.etronixtt.com 2 test.jj-joy.com 1 qio.hsj.mybluehost.me 1 chiragrvaiddds.com 1 www.test.jj-joy.com 1 etronixtt.com 1 sabiman.ng 1 www.sabiman.ng 1 homesickandwestbound.com 1 mail.homesickandwestbound.com 1 scottstravelblog.com 0 www.ashotofpetrone.transcendinghorizonsmarketing.com 0 www.dermatologiajimenez.hfy.ovo.mybluehost.me 0 mail.faronassociates.com 0 www.themightyoakes.com 0 www.anothersunnyday.us 0 dgy.goc.mybluehost.me 0 mail.superpsychicroyale.com 0 mail.chr.vql.mybluehost.me 0 www.discgolfaround.teacherdouble.com 0 www.nmk.dhy.mybluehost.me 0 slinkyandmoose.com 0 gabesiegal.com 0 mail.familybackyardadventures.com 0 www.growinggreatsouls.com 0 www.aiwtd.nlyh.org 0 mail.galezmarketing.com 0 website-cea4c429.accessibledbt.com 0 thewhitelightcollective.com 0 www.gzp.xng.mybluehost.me 0 vyf.svi.mybluehost.me 0 mail.crystalaccountsnig.com 0 www.im4c.com 0 www.mindfulequanimity.com 0 www.prepamasters-com.mte.uzz.mybluehost.me 0 parkramz.amenired.com 0 beyondglioblastoma.com 0 berenicelefebvre.com 0 www.thb.bpj.mybluehost.me 0 elm-rc.com 0 xcf.wvs.mybluehost.me 0 artsbiotica.spircen.com 0 mail.montcopatchpro.com 0 mail.loveandwar.com 0 configjon.com 0 www.doorbustersale.thematchmakingteam.com 0 mail.silkbeautyfromqi.com 0 www.ivuemedia.com 0 www.gbts-llc.com 0 www.nbtrades.thematchmakingteam.com 0 old.pavedc.org 0 mail.badassloops.com 0 grape-experiences.com 0 www.tammyhicksjackson.com 0 jesustrustinginhim.ca 0 www.dmwoodturners.com 0 www.bumclues.schindlerengineering.com 0 www.eleventy-one.com 0 inspirednationonline.com 0 mail.ljx.ryb.mybluehost.me 0 tsc.coo.mybluehost.me 0 mail.janellelynnrn.com 0 www.livingthehlife.com 0 letthebunsbake.com 0 mail.bat-trac.com 0 mail.xmw.pan.mybluehost.me 0 tinker1881.chiefsimplicityofficer.com 0 mail.secondcityfireprotection.com 0 mail.votersrighttoknow.org 0 mail.dearricky.com 0 mail.ohanaparents.com 0 www.hrsfashionllc.com 0 mail.mindfulequanimity.com 0 test.westmountplacepharmacy.com 0 website-d965dad7.gandtideas.com 0 mail.brennanforpa.com 0 southernlehightogether.com 0 ssscolumbia-org.sgw.ihj.mybluehost.me 0 overthinkingcomics.seanneprud.com 0 mail.wfh.tdd.mybluehost.me 0 themoreclub.com 0 www.loveandwar.com 0 grupolazaro.com 0 littlefeetbigworld.blog 0 mail.boriginallifecoach.com 0 www.ancernetwork.org 0 fjb.gro.mybluehost.me 0 qfs.yhn.mybluehost.me 0 www.mah.rfn.mybluehost.me 0 mll.kqm.mybluehost.me 0 www.website-41f92733.litraven.com 0 mail.cht.jvd.mybluehost.me 0 mail.containstore.co 0 revolvt.com 0 www.qarnis.com 0 mail.centralkitchenla.com 0 mail.epicchronicles.ca 0 nbtrades.thematchmakingteam.com 0 bolbiethebear.com 0 skyscrapers.today 0 schindlerengineering.com 0 www.website-f4f68066.simplyfinn.com 0 mail.airr-na.org 0 campustocorporatellc.com 0 www.zealium.media 0 creatimartcr.com 0 mail.levinsonforeastpenn.org 0 website-b64bd23a.yqr.bzx.mybluehost.me 0 mail.bahaiteacher.org 0 aiwtd.com 0 advancedtreehealth.com 0 www.newcomfortinc.com 0 naturallygoodlife.com 0 mail.wholehomeandbodyhealth.com 0 www.roofsaverscolorado.com 0 yqr.bzx.mybluehost.me 0 www.en.cydefi.com 0 mail.aysphiladelphia.com 0 mail.thematchmakingteam.com 0 www.tahitianinn.com 0 www.insideoutcareer.com 0 nwgroutworks.com 0 xrk.get.mybluehost.me 0 www.rebushealth.com 0 mail.mte.uzz.mybluehost.me 0 mah.rfn.mybluehost.me 0 hkx.yek.mybluehost.me 0 whitestone.institute 0 thesavannahoakswinery.com 0 thelifewhispers.com 0 digitaleyearmor.com 0 website-8dc5acf0.livinglifeyouthwellness.com 0 mail.newcomfortinc.com 0 lauradevaisher.com 0 www.bryangarde.com 0 seefeldtlab.org 0 mail.daviddtaylor.com 0 mail.isaacbutler.com 0 relationalchristianity.com 0 upro1.net 0 mail.mandalainteriordesigns.com 0 www.grv.zzm.mybluehost.me 0 mail.middleschoolkingdom.com 0 emmacorriganfilm.com 0 mail.apknowledgehub.com 0 mail.brandengill.com 0 website-657d527b.laelgia.com 0 rebellatrix.com 0 www.emmacorriganfilm.com 0 wallylambdesign.com 0 mail.rebellatrix.com 0 mail.kal.tdd.mybluehost.me 0 mail.xoi.ooe.mybluehost.me 0 www.sportsnews-swiss.ch 0 mail.frontlinecustomprinting.com 0 mail.muratarslanoglu.com 0 maxbloom.com 0 mail.diversifiedequipmentinc.com 0 www.sewingcoursesshrewsbury.co.uk 0 mail.fiveonthego.com 0 www.demirpinar.com 0 www.simplyunderstood.com 0 loveandwar.com 0 mail.nbtrades.com 0 micdrop.one 0 www.iprettygirl.com 0 mail.myh.rwl.mybluehost.me 0 www.yla.joe.mybluehost.me 0 themightyoakes.com 0 www.kassargroup2.bravaconsultancy.com 0 gabrielcybersecurity.com 0 assertif.us 0 mail.haysolar.com.au 0 tangerineeatery.com 0 tool.plannexcg.com 0 mail.trafficfreegh.com 0 mail.daa.mke.mybluehost.me 0 mail.bobbymoen.com 0 mail.embraceherflow.com 0 www.imdsspecialists.com 0 mail.monomovement.org 0 www.cop.mzi.mybluehost.me 0 www.mve.ldj.mybluehost.me 0 mail.vyf.svi.mybluehost.me 0 artjefferson.com 0 www.rte.qps.mybluehost.me 0 mail.cometpluto.com 0 www.tankardsaweigh.chiefsimplicityofficer.com 0 allprofencingplus.com 0 mail.dyu.kzx.mybluehost.me 0 bizfornurses.com 0 www.karenchavez.com 0 www.artjefferson.com 0 mail.uft.psw.mybluehost.me 0 mail.teammcgloin-delevieforpsu.com 0 www.kal.tdd.mybluehost.me 0 bronxanimalhospital.com 0 inklingvideo.com 0 www.spicesindia-ca.vedictantra.ca 0 pqg.ssy.mybluehost.me 0 mail.nir.qhd.mybluehost.me 0 www.clubboring.com 0 www.powerplus.tw 0 www.myh.rwl.mybluehost.me 0 westlakechineseacademy.org 0 www.gwblue-site.pkk.xvd.mybluehost.me 0 www.muguetphotography.com 0 www.qarnis.lfc.twv.mybluehost.me 0 theeverydayhousewife.com 0 evecustompackaging.com 0 www.soo.fuh.mybluehost.me 0 mail.dmwoodturners.com 0 www.uft.psw.mybluehost.me 0 mail.jcc.qfv.mybluehost.me 0 www.monomovement.org 0 www.vivianasoto.vivianasoto.com 0 isaacbutler.com 0 www.vnv.sty.mybluehost.me 0 mail.novacountertopsusa.com 0 www.mte.uzz.mybluehost.me 0 mail.thesleepeasymethod.com 0 mail.thb.bpj.mybluehost.me 0 www.mvmteam.thematchmakingteam.com 0 www.azfqhc.com 0 awx.rew.mybluehost.me 0 www.rez.lbn.mybluehost.me 0 www.vedictantra.ca 0 www.milehighsquares.org 0 www.kef.ops.mybluehost.me 0 mail.xavierguri.com 0 annakaytolberk.com 0 www.kzt.iml.mybluehost.me 0 mail.aml.ano.mybluehost.me 0 vgp.tta.mybluehost.me 0 www.yra.wyz.mybluehost.me 0 www.aniespizza.com 0 mail.courtneycoffey.com 0 www.khoecungdoc.com 0 dearricky.com 0 www.uut.thm.mybluehost.me 0 mail.duettoeventi.com 0 mail.ushoneybeehealthsurvey.info 0 mail.steppinginpurpose.com 0 mail.jesustrustinginhim.ca 0 mail.onlinesellingsystems.us 0 mail.brainstreamhelp.com 0 www.newentrepreneurontheblock.pickupabroom.com 0 travelwithjai.com 0 www.qualicumwellnesspartnersgroup.com 0 www.whynotgifted.com 0 www.aidealsandoffers.com 0 www.aidealsandoffers.pickupabroom.com 0 ivuerobotics.com 0 www.cdc.jvd.mybluehost.me 0 www.charlesjmorganmdpsychiatry.com 0 www.website-3c332e22.xly.czh.mybluehost.me 0 wfh.tdd.mybluehost.me 0 www.rfimagingandcommunications.com 0 www.michaelklotz.mkadvisory.com 0 www.primroseground.nlyh.org 0 www.bobbymoen.com 0 mail.tce.qby.mybluehost.me 0 sxj.mhd.mybluehost.me 0 mail.zekca.com.hk 0 qas.wbq.mybluehost.me 0 anothersunnyday.us 0 mail.uponaboard.com 0 mail.tripsactions.online 0 www.aze.zhc.mybluehost.me 0 www.projectevan.com 0 mail.zog.ufe.mybluehost.me 0 mail.zpv.ops.mybluehost.me 0 zpv.ops.mybluehost.me 0 www.zpv.ops.mybluehost.me 1 mail.wrv.ops.mybluehost.me 0 www.wrv.ops.mybluehost.me 0 www.havefridayeveryday.com 0 fgt.wgl.mybluehost.me 0 mail.havefridayeveryday.com 0 fjj.duj.mybluehost.me 0 atentinthewoods.com 0 www.fridanelkenrealestate.com 0 ctmracing.com 0 www.training-ground.bluehivecreative.com 0 www.showmefreight.com 0 nuthatchleos.com 0 www.laelgia.com 0 mail.analyticallens.com 0 clintfirstbaptist.org 0 caosville.com 0 www.mkadvisory.com 0 parentsmakinganinvestment.com 0 mail.nmk.dhy.mybluehost.me 0 prepamasters-com.mte.uzz.mybluehost.me 0 www.beginagain.site 0 mail.inspirednationonline.com 0 www.outtaroad.com 0 ipt.wgl.mybluehost.me 0 www.bryangarde.on-garde.com 0 www.fonvilletreeservice.com 0 mail.alphabetcorner.com 0 mail.littrellelectric.com 0 www.alabamadrivethroughtesting.gandtideas.com 0 mail.bizfornurses.com 0 www.drdeborahlevy.com.au 0 canadaimmihelps.com 0 buloy.nh-bluehost3.com 0 umx.hsk.mybluehost.me 0 www.tjw.bjl.mybluehost.me 0 advancetreehealth.com 0 mail.njj.ano.mybluehost.me 0 doorbustersale.thematchmakingteam.com 0 www.artsbiotica.com 0 mail.discgolfaround.com 0 www.elevatedbecoming.com 0 triginc.org 0 levinsonforeastpenn.org 0 mail.laelgia.com 0 mandeepstratigies.com 0 ivuemedia.com 0 bahaiteacher.org 0 www.sportsgematria.com 0 prodermalwellness.spircen.com 0 www.matjararabi.net 0 mail.siliangz.com 0 www.sxj.mhd.mybluehost.me 0 www.rodnreelfishing.com 0 www.evr.ths.mybluehost.me 0 www.irevealhealth.com 0 www.worklikeagirl.co 0 www.kassargroup.com 0 www.ykl.thm.mybluehost.me 0 www.lwolfeauthor.com 0 mail.tjw.bjl.mybluehost.me 0 www.belottieros.com 0 www.heraextension.com 0 www.uaj.tdd.mybluehost.me 0 www.saltycentral.com 0 mail.shrineandrepublic.com 0 nnh.zbc.mybluehost.me 0 www.legaceeproductions.com 1 easyrecruitnow.com 0 www.keatonlannert.com 0 www.pqg.ssy.mybluehost.me 0 mail.jnoblespeak.com 0 imperepoxy.com 0 mail.gbb.tdd.mybluehost.me 0 www.gdd.cjs.mybluehost.me 0 mail.fotografia-gallery.com 0 www.tmh.qdt.mybluehost.me 0 mte.uzz.mybluehost.me 0 www.thebridgechristianpodcast.thebridgechristianfellowshipteachings.com 0 journalofpornography.com 0 www.schindlerscrapandsalvage.schindlerengineering.com 0 www.ste.tdd.mybluehost.me 0 allboybootytrain.com 0 erd1music.com 0 mail.zenithsolutionsnm.com 0 mail.decghana.org 0 mail.tmh.qdt.mybluehost.me 0 mail.tmx.bpj.mybluehost.me 0 opulent.gold 0 mail.thesaltypaddle.com 0 www.funeka-shop.com 0 funeka-shop.com 0 www.digitaleyearmor.com 0 tmx.bpj.mybluehost.me 0 mail.jacksoneducationservices.com 0 www.jacksoneducationservices.com 0 jacksoneducationservices.com 0 mail.plantbookusa.com 0 weddings.bluehivecreative.com 0 www.plantbookusa.com 0 gdd.cjs.mybluehost.me 0 mail.rtv.cup.mybluehost.me 0 improveyour20s.com 0 eaviationnews.com 0 mail.annakaytolberk.com 0 www.balconyguide.com 0 www.dronesivue.ivuerobotics.com 0 www.prayerpointpress.vyf.svi.mybluehost.me 0 www.overthinkingcomics.seanneprud.com 0 mail.michmondo.com 0 www.xvm.cup.mybluehost.me 0 mail.aayaproductionsny.com 0 keywomeninchrist.com 0 mail.tankardsaweigh.com 0 www.fua.zzt.mybluehost.me 0 www.instincxbyanayanicole.com 0 rmt.zga.mybluehost.me 0 mail.heraextension.com 0 www.redheadlivesmatter.com 0 recon-logic.com 0 mail.humansalike.com 0 mail.jhairstudio.ca 0 www.eliterazor.com 0 mail.lyubastudio.co.uk 1 mail.uyw.fmr.mybluehost.me 0 www.roofsaversco.com 0 www.alexketo.com 0 mail.chiton.store 0 thewayofthekingdom.pmg.dbr.mybluehost.me 0 www.kaabuzz.thematchmakingteam.com 0 www.imperepoxy.com 0 vernastudio.com 0 mti.nxb.mybluehost.me 0 becan-ca.multicultural.com.br 0 mail.avtgl.com 0 www.beyondglioblastoma.atentforfour.com 0 pinoandpie.com 0 mail.redheadlivesmatter.com 0 www.gwblue.site 0 www.doorbustersale.com 0 mail.remotejoblist.com 0 www.anthonycinque.com 0 pqf.yfm.mybluehost.me 0 mail.dgf.cyt.mybluehost.me 0 mail.iml.kes.mybluehost.me 0 zyc.yhb.mybluehost.me 0 www.barbarahroos.com 0 mail.padelcommunity.club 0 website-b387fdd0.simplyfinn.com 0 zev.mvv.mybluehost.me 0 thv.qjk.mybluehost.me 0 edermaskinshop.hfy.ovo.mybluehost.me 0 www.primroseground.com 0 litraven.com 0 www.entrustedwithgrace.com 0 mail.stunncust.com 0 ricamontespr.com 0 mail.advancetreehealth.com 0 www.dai.pgs.mybluehost.me 0 sethrwilson.com 0 www.theboozereviews.com 0 mail.jojoinfotech.com 0 www.overthinkingcomics.com 0 lnj.wgl.mybluehost.me 0 www.therevolutionky.org 0 teacherdouble.com 0 www.naturallygoodlife.com 0 mail.arcanawatch.com 0 www.schindlerengineering.com 0 billmoore.auroralightgraffiti.com 0 drsexyann.com 0 www.outtaroad.embraceherflow.com 0 www.czp.isd.mybluehost.me 0 jwholesalespa.nlyh.org 0 jfp.vgr.mybluehost.me 0 whitneyforeastpenn.com 0 mail.travelglobenow.com 0 jackbabbage.chiefsimplicityofficer.com 0 mail.rve.vua.mybluehost.me 0 mail.philomathean.tv 0 www.website-b8e2bb48.simplyfinn.com 0 mail.neurostrategiesfx.com 0 mail.ngiscvsa.com 0 mail.thewhitelightcollective.com 0 www.hopesforthepath.org 0 partnersteletherapy.com 0 mail.xum.ryb.mybluehost.me 0 mail.weightsandredemption.com 0 mail.latinvfr.org 0 www.blessingretailgroup.com 0 bravaconsultancy.com 0 mail.williamthepainter.com 0 www.razzlemarketing.com 0 mail.jordanwaugh.com 0 genzintherealworld.com 0 mail.straightasasafetypin.com 0 mail.pearlory.com 0 www.improveyour20s.com 0 lunacatena.com 0 mail.overthinkingcomics.com 0 www.kaitlinhenre.com 0 mail.ypd.ajs.mybluehost.me 0 npw.qps.mybluehost.me 0 uponaboard.com 0 thesleepeasymethod.com 0 razzlemarketing.aniespizza.com 0 rtv.cup.mybluehost.me 0 mail.flowgrounds.org 0 www.onlinesellingsystems.us 0 www.shellyannweeks.embraceherflow.com 0 www.weightsandredemption.com 0 hollowayandyoung.com 0 mail.buildingfluency.com 0 mail.btg.yzs.mybluehost.me 0 www.floridatackleclub.com 0 jojoinfotech.com 0 www.im4c.genasysinc.com 0 www.wsg.fwo.mybluehost.me 0 www.nvd.zhc.mybluehost.me 0 www.sewingstudioshrewsbury.co.uk 0 www.ldb.psw.mybluehost.me 0 mail.berenicelefebvre.com 0 www.hss.lcd.mybluehost.me 0 xperttreeservicesma-ri.com 0 mail.defendeastpenn.com 0 ushoneybeehealthsurvey.info 0 www.rmt.zga.mybluehost.me 0 www.cinetyka-mg.andcorp.org 0 primroseground.nlyh.org 0 thechefdinnerclub.com 0 mail.inklingvideo.com 0 www.silverpuddleglum.com 0 www.rebellatrix.com 0 mail.dealers.marketing 0 leavingchristianity-net.pmg.dbr.mybluehost.me 0 mail.bmm.isd.mybluehost.me 0 jwholesalespa.com 0 www.embraceherflow.com 0 www.fjj.duj.mybluehost.me 0 migukedit.travelglobenow.com 0 unitechcomputersnorthwest.co.uk 0 julialaurel.com 0 mail.sunshinespaulding.com 0 www.roadrevelations.org 0 www.shittybooks.com 0 www.meltcville.com 0 www.lifewithvernandjoli.com 0 mail.monioweddings.com 0 atentinthewoods.atentforfour.com 0 mail.tjq.ijo.mybluehost.me 0 mail.martimcerere.edu.ec 0 www.subdomain.radhakrishna.ca 0 mail.fua.zzt.mybluehost.me 0 mail.jfp.vgr.mybluehost.me 0 hatchersmith.com 0 www.inklingvideo.com 0 familybackyardadventures.com 0 www.noemarti.com 0 greenobsessionnursery.com 0 www.simplycolorguard.com 0 mail.sportsnews-swiss.ch 0 www.startguides.net 0 razzlemarketing.com 0 mail.dgy.goc.mybluehost.me 0 sjqart.com 0 website-e7a6b7e6.rightslaw.org 0 website-b8e2bb48.simplyfinn.com 0 www.jackbabbage.chiefsimplicityofficer.com 0 www.martechcreative.com 0 mail.ljl.zhc.mybluehost.me 0 www.iml.kes.mybluehost.me 0 mail.futech.cl 0 mail.tsc.coo.mybluehost.me 0 www.billmoore.auroralightgraffiti.com 0 stevenrychen.com 0 authortalk.tv 0 btg.yzs.mybluehost.me 0 www.website-185d22be.livinglifeyouthwellness.com 0 www.rebushealth.mkadvisory.com 0 www.unitechcomputersnorthwest.co.uk 0 bksbmpa.com 0 mail.tangerineeatery.com 0 thegraphiteline.com 0 website-da2d9bdc.qok.pan.mybluehost.me 1 www.new.greatplacetobelong.org.au 0 www.tangerineeatery.com 0 mail.securingyourfamily.com 0 www.fzr.tdd.mybluehost.me 0 mail.idx.oao.mybluehost.me 0 clubboring.com 0 www.levinsonforeastpenn.org 0 www.assertif.us 0 www.liz-jackson.com 0 www.whitestone.institute 0 spircen.com 0 bsl.abf.mybluehost.me 0 ofo.evx.mybluehost.me 0 aahomerealty.com 0 mail.jsu.vtl.mybluehost.me 0 ddq.jdq.mybluehost.me 0 laelgia.com 0 www.kpv.wog.mybluehost.me 0 mail.embeddedmindset.com 0 wholeheartedwellnessalabama.com 0 mail.whitestone.institute 0 jordanwaugh.com 0 val.wxt.mybluehost.me 0 revdrkatewinters.com 0 mail.val.wxt.mybluehost.me 0 zekca.com.hk 0 www.cledygonzalez.com 0 www.themoreclub.com 0 www.seanneprud.com 0 mail.bandeconcrete.com 0 website-3c332e22.xly.czh.mybluehost.me 1