Host 162.241.226.40
United States
Software information
Apache
tcp/443 tcp/80
nginx 1.25.5
tcp/443 tcp/80
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 17:55
Last seen 2024-11-08 22:14
Open for 782 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-11-08 22:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:41
Last seen 2024-11-08 22:12
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 22:12
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.nontribaleconomics.com
Port: 443
URL: https://mail.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2024-11-08 22:10
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 22:10
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.journalpublisher.co.uk
Port: 443
URL: https://www.journalpublisher.co.ukFirst seen 2023-09-19 18:58
Last seen 2024-11-08 22:09
Open for 416 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c2aeec2[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-11-08 22:09293 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224352633e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [pull] rebase = false
Found on 2024-01-07 12:13320 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-12-11 12:32235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2024-11-08 22:01
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2024-11-08 22:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9defc5466cefc5466cefc5466cefc5466cFound 1 files trough .DS_Store spidering: /blog
Found on 2024-09-18 13:45
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublications.zbo.pfi.mybluehost.meFirst seen 2023-04-03 18:20
Last seen 2024-11-08 21:57
Open for 585 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 21:57241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.androidrobotproductions.com
Port: 443
URL: https://mail.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-11-08 21:45
Open for 723 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-11-08 21:45
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublicationsuss.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublicationsuss.zbo.pfi.mybluehost.meFirst seen 2023-04-03 18:20
Last seen 2024-11-08 21:42
Open for 585 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 21:42241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2024-11-08 21:40
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2024-11-08 21:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9defc5466cefc5466cefc5466cefc5466cFound 1 files trough .DS_Store spidering: /blog
Found on 2024-09-02 05:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-11-08 21:39
Open for 477 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 21:39 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-06 17:52 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c8c9af8b78c9af8b79ca15ebcc657e14adaa42238c06d573aFound 128 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/blocks/archives /wp-includes/blocks/audio /wp-includes/blocks/avatar /wp-includes/blocks/block /wp-includes/blocks/button /wp-includes/blocks/buttons /wp-includes/blocks/calendar /wp-includes/blocks/categories /wp-includes/blocks/code /wp-includes/blocks/column /wp-includes/blocks/columns /wp-includes/blocks/comment-author-name /wp-includes/blocks/comment-content /wp-includes/blocks/comment-date /wp-includes/blocks/comment-edit-link /wp-includes/blocks/comment-reply-link /wp-includes/blocks/comment-template /wp-includes/blocks/comments /wp-includes/blocks/comments-pagination /wp-includes/blocks/comments-pagination-next /wp-includes/blocks/comments-pagination-numbers /wp-includes/blocks/comments-pagination-previous /wp-includes/blocks/comments-title /wp-includes/blocks/cover /wp-includes/blocks/embed /wp-includes/blocks/file /wp-includes/blocks/freeform /wp-includes/blocks/gallery /wp-includes/blocks/group /wp-includes/blocks/heading /wp-includes/blocks/home-link /wp-includes/blocks/html /wp-includes/blocks/image /wp-includes/blocks/latest-comments /wp-includes/blocks/latest-posts /wp-includes/blocks/legacy-widget /wp-includes/blocks/list /wp-includes/blocks/list-item /wp-includes/blocks/loginout /wp-includes/blocks/media-text /wp-includes/blocks/missing /wp-includes/blocks/more /wp-includes/blocks/navigation /wp-includes/blocks/navigation-link /wp-includes/blocks/navigation-submenu /wp-includes/blocks/nextpage /wp-includes/blocks/page-list /wp-includes/blocks/paragraph /wp-includes/blocks/pattern /wp-includes/blocks/post-author /wp-includes/blocks/post-author-biography /wp-includes/blocks/post-comments-form /wp-includes/blocks/post-content /wp-includes/blocks/post-date /wp-includes/blocks/post-excerpt /wp-includes/blocks/post-featured-image /wp-includes/blocks/post-navigation-link /wp-includes/blocks/post-template /wp-includes/blocks/post-terms /wp-includes/blocks/post-title /wp-includes/blocks/preformatted /wp-includes/blocks/pullquote /wp-includes/blocks/query /wp-includes/blocks/query-no-results /wp-includes/blocks/query-pagination /wp-includes/blocks/query-pagination-next /wp-includes/blocks/query-pagination-numbers /wp-includes/blocks/query-pagination-previous /wp-includes/blocks/query-title /wp-includes/blocks/quote /wp-includes/blocks/read-more /wp-includes/blocks/rss /wp-includes/blocks/search /wp-includes/blocks/separator /wp-includes/blocks/shortcode /wp-includes/blocks/site-logo /wp-includes/blocks/site-tagline /wp-includes/blocks/site-title /wp-includes/blocks/social-link /wp-includes/blocks/social-links /wp-includes/blocks/spacer /wp-includes/blocks/table /wp-includes/blocks/tag-cloud /wp-includes/blocks/template-part /wp-includes/blocks/term-description /wp-includes/blocks/text-columns /wp-includes/blocks/verse /wp-includes/blocks/video /wp-includes/blocks/widget-group /wp-includes/certificates /wp-includes/css /wp-includes/customize
Found on 2024-10-17 04:30 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-10 22:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-26 19:27 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-14 03:56
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerpublications.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.springerpublications.zbo.pfi.mybluehost.meFirst seen 2023-03-08 19:20
Last seen 2024-11-08 21:34
Open for 611 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222bfb54be[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ebookpublisher/springerpublications-as-dradamconsultancy.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 21:34260 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2024-11-08 21:32
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2024-11-08 21:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.churchannouncementsolutions.com
Port: 443
URL: https://www.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2024-11-08 21:31
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-16 19:09
Last seen 2024-11-08 21:21
Open for 662 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 21:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-11-08 21:19
Open for 723 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 21:19
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.scimagopublications.co.uk
Port: 443
URL: https://www.scimagopublications.co.ukFirst seen 2023-06-04 18:12
Last seen 2024-11-08 20:59
Open for 523 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652236b4a59e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/scimagopublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 20:59239 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-11-08 20:55
Open for 366 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-11-08 20:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-09 19:05
Last seen 2024-11-08 20:54
Open for 700 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 20:54
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublicationsusus.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublicationsusus.zbo.pfi.mybluehost.meFirst seen 2023-06-04 18:12
Last seen 2024-11-08 20:53
Open for 523 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 20:53241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.orchardhillschristianacademy.com
Port: 443
URL: https://www.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2024-11-08 20:45
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 20:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-11-08 20:37
Open for 366 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-11-08 20:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.nontribaleconomics.com
Port: 443
URL: https://www.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2024-11-08 20:14
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 20:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-17 19:21
Last seen 2024-11-08 20:13
Open for 661 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-10 21:26
Last seen 2024-11-08 20:12
Open for 242 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 20:12
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenhoa.org
Port: 443
URL: https://mail.charbonneaugreenhoa.orgFirst seen 2023-02-08 18:55
Last seen 2024-11-08 19:44
Open for 639 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 19:44
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublications-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-01-22 19:18
Last seen 2024-11-08 19:42
Open for 656 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 19:42241 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652210381cd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk-old.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-01-22 19:18303 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.journalpublisher-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.journalpublisher-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-09-19 18:58
Last seen 2024-11-08 19:40
Open for 416 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c2aeec2[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-11-08 19:40293 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224352633e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [pull] rebase = false
Found on 2024-01-07 05:24320 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-12-11 13:22235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-14 07:45
Last seen 2024-11-08 19:37
Open for 178 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 19:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowemountainbike.stowe-trails.com
Port: 443
URL: https://stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13
Last seen 2024-11-08 19:06
Open for 451 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 19:06 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-06 07:53 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-04 08:22 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-19 00:57 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-02 17:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-11-08 18:55
Open for 477 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 18:55 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-04 08:06 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-24 03:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-06 16:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6cdcd985923522afbaadcd0c57c36f36fFound 28 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-20 12:39 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-16 11:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.portugalexperience.com
Port: 443
URL: https://www.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2024-11-08 18:54
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 18:54
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-11-08 18:40
Open for 859 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-08 18:40302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-11-08 18:40
Open for 737 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-11-08 18:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-08-25 23:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-06-01 21:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-05-13 01:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2023-09-14 04:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-11-08 18:38
Open for 737 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-11-08 18:38 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-11-05 18:55 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-10-30 21:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-10-10 12:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-08-26 17:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead62b5dcaabFound 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-08-26 17:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-08-22 18:22
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-11-08 18:38
Open for 859 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-08 18:38302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd08e645819ddf7fd15b8dbfb5b08bcd1896246f4c744b9a8204HTTP/1.1 200 OK Date: Fri, 05 May 2023 17:54:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ehfs.health/wp-json/>; rel="https://api.w.org/", <https://ehfs.health/wp-json/wp/v2/pages/1556>; rel="alternate"; type="application/json", <https://ehfs.health/>; rel=shortlink Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: EHFS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/masterFound on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.churchannouncementsolutions.com
Port: 443
URL: https://mail.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2024-11-08 18:37
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 18:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: orchardhillschristianacademy.com
Port: 443
URL: https://orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2024-11-08 18:35
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 18:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:29
Last seen 2024-11-08 18:34
Open for 784 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 18:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.qru.jgb.mybluehost.me
Port: 443
URL: https://www.qru.jgb.mybluehost.meFirst seen 2023-11-07 21:03
Last seen 2024-11-08 18:34
Open for 366 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-11-08 18:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-11-08 18:07
Open for 476 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 18:07 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-04 17:32 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-02 15:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-20 15:59 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-16 06:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-01-08 21:13
Last seen 2024-11-08 17:56
Open for 304 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-11-08 17:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.vbp.pmc.mybluehost.me
Port: 443
URL: https://www.vbp.pmc.mybluehost.meFirst seen 2024-06-07 09:57
Last seen 2024-11-08 17:52
Open for 154 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 17:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2024-11-08 17:46
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-11-08 17:46
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-11-08 17:39
Open for 716 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 17:39225 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: churchannouncementsolutions.com
Port: 443
URL: https://churchannouncementsolutions.comFirst seen 2022-09-16 18:17
Last seen 2024-11-08 17:21
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 17:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:29
Last seen 2024-11-08 17:20
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 17:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.tyd.skj.mybluehost.me
Port: 443
URL: https://mail.tyd.skj.mybluehost.meFirst seen 2024-03-10 21:35
Last seen 2024-11-08 17:17
Open for 242 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 17:17
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivate.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivate.zbo.pfi.mybluehost.meFirst seen 2023-01-24 19:20
Last seen 2024-11-08 16:51
Open for 653 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 16:51241 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublicationsus.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublicationsus.zbo.pfi.mybluehost.meFirst seen 2023-04-03 18:20
Last seen 2024-11-08 16:04
Open for 584 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 16:04241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:29
Last seen 2024-11-08 15:48
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 15:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2024-11-08 15:23
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 15:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2024-11-08 15:21
Open for 721 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2024-11-08 15:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9defc5466cefc5466cefc5466cefc5466cFound 1 files trough .DS_Store spidering: /blog
Found on 2024-09-04 16:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetguitar.com
Port: 443
URL: https://www.andyrobinetguitar.comFirst seen 2023-01-16 19:10
Last seen 2024-11-08 15:21
Open for 661 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 15:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.tyd.skj.mybluehost.me
Port: 443
URL: https://www.tyd.skj.mybluehost.meFirst seen 2024-03-10 21:35
Last seen 2024-11-08 15:21
Open for 242 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 15:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.achronicentrepreneur.com
Port: 443
URL: https://mail.achronicentrepreneur.comFirst seen 2022-10-13 18:10
Last seen 2024-11-08 15:21
Open for 756 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 15:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2024-11-08 14:46
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 14:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.portugalexperience.com
Port: 443
URL: https://mail.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2024-11-08 14:03
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 14:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetmusic.androidrobotproductions.com
Port: 80
URL: http://andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-11-08 13:57
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 13:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2024-11-08 13:56
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 13:56
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-11-08 13:49
Open for 858 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-08 13:49302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-11-08 13:49
Open for 736 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-11-08 13:49 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-06-30 04:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-06-18 11:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-06-18 09:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-05-13 03:07
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.scimagopublications-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.scimagopublications-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-06-04 18:12
Last seen 2024-11-08 13:45
Open for 522 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652236b4a59e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/scimagopublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 13:45239 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.wpr.bwk.mybluehost.me
Port: 443
URL: https://mail.wpr.bwk.mybluehost.meFirst seen 2024-05-14 07:55
Last seen 2024-11-08 13:25
Open for 178 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 13:25
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetmusic.androidrobotproductions.com
Port: 443
URL: https://www.andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-11-08 13:23
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 13:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2024-11-08 13:07
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2024-11-08 13:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2024-11-08 12:54
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-11-08 12:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.yiy.rfl.mybluehost.me
Port: 443
URL: https://mail.yiy.rfl.mybluehost.meFirst seen 2024-01-08 21:23
Last seen 2024-11-08 12:41
Open for 304 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-11-08 12:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.qru.jgb.mybluehost.me
Port: 443
URL: https://mail.qru.jgb.mybluehost.meFirst seen 2023-11-07 21:03
Last seen 2024-11-08 12:38
Open for 366 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-11-08 12:38
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-11-08 12:29
Open for 716 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 12:29225 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-09 19:05
Last seen 2024-11-08 12:28
Open for 699 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 12:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-11-08 12:27
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 12:27
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerspublications-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.springerspublications-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-08-08 18:20
Last seen 2024-11-08 12:27
Open for 457 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522bcde40e1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/springerpublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 12:27242 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetguitar.androidrobotproductions.com
Port: 443
URL: https://andyrobinetguitar.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-11-08 12:22
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 12:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-11-08 12:17
Open for 476 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 12:17 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-06 10:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-30 08:59 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-16 13:48 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aaa80b4585e32b52d7ad4371490c4b380fFound 33 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-18 11:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetguitar.androidrobotproductions.com
Port: 443
URL: https://www.andyrobinetguitar.androidrobotproductions.comFirst seen 2023-01-16 19:10
Last seen 2024-11-08 12:15
Open for 661 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 12:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.wpr.bwk.mybluehost.me
Port: 443
URL: https://www.wpr.bwk.mybluehost.meFirst seen 2024-05-14 07:55
Last seen 2024-11-08 12:14
Open for 178 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-08 12:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenhoa.org
Port: 443
URL: https://www.charbonneaugreenhoa.orgFirst seen 2023-02-08 18:55
Last seen 2024-11-08 11:54
Open for 638 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:54
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-11-08 11:53
Open for 858 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-08 11:53302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-11-08 11:53
Open for 736 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-11-08 11:53 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-10-26 23:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-10-08 18:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-09-08 18:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-09-01 19:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247255468757e4d7abc1ac48f5e34fcb64df8Found 9 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-08-12 23:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-07-30 18:25 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead62b5dcaabFound 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-06-18 13:27
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-07 18:10
Last seen 2024-11-08 11:51
Open for 92 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenshoa.org
Port: 443
URL: https://www.charbonneaugreenshoa.orgFirst seen 2023-02-08 18:55
Last seen 2024-11-08 11:50
Open for 638 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.orchardhillschristianacademy.com
Port: 443
URL: https://mail.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2024-11-08 11:50
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.andyrobinetmusic.com
Port: 443
URL: https://mail.andyrobinetmusic.comFirst seen 2022-11-16 19:30
Last seen 2024-11-08 11:50
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetmusic.androidrobotproductions.com
Port: 443
URL: https://andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-11-08 11:49
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.vbp.pmc.mybluehost.me
Port: 443
URL: https://mail.vbp.pmc.mybluehost.meFirst seen 2024-06-07 11:47
Last seen 2024-11-08 11:49
Open for 154 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.andyrobinetguitar.com
Port: 443
URL: https://mail.andyrobinetguitar.comFirst seen 2023-01-16 19:10
Last seen 2024-11-08 11:49
Open for 661 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-11-08 11:29
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-17 19:21
Last seen 2024-11-08 11:15
Open for 660 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2024-11-08 11:09
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 11:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-16 19:09
Last seen 2024-11-08 10:56
Open for 661 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 10:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2024-11-08 10:04
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2024-11-08 10:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowetrails.stowe-trails.com
Port: 443
URL: https://www.stowetrails.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-11-08 09:26
Open for 476 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 09:26 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-06 11:39 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-01 03:08 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-26 18:56 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b914c2cd80228191834bcaf6796a0aecc40Found 52 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-18 20:53 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e46303911e2c8bb738f82ed3dd91fcc41Found 20 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-03-08 09:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetmusic.androidrobotproductions.com
Port: 80
URL: http://www.andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-11-08 09:19
Open for 722 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 09:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.androidrobotproductions.com
Port: 443
URL: https://www.androidrobotproductions.comFirst seen 2023-01-16 19:09
Last seen 2024-11-08 07:58
Open for 661 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-11-08 07:58
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications.com
Port: 443
URL: https://www.clarivatepublications.comFirst seen 2023-06-04 18:12
Last seen 2024-11-08 07:33
Open for 522 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-08 07:33241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-11-08 07:16
Open for 476 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 07:16 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-02 06:01 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-01 03:28 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-22 18:00 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b914c2cd80228191834bcaf6796a0aecc40Found 52 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-02 07:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6cdcd985923522afbaadcd0c57c36f36fFound 28 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-26 14:00 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-24 10:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 17:55
Last seen 2024-11-08 07:04
Open for 781 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-11-08 07:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:34
Last seen 2024-11-08 06:13
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 06:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenshoa.org
Port: 443
URL: https://mail.charbonneaugreenshoa.orgFirst seen 2022-12-09 19:05
Last seen 2024-11-08 05:45
Open for 699 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-08 05:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowetrails-org.stowe-trails.com
Port: 443
URL: https://www.stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-11-08 05:14
Open for 476 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 05:14 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-07 01:22 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-03 01:44 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-22 09:54 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-20 12:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-11-08 04:12
Open for 736 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-11-08 04:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-08-20 10:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-06-24 03:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-06-18 12:04
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-11-08 04:12
Open for 858 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-08 04:12302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-11-08 03:20
Open for 366 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-11-08 03:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.yiy.rfl.mybluehost.me
Port: 443
URL: https://www.yiy.rfl.mybluehost.meFirst seen 2024-01-08 21:23
Last seen 2024-11-08 03:20
Open for 304 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-11-08 03:20
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.ecom.journalpublisher.co.uk
Port: 443
URL: https://www.ecom.journalpublisher.co.ukFirst seen 2024-07-29 18:22
Last seen 2024-11-08 03:16
Open for 101 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522252736dc[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/ecommonkscurrent.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-08 03:16294 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowemountainbike.stowe-trails.com
Port: 443
URL: https://www.stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13
Last seen 2024-11-08 02:52
Open for 450 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-08 02:52 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-04 21:18 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-02 22:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-24 23:38 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-04 08:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: androidrobotproductions.com
Port: 443
URL: https://androidrobotproductions.comFirst seen 2023-01-16 19:09
Last seen 2024-11-08 02:48
Open for 661 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-11-08 02:48
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.teals.journalpublisher.co.uk
Port: 443
URL: https://www.teals.journalpublisher.co.ukFirst seen 2024-07-08 18:21
Last seen 2024-11-07 19:17
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522252736dc[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/ecommonkscurrent.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-07 19:17294 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-11-07 01:54
Open for 857 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-11-07 01:54302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-11-07 01:54
Open for 735 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-11-07 01:54 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-10-25 00:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-10-20 22:54 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-10-14 23:23 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fdb2942389d1bf6144c829e9acb4c5144Found 10 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-09-18 07:50 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-09-14 11:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-08-28 20:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: childrensfrenchbookcorner.com
Port: 443
URL: https://childrensfrenchbookcorner.comFirst seen 2022-09-15 17:53
Last seen 2024-11-07 01:49
Open for 783 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-07 01:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-11-07 01:47
Open for 365 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-11-07 01:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-11-07 01:23
Open for 721 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-07 01:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-17 19:21
Last seen 2024-11-07 01:18
Open for 659 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-07 01:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowetrails-org.stowe-trails.com
Port: 443
URL: https://stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-11-07 01:18
Open for 475 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-07 01:18 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-05 03:15 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-02 23:02 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-30 17:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e46303911e2c8bb738f82ed3dd91fcc41Found 20 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-18 10:12 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-05-25 14:24
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications.co.uk
Port: 443
URL: https://www.clarivatepublications.co.ukFirst seen 2023-01-22 19:18
Last seen 2024-11-07 00:58
Open for 654 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-07 00:58241 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652210381cd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk-old.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-01-22 19:18303 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-11-07 00:36
Open for 475 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-07 00:36 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-02 22:22 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-01 18:56 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-30 22:40 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-10 11:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 17:54
Last seen 2024-11-06 20:20
Open for 780 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-11-06 20:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2024-11-06 19:54
Open for 782 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-06 19:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowetrails.stowe-trails.com
Port: 443
URL: https://stowetrails.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-11-06 18:40
Open for 474 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-06 18:40 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-11-02 12:46 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-30 07:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-26 05:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-10-21 00:07
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerspublications.co.uk
Port: 443
URL: https://www.springerspublications.co.ukFirst seen 2023-08-08 18:20
Last seen 2024-11-06 15:21
Open for 455 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522bcde40e1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/springerpublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-11-06 15:21242 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:21
Last seen 2024-11-06 14:25
Open for 719 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-11-06 14:25
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.childrensfrenchbookcorner.com
Port: 443
URL: https://www.childrensfrenchbookcorner.comFirst seen 2022-09-15 17:52
Last seen 2024-11-06 14:11
Open for 782 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-11-06 14:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-22 21:30
Open for 328 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-22 21:30 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-18 20:29 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-09-14 14:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-03-08 09:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-22 21:00
Open for 328 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-09-22 21:00 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-09-06 11:41 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-08-22 07:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-08-18 07:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-08-08 20:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-22 13:59
Open for 327 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-09-22 13:59 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-14 19:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-09-11 03:57 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-08-24 03:13 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-08-20 13:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-22 09:40
Open for 327 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-22 09:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-14 09:23 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-09-06 19:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-07-16 11:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-04-28 21:05
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 80
URL: http://www.ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-09-02 03:59
Open for 649 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-02 03:59225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 80
URL: http://ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-09-01 07:51
Open for 648 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-01 07:51225 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.allnaturalrepellent.com
Port: 443
URL: https://www.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2024-08-24 05:37
Open for 707 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2024-08-24 05:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772eda0e53922d85fe97e12963a565b8f61Found 11 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.allnaturalrepellent.com
Port: 443
URL: https://mail.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2024-08-22 16:07
Open for 705 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2024-08-22 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:52
Last seen 2024-08-22 14:15
Open for 705 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2024-08-22 14:15 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772eda0e53922d85fe97e12963a565b8f61Found 11 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /Layered_highres /old html files /prelim imagery /proof
Found on 2024-03-08 06:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2024-06-28 08:45
Open for 588 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-28 08:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2024-06-28 01:28
Open for 588 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-28 01:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2024-06-26 11:43
Open for 586 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-26 11:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2024-06-06 10:43
Open for 627 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-06 10:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2024-06-06 09:16
Open for 627 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-06 09:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2024-06-06 07:13
Open for 627 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-06 07:13
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57
Last seen 2024-02-22 18:56
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb90233cd2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Florencio-Jose-Cau/41bc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-02-22 18:56305 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-01-07 11:03301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57
Last seen 2024-02-22 18:56
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb90233cd2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Florencio-Jose-Cau/41bc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-02-22 18:56305 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-01-07 02:42301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: mail.journalpublisher.co.uk
Port: 443
URL: https://mail.journalpublisher.co.ukFirst seen 2023-11-19 20:45
Last seen 2024-02-02 02:27
Open for 74 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c2aeec2[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-02-02 02:27293 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224352633e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [pull] rebase = false
Found on 2024-01-07 12:13320 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-12-11 12:32235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2024-01-31 19:11
Open for 502 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2024-01-31 19:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2024-01-31 19:11
Open for 502 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2024-01-31 19:11
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-11-19 20:45-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-11-19 20:45235 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: journalpublisher-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://journalpublisher-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-11-19 20:45-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-11-19 20:45235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-17 02:16
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2023-11-17 02:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-06 05:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 23:36
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 23:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-06 04:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 23:01
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 23:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-06 03:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 22:52
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 22:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-10-30 17:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 22:52
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 22:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-10-23 17:57301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-10-23 17:57301 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.churchannouncementsolutions.com
Port: 80
URL: http://mail.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2023-09-20 17:53
Open for 368 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 18:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: churchannouncementsolutions.com
Port: 80
URL: http://churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2023-09-20 17:53
Open for 368 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 18:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.churchannouncementsolutions.com
Port: 80
URL: http://www.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2023-09-20 17:53
Open for 368 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 18:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-09-19 18:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowetrails-org.stowe-trails.com
Port: 80
URL: http://stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowemountainbike.stowe-trails.com
Port: 80
URL: http://stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-08-15 18:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowemountainbike.stowe-trails.com
Port: 80
URL: http://www.stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-08-15 18:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-07-21 18:04
Open for 245 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-07-21 18:04
Open for 245 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-07-21 18:04
Open for 245 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2023-03-21 18:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowetrails-org.stowe-trails.com
Port: 80
URL: http://www.stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.todayisthedaylifestyle.com
Port: 443
URL: https://www.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2023-03-20 19:31
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.todayisthedaylifestyle.com
Port: 443
URL: https://mail.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2023-03-20 19:31
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: todayisthedaylifestyle.com
Port: 443
URL: https://todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2023-03-20 19:31
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2023-03-20 18:23
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2023-03-20 18:23
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2023-03-20 18:23
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.agua.cordilleracentral.cl
Port: 443
URL: https://www.agua.cordilleracentral.clFirst seen 2022-09-16 18:19
Last seen 2023-03-19 18:08
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: agua.cordilleracentral.cl
Port: 443
URL: https://agua.cordilleracentral.clFirst seen 2022-09-16 18:18
Last seen 2023-03-19 18:08
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.andyrobinetguitar.com
Port: 80
URL: http://mail.andyrobinetguitar.comFirst seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetguitar.androidrobotproductions.com
Port: 80
URL: http://andyrobinetguitar.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetguitar.androidrobotproductions.com
Port: 80
URL: http://www.andyrobinetguitar.androidrobotproductions.comFirst seen 2023-01-16 19:10
Last seen 2023-03-19 17:53
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2023-01-16 19:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerpublications.com
Port: 443
URL: https://www.springerpublications.comFirst seen 2023-03-08 19:20-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222bfb54be[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ebookpublisher/springerpublications-as-dradamconsultancy.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-03-08 19:20260 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.achronicentrepreneur.com
Port: 80
URL: http://mail.achronicentrepreneur.comFirst seen 2022-10-13 18:10
Last seen 2023-02-12 18:48
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-13 18:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 19:02
Last seen 2023-01-30 20:21
Open for 10 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9db7f4c636b7f4c636b7f4c636b7f4c636Found 1 files trough .DS_Store spidering: /images
Found on 2023-01-20 19:02
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-01-20 19:20
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-01-20 19:20
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-01-20 19:20
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2023-01-20 19:03
Open for 126 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2023-01-20 19:03
Open for 126 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 19:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9db7f4c636b7f4c636b7f4c636b7f4c636Found 1 files trough .DS_Store spidering: /images
Found on 2023-01-20 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2023-01-18 19:25
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2023-01-18 19:25
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2023-01-17 19:52
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2023-01-17 19:52
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2023-01-17 19:52
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:41
Last seen 2023-01-17 19:48
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.portugalexperience.com
Port: 80
URL: http://www.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2023-01-17 19:48
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.portugalexperience.com
Port: 80
URL: http://mail.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2023-01-17 19:48
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.orchardhillschristianacademy.com
Port: 80
URL: http://www.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2023-01-17 19:45
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: orchardhillschristianacademy.com
Port: 80
URL: http://orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2023-01-17 19:45
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.orchardhillschristianacademy.com
Port: 80
URL: http://mail.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2023-01-17 19:45
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.nontribaleconomics.com
Port: 80
URL: http://www.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2023-01-17 19:44
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.nontribaleconomics.com
Port: 80
URL: http://mail.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2023-01-17 19:44
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:34
Last seen 2023-01-17 19:44
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2023-01-17 19:38
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2022-09-16 19:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2023-01-17 19:34
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-17 19:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2023-01-17 19:34
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-17 19:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2023-01-17 19:34
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-17 19:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.agua.cordilleracentral.cl
Port: 80
URL: http://www.agua.cordilleracentral.clFirst seen 2022-09-16 18:19
Last seen 2023-01-16 19:16
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:19
Last seen 2023-01-16 19:16
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenhoa.org
Port: 80
URL: http://www.charbonneaugreenhoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenhoa.org
Port: 80
URL: http://mail.charbonneaugreenhoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenshoa.org
Port: 80
URL: http://mail.charbonneaugreenshoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenshoa.org
Port: 80
URL: http://www.charbonneaugreenshoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivate.zbo.pfi.mybluehost.me
Port: 80
URL: http://www.clarivate.zbo.pfi.mybluehost.meFirst seen 2022-11-24 19:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652230364a84[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications-as-papertrue.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-24 19:35248 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: clarivate.zbo.pfi.mybluehost.me
Port: 80
URL: http://clarivate.zbo.pfi.mybluehost.meFirst seen 2022-11-24 19:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652230364a84[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications-as-papertrue.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-24 19:35248 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.dissertationshark.co.uk
Port: 443
URL: https://www.dissertationshark.co.ukFirst seen 2022-11-22 17:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652237e467b1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/dissertationshark-as-researchwriting.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 17:35250 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.dissertationshark-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.dissertationshark-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 17:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652237e467b1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/dissertationshark-as-researchwriting.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 17:35250 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.todayisthedaylifestyle.com
Port: 80
URL: http://www.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2022-11-17 20:19
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: todayisthedaylifestyle.com
Port: 80
URL: http://todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2022-11-17 20:19
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.todayisthedaylifestyle.com
Port: 80
URL: http://mail.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2022-11-17 20:19
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2022-11-17 20:18
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2022-11-17 19:53
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2022-09-16 19:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2022-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2022-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2022-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2022-11-17 19:43
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2022-11-17 19:43
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2022-11-17 19:43
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2022-11-17 19:21
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2022-11-17 19:21
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.androidrobotproductions.com
Port: 80
URL: http://www.androidrobotproductions.comFirst seen 2022-11-16 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: androidrobotproductions.com
Port: 80
URL: http://androidrobotproductions.comFirst seen 2022-11-16 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.androidrobotproductions.com
Port: 80
URL: http://mail.androidrobotproductions.comFirst seen 2022-11-16 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.allnaturalrepellent.com
Port: 80
URL: http://www.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2022-11-16 19:27
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:52
Last seen 2022-11-16 19:27
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.allnaturalrepellent.com
Port: 80
URL: http://mail.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2022-11-16 19:27
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.sundayafternoonblog.com
Port: 443
URL: https://mail.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.sundayafternoonblog.com
Port: 80
URL: http://mail.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.sundayafternoonblog.com
Port: 80
URL: http://www.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.sundayafternoonblog.com
Port: 443
URL: https://www.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:24-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 17:54
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.api-epaper.parichoy.com
Port: 80
URL: http://www.api-epaper.parichoy.comFirst seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.api-epaper.parichoy.com
Port: 443
URL: https://www.api-epaper.parichoy.comFirst seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Open service 162.241.226.40:443 · website-8380379f.hjy.jyk.mybluehost.me
2024-11-03 01:58
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:58:45 GMT Server: Apache Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Retry-After: 600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://smalimousine.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qru.jgb.mybluehost.me
2024-11-03 01:58
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:58:24 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://premics.com/xmlrpc.php X-Redirect-By: WordPress Location: https://premics.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: lp_session_guest=g-6726d8c02598f; expires=Tue, 05 Nov 2024 01:58:24 GMT; Max-Age=172800; path=/; secure; HttpOnly
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.eliece.com
2024-11-03 01:58
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:58:23 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eliece.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.salishseadiatoms.com
2024-11-03 01:57
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:57:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://salishseadiatoms.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:57:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-2e15c7d2.yourstudydoctor.com
2024-11-03 01:57
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.galenetherapy.com
2024-11-03 01:57
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.zul.uqp.mybluehost.me
2024-11-03 01:57
HTTP/1.1 302 Found Date: Sun, 03 Nov 2024 01:57:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.zul.uqp.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.zul.uqp.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.zul.uqp.mybluehost.me
2024-11-03 01:57
HTTP/1.1 302 Found Date: Sun, 03 Nov 2024 01:57:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://mail.zul.uqp.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.zul.uqp.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · neighboravenue.com
2024-11-03 01:57
HTTP/1.1 302 Found Date: Sun, 03 Nov 2024 01:57:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=iso-8859-1 Content-Length: 236 Location: https://neighboravenue.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://neighboravenue.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.andyrobinetguitar.androidrobotproductions.com
2024-11-03 01:56
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:56:59 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.politics.nnhsclubs.com
2024-11-03 01:56
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:56:27 GMT Server: Apache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Location: https://politics.nnhsclubs.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 02:01:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lightsoutbbq.com
2024-11-03 01:55
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:55:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.lightsoutbbq.com/wp-json/>; rel="https://api.w.org/", <https://www.lightsoutbbq.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PaJkF4-4>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 02:00:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thewholepetdiet.jkcornett.com
2024-11-03 01:55
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:55:36 GMT Server: Apache X-Pingback: https://www.thewholepetdiet.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.thewholepetdiet.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.harryvourtsis.com
2024-11-03 01:55
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:55:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.harryvourtsis.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:55:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.alisongifford.yourstudydoctor.com
2024-11-03 01:55
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.onwhatwings.com
2024-11-03 01:55
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:55:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: on what wings — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>on what wings — Coming Soon</title> <script src="https://onwhatwings.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://onwhatwings.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.11" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://onwhatwings.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kimberlysdesignstudio.com
2024-11-03 01:54
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:55:01 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kimberlysdesignstudio.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:55:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sunmul-gift.sunmulgift.com
2024-11-03 01:54
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:54:55 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.sunmul-gift.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:54:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ksnartistry.com
2024-11-03 01:54
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:54:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ksnartistry.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:54:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.hollybrunelle.com
2024-11-03 01:53
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:53:40 GMT Server: Apache Link: <https://www.hollybrunelle.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.churchannouncementsolutions.com
2024-11-03 01:53
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:53:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <!DOCTYPE html> <html class="sp-html sp-is-mobile sp-seedprod sp-h-full" lang="en-US"> <head> <!-- Open Graph --> <meta property="og:url" content="https://mail.churchannouncementsolutions.com/" /> <meta property="og:type" content="website" /> <!-- Twitter Card --> <meta name="twitter:card" content="summary" /> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <!-- Default CSS --> <link rel='stylesheet' id='seedprod-css-css' href='https://www.churchannouncementsolutions.com/wp-content/plugins/coming-soon/public/css/tailwind.min.css?ver=6.9.0.8' type='text/css' media='all' /> <link rel='stylesheet' id='seedprod-fontawesome-css' href='https://www.churchannouncementsolutions.com/wp-content/plugins/coming-soon/public/fontawesome/css/all.min.css?ver=6.9.0.8' type='text/css' media='all' /> <!-- Google Font --> <link rel="stylesheet" href="https://fonts.googleapis.com/css?family=Inter:400,700&display=swap"> <!-- Global Styles --> <style> #sp-page{color:rgba(255, 255, 255, 0.75)} #sp-page .sp-header-tag-h1,#sp-page .sp-header-tag-h2,#sp-page .sp-header-tag-h3,#sp-page .sp-header-tag-h4,#sp-page .sp-header-tag-h5,#sp-page .sp-header-tag-h6{color:#FFFFFF}#sp-page h1,#sp-page h2,#sp-page h3,#sp-page h4,#sp-page h5,#sp-page h6{color:#FFFFFF; font-family:'Inter';font-weight:700;font-style:normal} #sp-page a{color:#FBD00F} #sp-page a:hover{color:#d3ae04}#sp-page .btn{background-color:#FBD00F}body{background-color:undefined; background-image:url('https://assets.seedprod.com/93-7v88vkr23q3ujpcp.jpg');} @media only screen and (max-width: 480px) { } @media only screen and (min-width: 480px) { } </style> <!-- JS --> <script> </script> <script src="https://www.churchannouncementsolutions.com/wp-content/plugins/coming-soon/public/js/sp-scripts.min.js" defer></script> <script src="https://www.churchannouncementsolutions.com/wp-includes/js/jquery/jquery.min.js"></script> </head> <body class="spBgcover sp-h-full sp-antialiased sp-bg-slideshow"> <div id="sp-page" class="spBgcover sp-content-4" style="background-image: url('https://assets.seedprod.com/93-7v88vkr23q3ujpcp.jpg'); font-family: Inter, sans-serif; font-weight: 400;"><section id="sp-ckzdoppede1" class="sp-el-section spBgcover" style="width: 100%; max-width: 100%; padding: 10px;"><div id="sp-rahpdx4qbt4v" class="sp-el-row sm:sp-flex sp-w-full sp-m-auto spBgcover sp-justify-between" style="padding: 10px; width: auto; max-width: 1000px;"><div id="sp-nlys3wrlqsuq" class="sp-el-col spBgcover sp-w-full" style="width: calc(50% - 0px);"><h1 id="sp-wxi918kaufaj" class="sp-css-target sp-el-block sp-headline-block-wxi918kaufaj sp-type-header" style="font-size: 60px; text-align: left; margin: 0px;">We are <br>Coming Soon</h1></div><div id="sp-sysknox8r1l" class="sp-el-col spBgcover sp-w-full" style="width: calc(50% - 0px);"></div></div></section></div> <div class="tv"> <div class="screen mute" id="tv"></div> </div> <script> var sp_is_mobile = true; </script> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.perspectivesireland.ie
2024-11-03 01:53
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:53:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://www.perspectivesireland.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.perspectivesireland.com%2F; expires=Sun, 01 Dec 2024 01:53:07 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: PHPSESSID=b5db635d61416cc057e3b4a8d8051180; path=/
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cstalks.org
2024-11-03 01:52
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:52:47 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cstalks.org/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:57:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lusty-store.keyawagroup.com
2024-11-03 01:52
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:52:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://lusty-store.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:52:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qru.jgb.mybluehost.me
2024-11-03 01:52
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:52:25 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://premics.com/xmlrpc.php X-Redirect-By: WordPress Location: https://premics.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: lp_session_guest=g-6726d75883aa0; expires=Tue, 05 Nov 2024 01:52:24 GMT; Max-Age=172800; path=/; secure; HttpOnly
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.eliece.com
2024-11-03 01:52
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:52:23 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eliece.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mavila.pe
2024-11-03 01:52
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:52:20 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://mavila.pe/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Frame-Options: ALLOW-FROM https://mavila.pe/ Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.springerspublications.co.uk
2024-11-03 01:51
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:51:21 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Set-Cookie: PHPSESSID=b5c316a801284f30ed99a90239dbd659; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.nutu.at
2024-11-03 01:51
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:51:13 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://nutu.at/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tlk.rfl.mybluehost.me
2024-11-03 01:51
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:51:02 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:51:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://geogroupcorrections.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://geogroupcorrections.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://geogroupcorrections.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-e95c4881.ane.pzr.mybluehost.me
2024-11-03 01:50
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:51:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rachana.io/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:51:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-69d89cfd.vmr.arb.mybluehost.me
2024-11-03 01:49
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:49:50 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://erinkdaniel.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:49:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.afaqhomeschool.dynamicsmachines.com
2024-11-03 01:49
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:49:07 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://afaqhomeschool.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · 66days.co
2024-11-03 01:48
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:48:43 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://66days.co/wp-json/>; rel="https://api.w.org/", <https://66days.co/wp-json/wp/v2/pages/14>; rel="alternate"; type="application/json", <https://66days.co/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:48:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kpb.goj.mybluehost.me
2024-11-03 01:48
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:48:36 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: nfdbrandname=BlueHost; expires=Wed, 01 Nov 2034 01:48:37 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://nathaliewallcoaching.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:48:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lkk.shn.mybluehost.me
2024-11-03 01:48
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:48:37 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.partnersdigitalmarketing.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.partnersdigitalmarketing.com
2024-11-03 01:48
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:48:34 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.partnersdigitalmarketing.com/wp-json/>; rel="https://api.w.org/", <https://www.partnersdigitalmarketing.com/wp-json/wp/v2/pages/34>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/P8ZgEF-y>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · uppercrustvegan.com
2024-11-03 01:48
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:48:31 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 82408 Vary: User-Agent,Accept-Encoding Accept-Ranges: bytes Cache-Control: max-age=7200, public Expires: Sun, 03 Nov 2024 03:48:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Powered-By: WP Rocket/3.15.4 X-Server-Cache: true X-Proxy-Cache: MISS Page title: Globally-inspired recipes for vegan baked goods & more. - Upper Crust Vegan <!DOCTYPE html> <html lang="en-US"> <head > <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v23.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Globally-inspired recipes for vegan baked goods & more. - Upper Crust Vegan</title> <link rel="canonical" href="https://uppercrustvegan.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Globally-inspired recipes for vegan baked goods & more. - Upper Crust Vegan" /> <meta property="og:description" content="Food is an expression of creativity and culture, and I don’t like to miss out while traveling as a vegan. This site is a growing compilation of recipes I’ve collected on my travels and tweaked to suit plant-based gourmets. Fall and Winter Recipes Cozy, comforting recipes for the winter season, including Thanksgiving, Christmas, and the..." /> <meta property="og:url" content="https://uppercrustvegan.com/" /> <meta property="og:site_name" content="Upper Crust Vegan" /> <meta property="article:modified_time" content="2023-10-16T23:34:10+00:00" /> <meta property="og:image" content="https://uppercrustvegan.com/wp-content/uploads/2023/10/main-upper-crust-vegan-logo-1200-1200.jpg" /> <meta property="og:image:width" content="1200" /> <meta property="og:image:height" content="1200" /> <meta property="og:image:type" content="image/jpeg" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://uppercrustvegan.com/","url":"https://uppercrustvegan.com/","name":"Globally-inspired recipes for vegan baked goods & more. - Upper Crust Vegan","isPartOf":{"@id":"http://hgu.aqd.mybluehost.me/#website"},"about":{"@id":"http://hgu.aqd.mybluehost.me/#organization"},"primaryImageOfPage":{"@id":"https://uppercrustvegan.com/#primaryimage"},"image":{"@id":"https://uppercrustvegan.com/#primaryimage"},"thumbnailUrl":"https://i0.wp.com/uppercrustvegan.com/wp-content/uploads/2023/10/main-upper-crust-vegan-logo-1200-1200.jpg?fit=1200%2C1200&ssl=1","datePublished":"2023-10-14T16:24:49+00:00","dateModified":"2023-10-16T23:34:10+00:00","breadcrumb":{"@id":"https://uppercrustvegan.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://uppercrustvegan.com/"]}]},{"@type":"ImageObject","inLanguage":"en-US","@id":"https://uppercrustvegan.com/#primaryimage","url":"https://i0.wp.com/uppercrustvegan.com/wp-content/uploads/2023/10/main-upper-crust-vegan-logo-1200-1200.jpg?fit=1200%2C1200&ssl=1","contentUrl":"https://i0.wp.com/uppercrustvegan.com/wp-content/uploads/2023/10/main-upper-crust-vegan-logo-1200-1200.jpg?fit=1200%2C1200&ssl=1","width":1200,"height":1200,"caption":"main-upper-crust-vegan-logo-1200-1200"},{"@type":"BreadcrumbList","@id":"https://uppercrustvegan.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"http://hgu.aqd.mybluehost.me/#website","url":"http://hgu.aqd.mybluehost.me/","name":"Upper Crust Vegan","description":"Globally-inspired recipes for vegan baked goods.","publisher":{"@id":"http://hgu.aqd.mybluehost.me/#organization"},"potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"http://hgu.aqd.mybluehost.me/?s={search_term_string}"},"query-input":{"@type":"PropertyValueSpecification","valueRequired":true,"valueName":"search_term_string"}}],"inLanguage":"en-US"},{"@type":"Organization","@id":"http://hgu.aqd.mybluehost.me/#organization","name":"Upper Crust Vegan","url":"http://hgu.aqd.mybluehost.me/","logo":{"@type":"ImageObject","inLanguage":"en-US","@id":"http://hgu.aqd.mybluehost.me/#/schema/logo/image/","url":"https://i0.wp.com/uppercrustvegan.com/wp-content/uploads/2023/09/upper-Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cotapult.com
2024-11-03 01:47
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:47:59 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:52:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Cotapult Pte Ltd — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Cotapult Pte Ltd — Coming Soon</title> <script src="https://cotapult.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cotapult.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cotapult.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wundexperte-koeln.de
2024-11-03 01:47
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:47:56 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wundexperte-koeln.de/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:47:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.doulosapologetics.com
2024-11-03 01:47
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:47:43 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://doulosapologetics.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:47:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ien.klr.mybluehost.me
2024-11-03 01:47
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:47:39 GMT Server: Apache Link: <https://andersenlandscaping.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://andersenlandscaping.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://andersenlandscaping.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.greenlightservices-us.aeroventuresllc.com
2024-11-03 01:47
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:47:08 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://greenlightservices.us/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · printec.sg
2024-11-03 01:44
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:44:58 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://printec.sg/wp-json/>; rel="https://api.w.org/", <https://printec.sg/wp-json/wp/v2/pages/1263>; rel="alternate"; type="application/json", <https://printec.sg/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.brusselsbeachhouse.com
2024-11-03 01:44
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:44:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://brusselsbeachhouse.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:44:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.stowetrails-org.stowe-trails.com
2024-11-03 01:44
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:44:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:44:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.vipseniorbenefits.myutahmedicareplans.com
2024-11-03 01:43
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:43:45 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://vipseniorbenefits.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · edn.lef.mybluehost.me
2024-11-03 01:43
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:43:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://grettabevis.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:43:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.whooi.mwz.rrh.mybluehost.me
2024-11-03 01:43
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:43:06 GMT Server: Apache X-LiteSpeed-Tag: ee5_HTTP.200,ee5_HTTP.301 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.whooi.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:43:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.lawnrangermi.com
2024-11-03 01:42
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:42:48 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://lawnrangermi.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://lawnrangermi.com/index.php?rest_route=/wp/v2/pages/11>; rel="alternate"; title="JSON"; type="application/json", <https://lawnrangermi.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · bqh.vtl.mybluehost.me
2024-11-03 01:42
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:42:48 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:42:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Dr Alex Q. Chen — Coming Soon <!DOCTYPE html> <html lang="en-GB"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Dr Alex Q. Chen — Coming Soon</title> <script src="https://bqh.vtl.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bqh.vtl.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bqh.vtl.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-0e80c00c.sju.aef.mybluehost.me
2024-11-03 01:41
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:41:28 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://voge.pe/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Frame-Options: ALLOW-FROM https://voge.pe/ Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.zhane.space
2024-11-03 01:41
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:41:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zhane.space/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:41:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · rln.bur.mybluehost.me
2024-11-03 01:41
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:41:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Strict-Transport-Security: max-age=31536000; X-XSS-Protection: 0 X-Content-Type-Options: nosniff Referrer-Policy: strict-origin-when-cross-origin Content-Security-Policy: upgrade-insecure-requests; Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://phoenixdpi.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:41:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · frkplant-net.sunpringextruder.com
2024-11-03 01:40
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:40:40 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://frkplant.net/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:40:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tct.jwp.mybluehost.me
2024-11-03 01:39
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:39:54 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zachcomputerservices.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:39:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.silverpoint-development.com
2024-11-03 01:39
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:39:35 GMT Server: Apache X-Pingback: https://silverpoint-development.com/xmlrpc.php Link: <https://silverpoint-development.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://silverpoint-development.com/index.php?rest_route=/wp/v2/pages/3744>; rel="alternate"; title="JSON"; type="application/json", <https://silverpoint-development.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mayaelchuco.com
2024-11-03 01:39
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:39:43 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://mayaelchuco.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:39:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · badgesoffraud.com
2024-11-03 01:39
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:39:06 GMT Server: Apache Link: <https://badgesoffraud.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://badgesoffraud.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://badgesoffraud.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ttw.nqg.mybluehost.me
2024-11-03 01:38
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:39:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ttw.nqg.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:39:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.globaltravelescapades.com
2024-11-03 01:37
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:37:52 GMT Server: Apache Content-Security-Policy: block-all-mixed-content Expires: Sun, 03 Nov 2024 02:37:52 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://globaltravelescapades.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · heaveninordinary.com
2024-11-03 01:37
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:37:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://heaveninordinary.com/wp-json/>; rel="https://api.w.org/", <https://heaveninordinary.com/wp-json/wp/v2/pages/648>; rel="alternate"; title="JSON"; type="application/json", <https://heaveninordinary.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:37:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.willow.ae
2024-11-03 01:37
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:37:08 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://willow.ae/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · aps.fts.mybluehost.me
2024-11-03 01:36
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:36:52 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:36:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://thejedipath.store/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thejedipath.store/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thejedipath.store/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.themarketingaigency.mindyourown.life
2024-11-03 01:36
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:36:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://themarketingaigency.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:36:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · pon.lgu.mybluehost.me
2024-11-03 01:36
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:36:10 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:36:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://supermarket2amigosgmail.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://supermarket2amigosgmail.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://supermarket2amigosgmail.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · xut.pyw.mybluehost.me
2024-11-03 01:36
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:36:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://xut.pyw.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:36:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.primepaintingco.com
2024-11-03 01:35
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:35:52 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://primepaintingco.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:35:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thesilvergym.booktipper.com
2024-11-03 01:34
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:34:33 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: nfdbrandname=bluehost; expires=Wed, 01 Nov 2034 01:34:37 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://thesilvergym.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:39:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bowlinefinancial.com
2024-11-03 01:34
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:34:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: b75_HTTP.200,b75_HTTP.301 X-Redirect-By: WordPress Location: https://bowlinefinancial.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:34:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · merakimortgage.com
2024-11-03 01:34
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:34:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 136968 Last-Modified: Mon, 20 May 2024 17:30:09 GMT Accept-Ranges: bytes Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS Page title: Home - Meraki Mortgage <!DOCTYPE html> <html class="html" lang="en-US"> <head><style>img.lazy{min-height:1px}</style><link rel="preload" href="https://merakimortgage.com/wp-content/plugins/w3-total-cache/pub/js/lazyload.min.js" as="script"> <meta charset="UTF-8"> <link rel="profile" href="https://gmpg.org/xfn/11"> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <meta name="viewport" content="width=device-width, initial-scale=1"> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Home - Meraki Mortgage</title> <link rel="canonical" href="https://merakimortgage.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Home - Meraki Mortgage" /> <meta property="og:description" content="Meraki Mortgage Previous Next Residential Mortgage and Real Estate With over 18 years of experience, we have assisted hundreds of Californians with residential and commercial mortgages. We take the time to learn about each client and search multiple banks for competitive rates. No matter your situation, we’re ready to match you with the right loan! […]" /> <meta property="og:url" content="https://merakimortgage.com/" /> <meta property="og:site_name" content="Meraki Mortgage" /> <meta property="article:modified_time" content="2021-05-06T06:22:01+00:00" /> <meta property="og:image" content="https://i0.wp.com/merakimortgage.com/wp-content/uploads/2020/04/Jocelyn-DeGuzman-1-scaled-e1587328066562.jpg?fit=1707%2C1888&ssl=1" /> <meta property="og:image:width" content="1707" /> <meta property="og:image:height" content="1888" /> <meta property="og:image:type" content="image/jpeg" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://merakimortgage.com/","url":"https://merakimortgage.com/","name":"Home - Meraki Mortgage","isPartOf":{"@id":"https://merakimortgage.com/#website"},"about":{"@id":"https://merakimortgage.com/#/schema/person/ab72d9efd7a394579555ac94fd505ebb"},"primaryImageOfPage":{"@id":"https://merakimortgage.com/#primaryimage"},"image":{"@id":"https://merakimortgage.com/#primaryimage"},"thumbnailUrl":"https://i0.wp.com/merakimortgage.com/wp-content/uploads/2020/04/Jocelyn-DeGuzman-1-scaled-e1587328066562.jpg?fit=1707%2C1888&ssl=1","datePublished":"2016-10-25T15:19:54+00:00","dateModified":"2021-05-06T06:22:01+00:00","breadcrumb":{"@id":"https://merakimortgage.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://merakimortgage.com/"]}]},{"@type":"ImageObject","inLanguage":"en-US","@id":"https://merakimortgage.com/#primaryimage","url":"https://i0.wp.com/merakimortgage.com/wp-content/uploads/2020/04/Jocelyn-DeGuzman-1-scaled-e1587328066562.jpg?fit=1707%2C1888&ssl=1","contentUrl":"https://i0.wp.com/merakimortgage.com/wp-content/uploads/2020/04/Jocelyn-DeGuzman-1-scaled-e1587328066562.jpg?fit=1707%2C1888&ssl=1","width":1707,"height":1888},{"@type":"BreadcrumbList","@id":"https://merakimortgage.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://merakimortgage.com/#website","url":"https://merakimortgage.com/","name":"Meraki Mortgage","description":"Residential and Commercial Mortgages","publisher":{"@id":"https://merakimortgage.com/#/schema/person/ab72d9efd7a394579555ac94fd505ebb"},"potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://merakimortgage.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"},{"@type":["Person","Organization"],"@id":"https://merakimortgage.com/#/schema/person/ab72d9efd7a394579555ac94fd505ebb","name":"Jocelyn DeGuzman","image":{"@type":"ImageObject","inLanguage":"en-US","@id":"https://merakimortgage.com/#/schema/person/image/","url":"https://i0.wp.com/merakimoFound 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mgp.zyv.mybluehost.me
2024-11-03 01:33
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:33:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:33:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://yanbenotmane.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://yanbenotmane.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://yanbenotmane.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · businessclub.dynamicsmachines.com
2024-11-03 01:33
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:33:41 GMT Server: Apache Link: <https://businessclub.dynamicsmachines.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mavila.pe
2024-11-03 01:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:33:43 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://mavila.pe/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Frame-Options: ALLOW-FROM https://mavila.pe/ Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.happy-houseplants.com
2024-11-03 01:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:33:43 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://happy-houseplants.com/xmlrpc.php Expires: Sun, 03 Nov 2024 02:33:43 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://happy-houseplants.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.plansformoms.com
2024-11-03 01:33
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:33:28 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:33:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://plansformoms.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://plansformoms.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://plansformoms.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kmi.aqd.mybluehost.me
2024-11-03 01:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:33:13 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://expressfundr.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:33:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.zhane.space
2024-11-03 01:32
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:33:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zhane.space/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:32:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.williammazza.com
2024-11-03 01:32
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:32:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://williammazza.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:32:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · sizzlesalsyoutube.com
2024-11-03 01:31
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:31:32 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://sizzlesalsyoutube.com/wp-json/>; rel="https://api.w.org/", <https://sizzlesalsyoutube.com/wp-json/wp/v2/pages/2022>; rel="alternate"; title="JSON"; type="application/json", <https://sizzlesalsyoutube.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:31:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · gwl.oqp.mybluehost.me
2024-11-03 01:30
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:30:22 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.dogsoflife.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lawnrangermi.com
2024-11-03 01:29
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:29:53 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://lawnrangermi.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://lawnrangermi.com/index.php?rest_route=/wp/v2/pages/11>; rel="alternate"; title="JSON"; type="application/json", <https://lawnrangermi.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rokaymedia.ca
2024-11-03 01:29
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:29:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://rokaymedia.ca/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:29:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cascadesignaturephotography.com
2024-11-03 01:29
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:29:10 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cascadesignaturephotography.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:29:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · phoenixdpi.com
2024-11-03 01:28
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:28:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-XSS-Protection: 0 X-Content-Type-Options: nosniff Referrer-Policy: strict-origin-when-cross-origin Content-Security-Policy: upgrade-insecure-requests; Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://phoenixdpi.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:28:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.dynamic-rr.com
2024-11-03 01:28
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:28:27 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.dynamic-rr.com/wp-json/>; rel="https://api.w.org/", <https://www.dynamic-rr.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.dynamic-rr.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:33:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.alcyonespace.com
2024-11-03 01:28
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:28:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:28:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://alcyonespace.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alcyonespace.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alcyonespace.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.theirsilentscreams.alvinwayneweiss.com
2024-11-03 01:28
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:28:04 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://theirsilentscreams.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.theaboutsports.com
2024-11-03 01:26
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:26:51 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 cache-control: private, max-age=0, must-revalidate, no-cache, no-store display: pub_site_sol expires: Sat, 02 Nov 2024 01:26:51 GMT link: <https://www.sportsierra.com/wp-json/>; rel="https://api.w.org/" pagespeed: off vary: Accept-Encoding x-middleton-display: pub_site_sol x-sol: pub_site x-ua-compatible: IE=edge host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS set-cookie: ezoictest=stable; Path=/; Domain=ezoic.net; Expires=Sun, 03 Nov 2024 01:56:51 GMT; HttpOnly Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.catheryngrivna.com
2024-11-03 01:26
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:26:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://www.catheryngrivna.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=f0dd8ab883dfd6c7edcd30ec5ad42383; path=/ Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.catheryngrivna.com%2F; expires=Sun, 01-Dec-2024 01:26:20 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thinkdigitalmatter.com
2024-11-03 01:26
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:26:15 GMT Server: Apache Link: <https://www.thinkdigitalmatter.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.thinkdigitalmatter.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.thinkdigitalmatter.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: DigitalMatter LLC – the structure and properties of matter <!DOCTYPE html> <html lang="en-US" class="no-js"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <link rel="profile" href="https://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.thinkdigitalmatter.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.thinkdigitalmatter.com/wp-content/themes/twentyfifteen/js/html5.js?ver=3.7.0"></script> <![endif]--> <script>(function(html){html.className = html.className.replace(/\bno-js\b/,'js')})(document.documentElement);</script> <title>DigitalMatter LLC – the structure and properties of matter</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link href='https://fonts.gstatic.com' crossorigin rel='preconnect' /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Feed" href="https://www.thinkdigitalmatter.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Comments Feed" href="https://www.thinkdigitalmatter.com/?feed=comments-rss2" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.thinkdigitalmatter.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · justingolding.com
2024-11-03 01:25
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:25:59 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://justingolding.com/wp-json/>; rel="https://api.w.org/", <https://justingolding.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/ParJX1-4>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mr-quackersartistry.com
2024-11-03 01:25
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:25:12 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://mr-quackersartistry.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jennayoungconsulting.com
2024-11-03 01:25
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:25:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://jennayoungconsulting.com/ Cache-Control: max-age=28800 Expires: Sun, 03 Nov 2024 09:25:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fjennayoungconsulting.com%2F; expires=Sun, 01 Dec 2024 01:25:07 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.neighboravenue.com
2024-11-03 01:24
HTTP/1.1 302 Found Date: Sun, 03 Nov 2024 01:24:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=iso-8859-1 Content-Length: 240 Location: https://www.neighboravenue.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.neighboravenue.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vsj.tdd.mybluehost.me
2024-11-03 01:24
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:24:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://krishmorgan.com/xmlrpc.php X-Redirect-By: WordPress Location: https://krishmorgan.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:24:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.melissarevels.com
2024-11-03 01:23
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:23:52 GMT Server: Apache Link: <https://melissarevels.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://melissarevels.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Melissa Revels <!DOCTYPE html> <!--[if IE 6]> <html id="ie6" lang="en-US"> <![endif]--> <!--[if IE 7]> <html id="ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html id="ie8" lang="en-US"> <![endif]--> <!--[if !(IE 6) & !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>Melissa Revels</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://melissarevels.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://melissarevels.com/wp-content/themes/forever/js/html5.js" type="text/javascript"></script> <![endif]--> <link rel='dns-prefetch' href='//melissarevels.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Melissa Revels » Feed" href="https://melissarevels.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Melissa Revels » Comments Feed" href="https://melissarevels.com/?feed=comments-rss2" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/melissarevels.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.3.18"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://melissarevels.com/wp-includes/css/dist/block-library/style.min.css?ver=5.3.18' type='text/css' media='all' /> <link rel='stylesheet' id='SFSImainCss-css' href='https://melissarevels.com/wp-content/plugins/ultimate-social-media-icons/css/sfsi-style.css?ver=2.7.5' type='text/css' media='all' /> <link rel='stylesheet' id='forever-style-css' href='https://melissarevels.coFound 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wiq.jru.mybluehost.me
2024-11-03 01:23
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:23:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://wiq.jru.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:23:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.yrh.nmb.mybluehost.me
2024-11-03 01:23
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:23:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://samicherkaouipublishings.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:23:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.asilverliningcounseling.org
2024-11-03 01:22
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:22:54 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://asilverliningcounseling.org/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:27:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ftj.rdx.mybluehost.me
2024-11-03 01:22
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:22:53 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ftj.rdx.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:22:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.olivetreetales.com
2024-11-03 01:22
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:22:51 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://olivetreetales.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:22:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · slk.bgd.mybluehost.me
2024-11-03 01:22
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:22:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zhane.space/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:22:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.trading.kismetmind.com
2024-11-03 01:22
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:22:21 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trading.kismetmind.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:22:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Ftrading.kismetmind.com%2F; expires=Sun, 01 Dec 2024 01:22:21 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mxx.xng.mybluehost.me
2024-11-03 01:22
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:22:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://mayaelchuco.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:22:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.gustordonez.keyawagroup.com
2024-11-03 01:21
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:22:00 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:22:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Blog de Gustavo — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <title> Blog de Gustavo — Coming Soon </title> <meta name="robots" content="noindex, nofollow" /> <script src="https://gustordonez.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url("https://gustordonez.com/wp-content/plugins/bluehost-wordpress-plugin/static/images/cs-bluehost-bg.jpg"); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom: 0; left: 0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important;Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wordxpressllc.kishafreed.com
2024-11-03 01:21
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:21:38 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://wordxpressllc.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:26:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · old.foodmarketgypsy.com
2024-11-03 01:21
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · xvb.fts.mybluehost.me
2024-11-03 01:20
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:20:22 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://adroitlivingtp.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:20:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.martinispickleball.com
2024-11-03 01:20
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:20:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://martinispickleball.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:20:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.texassigningservices.com
2024-11-03 01:19
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:19:55 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://texassigningservices.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:19:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.gti.etu.mybluehost.me
2024-11-03 01:19
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:19:51 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://christinesstylingbags.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:19:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · waterpurifierrental.com
2024-11-03 01:19
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:19:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://waterpurifierrental.com/wp-json/>; rel="https://api.w.org/", <https://waterpurifierrental.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://waterpurifierrental.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:19:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ooa.pvh.mybluehost.me
2024-11-03 01:18
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:19:01 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://brightaiideas.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=153409e237f057115fb55779249dacc5; path=/
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-cab72c0c.ygo.bsd.mybluehost.me
2024-11-03 01:18
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:18:33 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:18:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: capemayhomeimprovements — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>capemayhomeimprovements — Coming Soon</title> <script src="https://capemayhomeimprovements.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://capemayhomeimprovements.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://capemayhomeimprovements.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.islandaircontrol.com
2024-11-03 01:18
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:18:30 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.islandaircontrol.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.smalimousine.com
2024-11-03 01:18
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:18:30 GMT Server: Apache Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Retry-After: 600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://smalimousine.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lumie.site
2024-11-03 01:17
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:17:37 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://lumie.site/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:17:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · balancebusinesssolution.net
2024-11-03 01:17
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:17:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:17:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Find Your Balance Business Solutions Ltd. — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Find Your Balance Business Solutions Ltd. — Coming Soon</title> <script src="https://balancebusinesssolution.net/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://balancebusinesssolution.net/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://balancebusinesssolution.net/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.lzv.xem.mybluehost.me
2024-11-03 01:17
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:17:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:17:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: TimsWritingPeace — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>TimsWritingPeace — Coming Soon</title> <script src="https://lzv.xem.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lzv.xem.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lzv.xem.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.zain-alemaar.com
2024-11-03 01:16
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:16:57 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://zain-alemaar.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-d20a7248.sunpringextruder.com
2024-11-03 01:16
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:16:42 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://tr.sunpringextruder.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · eidegames.eoj.xmy.mybluehost.me
2024-11-03 01:16
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:16:40 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eidegames.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:16:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jcmagazine.com
2024-11-03 01:16
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:16:32 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://jcmagazine.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-84d10498.qmd.bzx.mybluehost.me
2024-11-03 01:16
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:16:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://pixelscott.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:16:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.dnp.tqp.mybluehost.me
2024-11-03 01:15
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:16:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spicedock.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:15:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yis.oco.mybluehost.me
2024-11-03 01:15
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:15:36 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://boredchickens.space/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:15:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.nrk.hsk.mybluehost.me
2024-11-03 01:15
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:15:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://classwings.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:15:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.msmassagesandacupunctures.com
2024-11-03 01:14
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:14:56 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://msmassagesandacupunctures.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:14:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.alexcriddle.com
2024-11-03 01:14
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:14:41 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alexcriddle.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.dynamicsmachines.com
2024-11-03 01:14
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:14:03 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.dynamicsmachines.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-a93fb326.aps.fts.mybluehost.me
2024-11-03 01:13
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:13:40 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:13:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: outofoffice.business — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>outofoffice.business — Coming Soon</title> <script src="https://outofoffice.business/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://outofoffice.business/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://outofoffice.business/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.qrz.pbv.mybluehost.me
2024-11-03 01:13
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:13:03 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:13:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Luxe Spain Travels — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Luxe Spain Travels — Coming Soon</title> <script src="https://qrz.pbv.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://qrz.pbv.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://qrz.pbv.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kgq.wyy.mybluehost.me
2024-11-03 01:12
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:12:54 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://healthy-queen.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:12:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kidzcomics.com
2024-11-03 01:12
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:12:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kidzcomics.com/wp-json/>; rel="https://api.w.org/", <https://kidzcomics.com/wp-json/wp/v2/pages/26>; rel="alternate"; title="JSON"; type="application/json", <https://kidzcomics.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:12:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.andyrobinetguitar.com
2024-11-03 01:12
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:12:06 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · charbonneaugreenshoa.org
2024-11-03 01:11
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:11:57 GMT Server: Apache X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Strict-Transport-Security: max-age=31536000; includeSubDomains Referrer-Policy: strict-origin-when-cross-origin X-Frame-Options: sameorigin Link: <https://charbonneaugreenshoa.org/index.php?rest_route=/>; rel="https://api.w.org/" Set-Cookie: apbct_timestamp=1730596317; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_site_landing_ts=1730596317; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_page_hits=1; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_cookies_test=%257B%2522cookies_names%2522%253A%255B%2522apbct_timestamp%2522%252C%2522apbct_site_landing_ts%2522%252C%2522apbct_page_hits%2522%255D%252C%2522check_value%2522%253A%2522500f5c6c5c09d8d39b74d6eda453d890%2522%257D; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_site_referer=UNKNOWN; expires=Wed, 06 Nov 2024 01:11:57 GMT; Max-Age=259200; path=/; domain=charbonneaugreenshoa.org; secure; HttpOnly; SameSite=Lax Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.freewebtoonsite.com
2024-11-03 01:11
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:11:56 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://freewebtoonsite.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:11:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.buttnerreisdias.com
2024-11-03 01:11
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:11:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://buttnerreisdias.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:11:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.abundantlovechildrenshome.com
2024-11-03 01:11
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:11:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://abundantlovechildrenshome.com/xmlrpc.php X-Redirect-By: WordPress Location: https://abundantlovechildrenshome.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:11:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · frk-machine.com
2024-11-03 01:11
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:11:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://frk-machine.com/wp-json/>; rel="https://api.w.org/", <https://frk-machine.com/wp-json/wp/v2/pages/17>; rel="alternate"; title="JSON"; type="application/json", <https://frk-machine.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:11:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.bingefreeathlete.com
2024-11-03 01:11
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:11:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://beccathesun.com/xmlrpc.php X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://beccathesun.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:11:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · vhk.hal.mybluehost.me
2024-11-03 01:11
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:11:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:11:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Workplace Healthcare Ltd — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Workplace Healthcare Ltd — Coming Soon</title> <script src="https://vhk.hal.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://vhk.hal.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://vhk.hal.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · healingwithmary.net
2024-11-03 01:10
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:10:55 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:10:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://healingwithmissmary.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://healingwithmissmary.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.13.3" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://healingwithmissmary.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cookingwithkittycat.com
2024-11-03 01:10
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:10:57 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://cookingwithkittycat.com/wp-json/>; rel="https://api.w.org/", <https://cookingwithkittycat.com/wp-json/wp/v2/pages/664>; rel="alternate"; title="JSON"; type="application/json", <https://cookingwithkittycat.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:10:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-63d89594.sunmulgift.com
2024-11-03 01:10
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:10:50 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.taemenkr.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:10:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.zachcomputerservices.com
2024-11-03 01:10
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:10:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zachcomputerservices.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:10:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wamlblog.net
2024-11-03 01:10
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:10:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.wamlblog.net/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:15:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.julietafumberg.iib.jso.mybluehost.me
2024-11-03 01:10
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:10:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.julietafumberg.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:10:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.yorktownday.com
2024-11-03 01:09
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:10:00 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://yorktownday.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:10:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hillts.com
2024-11-03 01:09
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:09:21 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://hillts.com/wp-json/>; rel="https://api.w.org/", <https://hillts.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://hillts.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:09:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.try.ebq.mybluehost.me
2024-11-03 01:09
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:09:11 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.dynamicsmachines.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dynamicsmachines.com
2024-11-03 01:09
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:09:10 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.dynamicsmachines.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ttr.bqv.mybluehost.me
2024-11-03 01:09
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:09:13 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:09:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ttr.bqv.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ttr.bqv.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ttr.bqv.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.xwk.lnl.mybluehost.me
2024-11-03 01:08
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:08:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html> <head> <meta name="viewport" content="width=device-width"> <title>Welcome — Coming Soon</title> <script src="https://aeroventuresusa.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url( "https://aeroventuresusa.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/cs-bluehost-bg.jpg" ); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom:0; left:0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16px; font-size: 11px; top: 2px; } .bh_subscription_widget form .bh-inputs.email input[type="email"] { background-color: #fff; background-image: url( "https://aeroventuresusa.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/icon-email.svg" ); background-position: 10px center; background-repeat: no-repeat; border: 1px solid #5B5B5B; border-radius: 3px; color: #5B5B5B; font-size: 11px; margin-right: 6px; min-width: 300px; padding: 14px 15px 14px 45pFound 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · trading.kismetmind.com
2024-11-03 01:08
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:08:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://trading.kismetmind.com/wp-json/>; rel="https://api.w.org/", <https://trading.kismetmind.com/wp-json/wp/v2/pages/302>; rel="alternate"; title="JSON"; type="application/json", <https://trading.kismetmind.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:08:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Ftrading.kismetmind.com%2F; expires=Sun, 01 Dec 2024 01:08:38 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yrj.ela.mybluehost.me
2024-11-03 01:08
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:08:24 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://yrj.ela.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://yrj.ela.mybluehost.me/wp-json/wp/v2/pages/5002>; rel="alternate"; title="JSON"; type="application/json", <https://yrj.ela.mybluehost.me/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:08:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yrj.ela.mybluehost.me
2024-11-03 01:07
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:07:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://yrj.ela.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:07:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wcag.grettabevis.com
2024-11-03 01:07
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:07:13 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wcag.grettabevis.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:07:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.abatementsolutionslacrosse.com
2024-11-03 01:07
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:07:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.abatementsolutionslacrosse.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:07:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · anisumakenya.co.ke
2024-11-03 01:06
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:07:01 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: 494_HTTP.200 Link: <https://anisumakenya.co.ke/wp-json/>; rel="https://api.w.org/", <https://anisumakenya.co.ke/wp-json/wp/v2/pages/568>; rel="alternate"; title="JSON"; type="application/json", <https://anisumakenya.co.ke/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thesatiricalhousewife.com
2024-11-03 01:06
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:06:10 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:06:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: TheSatiricalHousewife — Coming Soon <!DOCTYPE html><html><head><title>TheSatiricalHousewife — Coming Soon</title><link href='https://fonts.googleapis.com/css?family=Montserrat' rel='stylesheet' type='text/css'><style type='text/css'>body{background-color: #2D2A25;background-image: url( http://images.mojomarketplace.com/images/mojo-landing-bg.jpg );background-position: top right;background-repeat: no-repeat;font-family: 'Montserrat', sans-serif;color: #fff;}a{color: #fff;text-decoration: none;}#wrap{max-width: 900px;margin: 0 auto;}#logo{height: auto;width: 204px;padding: 30px 10px 10px 10px;max-width: 90%;}.cta{background-color: #93C933;color: #35393A;padding: 10px 20px;text-decoration: none;margin: 10px 0;display: inline-block;border-radius: 3px;}.cta:hover{color: #fff;}.content{margin: 5rem 0;font-size: 1.2rem;padding: 0 15px;}.powered-by {text-align: right;padding: 50px;font-size: 12px;}h1 span{color: #93C933;}footer{border-top: 1px solid #333;}footer a:hover{color: #ccc;}footer .col{padding: 10px 4%;display: inline-block;vertical-align: top;max-width: 100%;}footer h2, footer h2 a{color: #93C933;font-size: 1rem;text-decoration: none;}footer ul{list-style: none;padding:0;}footer li{height: 26px;}#what-is-this-content{display:none;position: fixed;top: 50%;left: 50%;margin-top: -200px;margin-left: -200px;width: 300px;height: 200px;background-color: #fff;color: #aaa;padding: 50px;}.btn{display: inline-block;margin-top:50px;text-align:center;padding: 10px 50px; border-radius: 3px;}.green{color: #343537;background: #92c835; /* Old browsers */background: -moz-linear-gradient(top, #92c835 0%, #6d9628 100%); /* FF3.6+ */background: -webkit-gradient(linear, left top, left bottom, color-stop(0%,#92c835), color-stop(100%,#6d9628)); /* Chrome,Safari4+ */background: -webkit-linear-gradient(top, #92c835 0%,#6d9628 100%); /* Chrome10+,Safari5.1+ */background: -o-linear-gradient(top, #92c835 0%,#6d9628 100%); /* Opera 11.10+ */background: -ms-linear-gradient(top, #92c835 0%,#6d9628 100%); /* IE10+ */background: linear-gradient(to bottom, #92c835 0%,#6d9628 100%);filter: progid:DXImageTransform.Microsoft.gradient( startColorstr='#92c835', endColorstr='#6d9628',GradientType=0 ); /* IE6-9 */}#what-is-this-content a{width: 50%;display:inline-block;color: #666;text-align:center;}.footer-actions a{width: 50%; text-align:center; display:inline-block;}.split-content > div:first-of-type{padding-right: 10%;}.split-content > div{width: 40%;display: inline-block;vertical-align: top;padding: 50px 80px 0 0;font-family: Arial;font-weight: lighter;line-height: 1.8rem;}#wrap .highlight{color:#90C534;}@media (max-width: 859px) {.split-content > div{width: 100%;box-sizing: border-box;padding: 5% 20%;}.btn{width: 122px;display:block;margin: 50px auto;}footer .col {width: 100%;box-sizing: border-box;padding: 5%;text-align:center;}}</style></head><body><div id='wrap'><div class='content'><h1>Website Coming Soon</h1><p>This page is used to test the proper operation of your recent <a class='highlight' href='https://www.mojomarketplace.com/explore?utm_source=mojo_wp_plugin&utm_campaign=mojo_wp_plugin&utm_medium=plugin_landing&utm_content=description_link'>MOJO Marketplace</a> installation of WordPress! If you can read this page it means your installation was successful!</p><a class='btn green' href='https://www.thesatiricalhousewife.com/wp-login.php'>Admin Login</a><div class='split-content'><div><h3>Just visiting?</h3><p>The owner of this website is working on making this site awesome. Why not <a class='highlight' href='#' onclick='bookmark();'>bookmark it</a> and come back again later. We are sure you will not be disappointed.</p></div><div><h3>Are you the Site Owner?</h3><p>You should <a class='highlight' href='https://www.thesatiricalhousewife.com/wp-login.php'>login</a> to your WordPress installation and prepare your site for launch.</p><p>To launch your site just click the link in the banner at the top of the screen.</p></div></div></div><footer><div class='col'><h2><a href='https://www.mojomarketplace.com/themes/wordpress?utm_source=mojo_wp_plugin&utm_campaign=mojo_wp_plugin&utm_meFound 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dgk.rts.mybluehost.me
2024-11-03 01:05
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:05:57 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sandiparkhurst.com/ Cache-Control: max-age=28800 Expires: Sun, 03 Nov 2024 09:05:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.magneticminstrel.net
2024-11-03 01:05
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:05:50 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://magneticminstrel.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:05:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.umh.sgg.mybluehost.me
2024-11-03 01:05
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:05:32 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://reaunique.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:05:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bsv.kdq.mybluehost.me
2024-11-03 01:05
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:05:16 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mossbayhall.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hollytoscanini.com
2024-11-03 01:05
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:05:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: hit Cache-Control: max-age=28800 Expires: Sun, 03 Nov 2024 09:05:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-7d613f40.geckographix.ca
2024-11-03 01:04
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:04:48 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:04:48 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://geckographix.ca/website_7d613f40/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://geckographix.ca/website_7d613f40/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://geckographix.ca/website_7d613f40/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · supermartt.xlr.kdb.mybluehost.me
2024-11-03 01:04
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:04:17 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.supermartt.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.vsj.tdd.mybluehost.me
2024-11-03 01:04
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:04:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://krishmorgan.com/xmlrpc.php X-Redirect-By: WordPress Location: https://krishmorgan.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:04:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.newhopecounselingonline.com
2024-11-03 01:04
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:04:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://newhopecounselingonline.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:04:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · christinesstylingbags.com
2024-11-03 01:03
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:04:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://christinesstylingbags.com/wp-json/>; rel="https://api.w.org/", <https://christinesstylingbags.com/wp-json/wp/v2/pages/7>; rel="alternate"; title="JSON"; type="application/json", <https://christinesstylingbags.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:04:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.dietarycafe.sunmulgift.com
2024-11-03 01:03
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:03:43 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.dietarycafe.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:03:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.way.tdd.mybluehost.me
2024-11-03 01:02
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:03:04 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fieldrosaries.org/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:03:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · easybillingrcm.xlr.kdb.mybluehost.me
2024-11-03 01:02
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:02:57 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://easybillingrcm.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · zdk.sco.mybluehost.me
2024-11-03 01:01
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:01:44 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inkfurie.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:01:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wekickitup.com
2024-11-03 01:01
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:01:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://wekickitup.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:01:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vhk.hal.mybluehost.me
2024-11-03 01:01
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:01:27 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://vhk.hal.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:01:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ru.sunpringextruder.com
2024-11-03 01:01
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:01:04 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ru.sunpringextruder.com/ Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 01:01:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-486dc152.thinkdigitalmatter.com
2024-11-03 01:00
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 01:00:54 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:00:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Lereveluxury.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Lereveluxury.com — Coming Soon</title> <script src="https://lereveluxury.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lereveluxury.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lereveluxury.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wamlblog.net
2024-11-03 01:00
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:00:52 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.wamlblog.net/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:05:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-97cb9c6b.yrj.ela.mybluehost.me
2024-11-03 01:00
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 01:00:41 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alphacornersglobal.tech/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 03:00:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.wealthygen.com
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:50 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://wealthygen.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:59:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · iamdrcole.com
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:49 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Pingback: https://www.iamdrcole.com/xmlrpc.php X-Redirect-By: WordPress Location: https://www.iamdrcole.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 01:04:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · eqv.ojq.mybluehost.me
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:46 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://wealthygen.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:59:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mse.ihh.mybluehost.me
2024-11-03 00:59
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:59:42 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:59:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://alcyonespace.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alcyonespace.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alcyonespace.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · gapscience.forensicpocketguide.com
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:34 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gapscience.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:59:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mxv.rew.mybluehost.me
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ccl-us.org/ Cache-Control: max-age=28800 Expires: Sun, 03 Nov 2024 08:59:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · oan.logical-insanity.com
2024-11-03 00:59
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:59:22 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Strict-Transport-Security: max-age=63072000; includeSubDomains; preload X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Referrer-Policy: no-referrer-when-downgrade Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:59:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Other CMS — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Other CMS — Coming Soon</title> <script src="https://kkn.jpm.mybluehost.me/oan/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kkn.jpm.mybluehost.me/oan/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kkn.jpm.mybluehost.me/oan/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.magneticminstrel.net
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:10 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://magneticminstrel.net/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:59:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.drrussyaconnor.com.au
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sun, 03 Nov 2024 01:59:12 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://drrussyaconnor.com.au/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.willow.ae
2024-11-03 00:59
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:59:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://willow.ae/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · vipseniorbenefits.com
2024-11-03 00:57
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:57:58 GMT Server: Apache Link: <https://vipseniorbenefits.com/wp-json/>; rel="https://api.w.org/", <https://vipseniorbenefits.com/wp-json/wp/v2/pages/11267>; rel="alternate"; type="application/json", <https://vipseniorbenefits.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ecg.abf.mybluehost.me
2024-11-03 00:57
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:57:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ecg.abf.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:57:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · internationalkenpokobudohakutsuruassociation.com
2024-11-03 00:56
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:56:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://internationalkenpokobudohakutsuruassociation.com/wp-json/>; rel="https://api.w.org/", <https://internationalkenpokobudohakutsuruassociation.com/wp-json/wp/v2/pages/27>; rel="alternate"; title="JSON"; type="application/json", <https://internationalkenpokobudohakutsuruassociation.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:56:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · licenselogicsolutions.com
2024-11-03 00:56
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:56:19 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: 862_HTTP.200 Link: <https://licenselogicsolutions.com/wp-json/>; rel="https://api.w.org/", <https://licenselogicsolutions.com/wp-json/wp/v2/pages/1222>; rel="alternate"; title="JSON"; type="application/json", <https://licenselogicsolutions.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · latincouncilavl-org.iib.jso.mybluehost.me
2024-11-03 00:56
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:56:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://latincouncilavl.org/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:56:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.issavalli.com
2024-11-03 00:56
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:56:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://issavalli.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:56:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · aevotechna.com
2024-11-03 00:56
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:56:22 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://aevotechna.com/wp-json/>; rel="https://api.w.org/", <https://aevotechna.com/wp-json/wp/v2/pages/301>; rel="alternate"; title="JSON"; type="application/json", <https://aevotechna.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:56:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.yrj.ela.mybluehost.me
2024-11-03 00:55
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:55:40 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://yrj.ela.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:55:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.simbaonlinestore.com
2024-11-03 00:55
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.pediatricsupportandintervention.com
2024-11-03 00:55
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:55:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pediatricsupportandintervention.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:55:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.texassigningservices.com
2024-11-03 00:54
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:54:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://texassigningservices.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:54:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · timswritingpeace.org
2024-11-03 00:52
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:52:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:52:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: TimsWritingPeace — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>TimsWritingPeace — Coming Soon</title> <script src="https://lzv.xem.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lzv.xem.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lzv.xem.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · qru.jgb.mybluehost.me
2024-11-03 00:52
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:52:22 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://premics.com/xmlrpc.php X-Redirect-By: WordPress Location: https://premics.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: lp_session_guest=g-6726c945861cd; expires=Tue, 05 Nov 2024 00:52:21 GMT; Max-Age=172800; path=/; secure; HttpOnly
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vbp.pmc.mybluehost.me
2024-11-03 00:52
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:52:18 GMT Server: Apache X-Pingback: https://www.revpatriciahart.net/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.revpatriciahart.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · andyrobinetmusic.androidrobotproductions.com
2024-11-03 00:52
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:52:15 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hstex.com.tw
2024-11-03 00:52
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:52:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://hstex.com.tw/wp-json/>; rel="https://api.w.org/", <https://hstex.com.tw/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://hstex.com.tw/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:52:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sallysfault.com
2024-11-03 00:51
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:51:58 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Strict-Transport-Security: max-age=63072000; includeSubDomains; preload X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Referrer-Policy: no-referrer-when-downgrade Location: https://sallysfault.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:51:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · fords-ip.com
2024-11-03 00:51
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:51:33 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://fords-ip.com/wp-json/>; rel="https://api.w.org/", <https://fords-ip.com/wp-json/wp/v2/pages/24>; rel="alternate"; type="application/json", <https://fords-ip.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:56:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Fords Intellectual Property Law <!doctype html> <html class="no-js" lang="en-US"> <head> <meta charset="utf-8"> <!-- Force IE to use the latest rendering engine available --> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <!-- Mobile Meta --> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <meta class="foundation-mq"> <!-- If Site Icon isn't set in customizer --> <link rel="pingback" href="https://fords-ip.com/xmlrpc.php"> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Fords Intellectual Property Law</title> <meta name="description" content="FORDS Intellectual Property Law | IP Lawyers | Brand Protection Specialists in brand and IP protection (applications & registrations) and infringement advice for trademarks, designs & copyright, FORDS is a leading intellectual property law firm based in Sydney." /> <link rel="canonical" href="https://fords-ip.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Fords Intellectual Property Law" /> <meta property="og:description" content="FORDS Intellectual Property Law | IP Lawyers | Brand Protection Specialists in brand and IP protection (applications & registrations) and infringement advice for trademarks, designs & copyright, FORDS is a leading intellectual property law firm based in Sydney." /> <meta property="og:url" content="https://fords-ip.com/" /> <meta property="og:site_name" content="Fords Intellectual Property Law" /> <meta property="article:modified_time" content="2020-07-02T00:26:55+00:00" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://fords-ip.com/","url":"https://fords-ip.com/","name":"Fords Intellectual Property Law","isPartOf":{"@id":"https://fords-ip.com/#website"},"about":{"@id":"https://fords-ip.com/#organization"},"datePublished":"2020-04-27T05:30:17+00:00","dateModified":"2020-07-02T00:26:55+00:00","description":"FORDS Intellectual Property Law | IP Lawyers | Brand Protection Specialists in brand and IP protection (applications & registrations) and infringement advice for trademarks, designs & copyright, FORDS is a leading intellectual property law firm based in Sydney.","breadcrumb":{"@id":"https://fords-ip.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://fords-ip.com/"]}]},{"@type":"BreadcrumbList","@id":"https://fords-ip.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://fords-ip.com/#website","url":"https://fords-ip.com/","name":"Fords Intellectual Property Law","description":"Australian IP Law Firm based in Sydney | Trade Mark Law Experts | Brand Protection Specialists","publisher":{"@id":"https://fords-ip.com/#organization"},"potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://fords-ip.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"},{"@type":"Organization","@id":"https://fords-ip.com/#organization","name":"Fords Intellectual Property Law","url":"https://fords-ip.com/","logo":{"@type":"ImageObject","inLanguage":"en-US","@id":"https://fords-ip.com/#/schema/logo/image/","url":"https://fords-ip.com/wp-content/uploads/2020/04/Fords_Logo.svg","contentUrl":"https://fords-ip.com/wp-content/uploads/2020/04/Fords_Logo.svg","width":"1024","height":"1024","caption":"Fords Intellectual Property Law"},"image":{"@id":"https://fords-ip.com/#/schema/logo/image/"},"sameAs":["https://www.linkedin.com/company/fords-ip/"]}]}</script> <!-- / Yoast SEO plugin. --> <link rel="alternate" type="application/rss+xml" title="Fords Intellectual Property Law » Feed" href="https://forFound 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.bentplyword.com
2024-11-03 00:51
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:51:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bentplyword.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:51:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.childrensfrenchbookcorner.com
2024-11-03 00:51
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:51:15 GMT Server: Apache Link: <https://www.childrensfrenchbookcorner.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.childrensfrenchbookcorner.com
2024-11-03 00:51
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:51:15 GMT Server: Apache Link: <https://www.childrensfrenchbookcorner.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kqv.zzt.mybluehost.me
2024-11-03 00:50
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:50:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kqv.zzt.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:50:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · bentplyword.com
2024-11-03 00:50
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:50:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:50:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Bent PlyWord — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Bent PlyWord — Coming Soon</title> <script src="https://bentplyword.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bentplyword.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bentplyword.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.josefinarecruitment.com
2024-11-03 00:48
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:48:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://josefinarecruitment.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:48:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.coopstrat.com
2024-11-03 00:48
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:48:08 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://coopstrat.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:48:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.urbanheropoodles.veterinarybootcampce.com
2024-11-03 00:48
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:48:04 GMT Server: Apache X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Location: https://urbanheropoodles.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:48:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== content-Security-Policy: upgrade-insecure-requests X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kbcreative-org.churchannouncementsolutions.com
2024-11-03 00:47
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:48:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://www.kbcreative.org/xmlrpc.php X-Redirect-By: WordPress Location: https://www.kbcreative.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qmd.bzx.mybluehost.me
2024-11-03 00:47
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:47:25 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://scottpysher.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:47:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.castellonfloreslaw.com
2024-11-03 00:47
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:47:09 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title> — Coming Soon</title> <script src="https://castellonfloreslaw.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://castellonfloreslaw.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://castellonfloreslaw.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · whooi.com
2024-11-03 00:46
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:46:28 GMT Server: Apache X-LiteSpeed-Tag: ee5_HTTP.200,ee5_HTTP.301 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.whooi.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:46:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ennvisionn.createwebsiteseasily.com
2024-11-03 00:46
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:46:10 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:51:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: ennvisionn — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>ennvisionn — Coming Soon</title> <script src="https://ennvisionn.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ennvisionn.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ennvisionn.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · artaffairs.gallery
2024-11-03 00:46
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:46:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://artaffairs.gallery/wp-json/>; rel="https://api.w.org/", <https://artaffairs.gallery/wp-json/wp/v2/pages/40>; rel="alternate"; title="JSON"; type="application/json", <https://artaffairs.gallery/>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:51:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kqv.zzt.mybluehost.me
2024-11-03 00:45
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:46:04 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kqv.zzt.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:45:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.justallgxxd.com
2024-11-03 00:45
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:46:01 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://justallgxxd.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=7d4998334493b286204c08e2a92543bf; path=/
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.zul.uqp.mybluehost.me
2024-11-03 00:45
HTTP/1.1 302 Found Date: Sun, 03 Nov 2024 00:45:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.zul.uqp.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.zul.uqp.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-4305e3a8.forensicpocketguide.com
2024-11-03 00:44
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:44:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://forensictrainersymposium.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:44:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · renewyou.alvinwayneweiss.com
2024-11-03 00:44
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:44:13 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://renewyou.io/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:44:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · penprojects.com
2024-11-03 00:41
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:42:01 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: miss Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: accept,content-type,Accept-Encoding Link: <https://karenjadams.net/wp-json/>; rel="https://api.w.org/" host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=8e670a8d54554a1d4f37cecf0dea9f65; path=/ Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · classwings.net
2024-11-03 00:41
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:41:49 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://classwings.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:41:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tuukkablab.com
2024-11-03 00:40
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:40:46 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://tuukkablab.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wealthywallets.org
2024-11-03 00:40
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:40:37 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wealthywallets.org/ Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 00:40:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.dunestrailers.com
2024-11-03 00:40
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:40:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dunestrailers.com/ Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 00:40:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yke.cup.mybluehost.me
2024-11-03 00:40
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:40:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dunestrailers.com/ Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 00:40:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.katiagupta.com
2024-11-03 00:39
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:39:49 GMT Server: Apache Link: <https://katiagupta.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://katiagupta.com/index.php?rest_route=/wp/v2/pages/116>; rel="alternate"; title="JSON"; type="application/json", <https://katiagupta.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kreativeways.com.au
2024-11-03 00:39
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:39:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kreativeways.com.au/wp-json/>; rel="https://api.w.org/", <https://kreativeways.com.au/wp-json/wp/v2/pages/135>; rel="alternate"; title="JSON"; type="application/json", <https://kreativeways.com.au/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:39:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vjo.hgs.mybluehost.me
2024-11-03 00:39
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:39:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:39:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Coaching & Keynote Speaking — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Coaching & Keynote Speaking — Coming Soon</title> <script src="https://indispensabilitypro.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://indispensabilitypro.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://indispensabilitypro.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · newhurleychurch.org
2024-11-03 00:38
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:38:05 GMT Server: Apache X-Pingback: https://www.newhurleychurch.org/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.newhurleychurch.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.fjh.dwa.mybluehost.me
2024-11-03 00:37
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:37:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://fjh.dwa.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:42:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: My Blog – My WordPress Blog <!doctype html> <html lang="en-US" > <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <title>My Blog – My WordPress Blog</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fjh.dwa.mybluehost.me' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel="alternate" type="application/rss+xml" title="My Blog » Feed" href="https://fjh.dwa.mybluehost.me/feed/" /> <link rel="alternate" type="application/rss+xml" title="My Blog » Comments Feed" href="https://fjh.dwa.mybluehost.me/comments/feed/" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/fjh.dwa.mybluehost.me\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); </script> <style id='wp-emoji-styles-inline-css'> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 0Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.androidrobotstudios.com
2024-11-03 00:37
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:37:43 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=d16d0c3975a379222257df865b3da855; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://androidrobotstudios.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.sof.frl.mybluehost.me
2024-11-03 00:37
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:37:41 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:37:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://darkkamala.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://darkkamala.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://darkkamala.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.alwehdaclub.sa
2024-11-03 00:36
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:36:53 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://alwehdaclub.sa/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.formydiet.com
2024-11-03 00:36
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:36:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.formydiet.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:36:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.patrickcheatham.com
2024-11-03 00:36
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:36:34 GMT Server: Apache X-UA-Compatible: IE=edge Expires: Sun, 03 Nov 2024 01:36:35 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://patrickcheatham.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · xfv.peu.mybluehost.me
2024-11-03 00:36
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:36:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://volleykats.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.paintedwolfhealingarts.paintedwolfmedia.com
2024-11-03 00:36
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:36:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://paintedwolfhealingarts.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:36:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qqu.lnr.mybluehost.me
2024-11-03 00:36
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:36:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:36:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Pediatric Support and Intervention — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Pediatric Support and Intervention — Coming Soon</title> <script src="https://pediatricsupportandintervention.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://pediatricsupportandintervention.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://pediatricsupportandintervention.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.stowetrails.org
2024-11-03 00:35
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:35:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type Expires: Sun, 03 Nov 2024 01:35:05 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://stowetrails.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yke.cup.mybluehost.me
2024-11-03 00:34
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:34:19 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dunestrailers.com/ Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 00:34:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.perspectivesireland.com
2024-11-03 00:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:34:00 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://www.perspectivesireland.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.perspectivesireland.com%2F; expires=Sun, 01 Dec 2024 00:34:00 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: PHPSESSID=949d7da3f788a56b5c0fc0764b733ee9; path=/
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.canada-shogi.com
2024-11-03 00:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:33:57 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://canada-shogi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.xdg.fsx.mybluehost.me
2024-11-03 00:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:34:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gulfcoastsurveys.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:33:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.fresaj.com
2024-11-03 00:33
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:33:49 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://fresaj.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=28800 Expires: Sun, 03 Nov 2024 08:33:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.hra.uzz.mybluehost.me
2024-11-03 00:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:33:46 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hra.uzz.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:33:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-add0827e.xlr.kdb.mybluehost.me
2024-11-03 00:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:33:30 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=041f6191ab506e1de751e2667d881300; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://jafferhasan.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.thelatenotes.com
2024-11-03 00:33
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:33:24 GMT Server: Apache Link: <https://thelatenotes.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:33:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wiq.jru.mybluehost.me
2024-11-03 00:33
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:33:21 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wiq.jru.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:33:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · blucapinvest.com
2024-11-03 00:32
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:32:51 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:32:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: BluCapital Bookkeeping — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>BluCapital Bookkeeping — Coming Soon</title> <script src="https://blucapinvest.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://blucapinvest.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://blucapinvest.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · nln.pvh.mybluehost.me
2024-11-03 00:32
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:32:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Location: https://www.blueandgrayfinancial.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=babe277785962614b7e119054f6412a5; path=/ Set-Cookie: FORMLIFT_ID=formlift_session_6726c49cec1f67.12698901; expires=Tue, 03-Dec-2024 00:32:28 GMT; Max-Age=2592000; path=/; secure; HttpOnly
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.galenetherapy.com
2024-11-03 00:32
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:32:37 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://galenetherapy.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:32:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.freedomafter50club.com
2024-11-03 00:32
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:32:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://freedomafter50club.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:32:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.strategicmathsolutions.com
2024-11-03 00:32
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:32:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://strategicmathsolutions.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.robertdryer.com
2024-11-03 00:31
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:31:43 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Server-Timing: Location: https://robertdryer.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:31:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · smalimousine.com
2024-11-03 00:31
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:31:38 GMT Server: Apache Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Retry-After: 600 Link: <https://smalimousine.com/wp-json/>; rel="https://api.w.org/", <https://smalimousine.com/wp-json/wp/v2/pages/10388>; rel="alternate"; title="JSON"; type="application/json", <https://smalimousine.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ond.emu.mybluehost.me
2024-11-03 00:31
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:31:31 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://ond.emu.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:31:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kfarringtondesigns.com
2024-11-03 00:31
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:31:17 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kfarringtondesigns.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:36:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.drwendylevy.com
2024-11-03 00:31
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:31:13 GMT Server: Apache Link: <https://www.drwendylevy.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.drwendylevy.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Wendy Levy, PsyD – Clinical Psychologist, LLC, Westport, CT <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="content-type" content="text/html" charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" > <link rel="profile" href="http://gmpg.org/xfn/11"> <title>Wendy Levy, PsyD – Clinical Psychologist, LLC, Westport, CT</title> <link rel='dns-prefetch' href='//www.drwendylevy.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Wendy Levy, PsyD » Feed" href="https://www.drwendylevy.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Wendy Levy, PsyD » Comments Feed" href="https://www.drwendylevy.com/?feed=comments-rss2" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.drwendylevy.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.4.16"}}; /*! This file is auto-generated */ !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://www.drwendylevy.com/wp-includes/css/dist/block-library/style.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='hemingway_googleFonts-css' href='//fonts.googleapis.com/css?family=Lato%3A400%2C700%2C400italic%2C700italic%7CRaleway%3A400%2C700' type='text/css' media='all' /> <link rel='stylesheet' id='hemingway_style-css' href='https://www.drwendylevy.com/wp-content/themes/hemingway/style.css?ver=2.0.2' type='text/css' media='all' /> <script type='text/javascript' src='https://www.drwendylevy.com/wp-includes/js/jquery/jquery.js?ver=1.12.4-wp'></script> <script type='text/javascript' src='https://www.drwendylevy.com/wp-includes/js/jquery/jquery-migrate.min.js?vFound 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.balancedvirtually.iib.jso.mybluehost.me
2024-11-03 00:30
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:30:21 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://balancedvirtually.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:30:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.zzj.etw.mybluehost.me
2024-11-03 00:30
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:30:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mya1tc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sunpringextruder.com
2024-11-03 00:29
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:29:04 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sunpringextruder.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.svc.uzz.mybluehost.me
2024-11-03 00:28
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:28:59 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://martinispickleball.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:28:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · forensicpocketguide.com
2024-11-03 00:28
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:28:52 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://forensicpocketguide.com/wp-json/>; rel="https://api.w.org/", <https://forensicpocketguide.com/wp-json/wp/v2/pages/12084>; rel="alternate"; title="JSON"; type="application/json", <https://forensicpocketguide.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:33:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kkcf-gmi.org
2024-11-03 00:28
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:28:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kkcf-gmi.org/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:28:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mygeotokens.com
2024-11-03 00:27
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:28:00 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://mygeotokens.com/wp-json/>; rel="https://api.w.org/", <https://mygeotokens.com/wp-json/wp/v2/pages/3052>; rel="alternate"; title="JSON"; type="application/json", <https://mygeotokens.com/>; rel=shortlink Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 00:27:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.androidrobotmusic.com
2024-11-03 00:27
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:27:49 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Independent Music Production — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Independent Music Production — Coming Soon</title> <script src="https://independentmusicproduction.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://independentmusicproduction.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://independentmusicproduction.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.brandonolin.com
2024-11-03 00:27
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:27:22 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://brandonolin.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:32:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · henryjoseph.spokespersonagency.com
2024-11-03 00:26
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:26:39 GMT Server: Apache Link: <https://henryjoseph.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · alwehdaclub.sa
2024-11-03 00:26
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:26:34 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,Cookie Cache-Control: max-age=3, must-revalidate host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.bayesinvest.com
2024-11-03 00:25
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:25:47 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bayesinvest.com/ Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 00:25:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-UA-Compatible: IE=edge X-Content-Type-Options: nosniff X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.littlemermaidglassbottomboat.com
2024-11-03 00:25
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:25:46 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.littlemermaidglassbottomboat.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.socialjones.com
2024-11-03 00:25
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:25:42 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.socialjones.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:25:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · patrickcheatham.com
2024-11-03 00:24
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:24:59 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://patrickcheatham.com/wp-json/>; rel="https://api.w.org/", <https://patrickcheatham.com/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://patrickcheatham.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:24:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-4d30039e.xlr.kdb.mybluehost.me
2024-11-03 00:24
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:24:25 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://gnsenterprises.com.pk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hmbll.com
2024-11-03 00:24
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:24:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:24:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: hmbll — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>hmbll — Coming Soon</title> <script src="https://hmbll.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hmbll.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hmbll.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wmi.cra.mybluehost.me
2024-11-03 00:23
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:23:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sunpringextruder.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.arizonareliablemoving.vrv.vjk.mybluehost.me
2024-11-03 00:22
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:22:58 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://arizonareliablemoving.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:22:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.whooi.com
2024-11-03 00:22
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:22:20 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sat, 02 Nov 2024 19:04:12 GMT Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:22:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.gagereviews.com
2024-11-03 00:22
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:22:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://gagereviews.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:27:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sweetbakingadventures.com
2024-11-03 00:22
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:22:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.sweetbakingadventures.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/8znIi>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:27:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.abe.oqk.mybluehost.me
2024-11-03 00:21
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:21:32 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sun, 03 Nov 2024 01:21:32 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://curlyhairproducts.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.leadcometdigital.com
2024-11-03 00:21
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:21:22 GMT Server: Apache Expires: Sun, 03 Nov 2024 01:21:25 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://leadcometdigital.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.zdj.lnl.mybluehost.me
2024-11-03 00:20
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:20:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.lenale.space/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:20:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.your-fitness-guru.booktipper.com
2024-11-03 00:19
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:19:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://your-fitness-guru.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:19:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.nurturedsoulrd.com
2024-11-03 00:19
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:19:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nurturedsoulrd.com/ Cache-Control: max-age=28800 Expires: Sun, 03 Nov 2024 08:19:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mindyourownbirth-ca.mindyourown.life
2024-11-03 00:18
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:18:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mindyourownbirth.ca/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:23:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · suncoastbaptistchurch.info
2024-11-03 00:18
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:18:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://suncoastbaptistchurch.info/wp-json/>; rel="https://api.w.org/", <https://suncoastbaptistchurch.info/wp-json/wp/v2/pages/55>; rel="alternate"; type="application/json", <https://wp.me/P7lAWA-T>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:23:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.walkabouthills.com
2024-11-03 00:18
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:18:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://walkabouthills.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:18:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.zain-alemaar.com
2024-11-03 00:17
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:17:19 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://zain-alemaar.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://zain-alemaar.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://zain-alemaar.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.lanikaiyatomi.com
2024-11-03 00:16
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:16:45 GMT Server: Apache Link: <https://lanikaiyatomi.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://lanikaiyatomi.com/index.php?rest_route=/wp/v2/pages/63>; rel="alternate"; title="JSON"; type="application/json", <https://lanikaiyatomi.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-6079b47d.wqb.fgc.mybluehost.me
2024-11-03 00:16
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:16:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://georgiaparis.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:16:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.gnsenterprises.com.pk
2024-11-03 00:16
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:16:11 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://gnsenterprises.com.pk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · animefreesite.com
2024-11-03 00:15
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:15:55 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://animefreesite.com/wp-json/>; rel="https://api.w.org/", <https://animefreesite.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://animefreesite.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:15:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-9fc6149c.ygo.bsd.mybluehost.me
2024-11-03 00:15
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:15:08 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:15:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: southjerseyhomeadditions — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>southjerseyhomeadditions — Coming Soon</title> <script src="https://southjerseyhomeadditions.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://southjerseyhomeadditions.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://southjerseyhomeadditions.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.odd-1.com
2024-11-03 00:14
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:15:01 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://odd-1.com/index.php?rest_route=/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · effectualwaves.com
2024-11-03 00:14
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:14:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:14:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Effectual Waves — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Effectual Waves — Coming Soon</title> <script src="https://effectualwaves.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://effectualwaves.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.11" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://effectualwaves.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mossbayhall.com
2024-11-03 00:14
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:14:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mossbayhall.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ghealthfood-com.sunmulgift.com
2024-11-03 00:14
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:14:19 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ghealthfood.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:14:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.fresaj.com
2024-11-03 00:14
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:14:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://fresaj.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=28800 Expires: Sun, 03 Nov 2024 08:14:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ncn.ihj.mybluehost.me
2024-11-03 00:14
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:14:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:14:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ncn.ihj.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ncn.ihj.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ncn.ihj.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.forensicpocketguide.com
2024-11-03 00:14
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:14:10 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://forensicpocketguide.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:19:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.espsigns.com
2024-11-03 00:14
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:14:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.espsigns.com/wp-json/>; rel="https://api.w.org/", <https://www.espsigns.com/wp-json/wp/v2/pages/455>; rel="alternate"; title="JSON"; type="application/json", <https://www.espsigns.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:14:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · medicareplansrx.blueandgrayfinancial.com
2024-11-03 00:13
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:13:53 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=f0b3779f2ec096e8263faa4fac7cad11; path=/; secure; HttpOnly Upgrade: h2,h2c Connection: Upgrade, close Location: https://medicareplansrx.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.vhk.hal.mybluehost.me
2024-11-03 00:13
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:13:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://vhk.hal.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:13:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.copyrightok.kr
2024-11-03 00:13
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:13:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.copyrightok.kr/wp-json/>; rel="https://api.w.org/", <https://www.copyrightok.kr/wp-json/wp/v2/pages/4481>; rel="alternate"; title="JSON"; type="application/json", <https://www.copyrightok.kr/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:13:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · qdc.vhl.mybluehost.me
2024-11-03 00:13
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:13:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://qdc.vhl.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:13:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.weightlossmasterzone.sunmulgift.com
2024-11-03 00:12
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:13:00 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://weightlossmasterzone.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:12:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kjj.bxm.mybluehost.me
2024-11-03 00:12
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:12:42 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kjj.bxm.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kjj.bxm.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kjj.bxm.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.preachfromthehousetops.com
2024-11-03 00:12
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:12:30 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://preachfromthehousetops.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:17:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.hkr.vcj.mybluehost.me
2024-11-03 00:12
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:12:32 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://preachfromthehousetops.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:17:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.yke.cup.mybluehost.me
2024-11-03 00:12
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:12:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dunestrailers.com/ Cache-Control: max-age=0 Expires: Sun, 03 Nov 2024 00:12:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kelpark.org
2024-11-03 00:11
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:11:52 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kelpark.org/wp-json/>; rel="https://api.w.org/", <https://kelpark.org/wp-json/wp/v2/pages/259>; rel="alternate"; title="JSON"; type="application/json", <https://kelpark.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:11:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · thegaldamezlandscaping.com
2024-11-03 00:11
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:11:33 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:11:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Galdamez Landscaping — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Galdamez Landscaping — Coming Soon</title> <script src="https://thegaldamezlandscaping.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thegaldamezlandscaping.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thegaldamezlandscaping.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.canada-shogi.com
2024-11-03 00:11
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:11:25 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://canada-shogi.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/a8hho>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.latincouncilavl.org
2024-11-03 00:10
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:10:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://latincouncilavl.org/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:10:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.sammysexports.com
2024-11-03 00:08
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:08:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sammysexports.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:08:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kelp-ark.org
2024-11-03 00:08
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:08:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.altaseadsconservancy.org/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:08:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kkcf-gmi.org
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:56 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kkcf-gmi.org/wp-json/>; rel="https://api.w.org/", <https://kkcf-gmi.org/wp-json/wp/v2/pages/3421>; rel="alternate"; title="JSON"; type="application/json", <https://kkcf-gmi.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:07:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · abundantlovechildrenshome.com
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-Pingback: https://abundantlovechildrenshome.com/xmlrpc.php Link: <https://abundantlovechildrenshome.com/wp-json/>; rel="https://api.w.org/", <https://abundantlovechildrenshome.com/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://abundantlovechildrenshome.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:07:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · charlotteandscottadopt.com
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:10 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://charlotteandscottadopt.com/wp-json/>; rel="https://api.w.org/" Set-Cookie: PHPSESSID=b5e6af17773a91787b977ac8bc59bce8; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.springerpublications.zbo.pfi.mybluehost.me
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:09 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Set-Cookie: PHPSESSID=7dde8b51a99336ea9357acda62327e0b; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rxn.kdf.mybluehost.me
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: My Gardening Passion — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>My Gardening Passion — Coming Soon</title> <script src="https://rxn.kdf.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rxn.kdf.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rxn.kdf.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · michaeljcordell.com
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://michaeljcordell.com/wp-json/>; rel="https://api.w.org/", <https://michaeljcordell.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:12:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.tcbuilderli.com
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:04 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Thomas Construction — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Thomas Construction — Coming Soon</title> <script src="https://tcbuilderli.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tcbuilderli.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tcbuilderli.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.charlotteandscottadopt.com
2024-11-03 00:07
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:07:04 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=ed59663d7624a0bfaeadd44610b1beb0; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://charlotteandscottadopt.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.forlogancounty.com
2024-11-03 00:07
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:07:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Logan County Community Foundation — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Logan County Community Foundation — Coming Soon</title> <script src="https://forlogancounty.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://forlogancounty.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://forlogancounty.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ehfs.health
2024-11-03 00:06
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:06:59 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ehfs.health
2024-11-03 00:06
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:06:57 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hammocktravelers.com
2024-11-03 00:06
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:06:20 GMT Server: Apache Link: <https://hammocktravelers.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.paintedwolfhealingarts.com
2024-11-03 00:05
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:05:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://paintedwolfhealingarts.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:05:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-d0df5eca.marksolomon.net
2024-11-03 00:05
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:05:24 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:05:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: 7pinespublishing.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>7pinespublishing.com — Coming Soon</title> <script src="https://7pinespublishing.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://7pinespublishing.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.11" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://7pinespublishing.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.tks.duj.mybluehost.me
2024-11-03 00:05
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:05:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://willow.ae/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.prx.doq.mybluehost.me
2024-11-03 00:05
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:05:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://simbaonlinestore.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:05:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.vjo.hgs.mybluehost.me
2024-11-03 00:04
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:04:27 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:04:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Coaching & Keynote Speaking — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Coaching & Keynote Speaking — Coming Soon</title> <script src="https://indispensabilitypro.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://indispensabilitypro.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://indispensabilitypro.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.swt.nuh.mybluehost.me
2024-11-03 00:04
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:04:24 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://saddleabout.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.fjh.srl.mybluehost.me
2024-11-03 00:04
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:04:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bludesigns.ca/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:04:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.888lockuup.com
2024-11-03 00:04
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:04:06 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://www.888lockuup.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/6a3IO>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.aps.fts.mybluehost.me
2024-11-03 00:04
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:04:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:04:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://thejedipath.store/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thejedipath.store/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thejedipath.store/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · erinnkdaniel.vmr.arb.mybluehost.me
2024-11-03 00:03
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:03:41 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://erinnkdaniel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:03:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.foundartfactory.net
2024-11-03 00:02
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:03:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://foundartfactory.net/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:03:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.curlyhairproducts.com
2024-11-03 00:02
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:02:59 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sun, 03 Nov 2024 01:02:59 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://curlyhairproducts.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · thecoopers.design
2024-11-03 00:02
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:02:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://thecoopers.design/wp-json/>; rel="https://api.w.org/", <https://thecoopers.design/wp-json/wp/v2/pages/2957>; rel="alternate"; title="JSON"; type="application/json", <https://thecoopers.design/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:02:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Referrer-Policy: no-referrer-when-downgrade X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ane.pzr.mybluehost.me
2024-11-03 00:02
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:02:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:02:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: USCIES — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>USCIES — Coming Soon</title> <script src="https://uscies.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://uscies.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.13.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://uscies.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bzn.nst.mybluehost.me
2024-11-03 00:01
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:01:54 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://ardsoftsolutions.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:01:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kidzcomics.com
2024-11-03 00:00
HTTP/1.1 301 Moved Permanently Date: Sun, 03 Nov 2024 00:00:53 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kidzcomics.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:00:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.abatementsolutionslacrosse.com
2024-11-03 00:00
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:00:28 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.abatementsolutionslacrosse.com/wp-json/>; rel="https://api.w.org/", <https://www.abatementsolutionslacrosse.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.abatementsolutionslacrosse.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:00:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-6ed183b1.geckographix.ca
2024-11-03 00:00
HTTP/1.1 200 OK Date: Sun, 03 Nov 2024 00:00:10 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 02:00:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: stephane_dev — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>stephane_dev — Coming Soon</title> <script src="https://geckographix.ca/website_6ed183b1/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://geckographix.ca/website_6ed183b1/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://geckographix.ca/website_6ed183b1/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-03 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · andyrobinetguitar.androidrobotproductions.com
2024-11-02 23:59
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:59:42 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.shrmehdi.com
2024-11-02 23:59
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:59:34 GMT Server: Apache Vary: accept,content-type,Accept-Encoding X-Cache-Enabled: True Link: <https://shrmehdi.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/9v86n>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:04:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.gsb.ekr.mybluehost.me
2024-11-02 23:59
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:59:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://floridagirltravels.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:59:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-1a89461e.ane.pzr.mybluehost.me
2024-11-02 23:58
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:58:44 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:58:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title> — Coming Soon</title> <script src="https://tinitiatives.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tinitiatives.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tinitiatives.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.yxo.gqj.mybluehost.me
2024-11-02 23:58
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:58:41 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:58:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Forever To Keep Photography — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Forever To Keep Photography — Coming Soon</title> <script src="https://forevertokeepphoto.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://forevertokeepphoto.com/wp-content/plugins/bluehost-wordpress-plugin/static/coming-soon.css?v=2.12.20" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>A New WordPress Site!</h1> <h2>Coming Soon!</h2> <a class="btn" href="https://forevertokeepphoto.com/wp-login.php"> Admin Login </a> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com/wordpress" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://forevertokeepphoto.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · alisongifford.yourstudydoctor.com
2024-11-02 23:58
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:58:41 GMT Server: Apache Link: <https://alisongifford.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://alisongifford.com/index.php?rest_route=/wp/v2/pages/193>; rel="alternate"; title="JSON"; type="application/json", <https://alisongifford.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.krlinvestors.com
2024-11-02 23:58
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:58:42 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: 1e7_HTTP.200,1e7_HTTP.301 X-Redirect-By: WordPress Location: https://krlinvestors.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:58:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cqg.pgm.mybluehost.me
2024-11-02 23:58
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:58:04 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.altaseadsconservancy.org/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:58:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-c04e6967.anc.xfn.mybluehost.me
2024-11-02 23:57
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:57:57 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:57:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Squeezing Nickels — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Squeezing Nickels — Coming Soon</title> <script src="https://anc.xfn.mybluehost.me/.website_c04e6967/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://anc.xfn.mybluehost.me/.website_c04e6967/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://anc.xfn.mybluehost.me/.website_c04e6967/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ftj.rdx.mybluehost.me
2024-11-02 23:57
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:57:59 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:57:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ftj.rdx.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ftj.rdx.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ftj.rdx.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vjv.mjh.mybluehost.me
2024-11-02 23:56
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:56:56 GMT Server: Apache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.ascendingarrows.com/ Cache-Control: max-age=300 Expires: Sun, 03 Nov 2024 00:01:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · coronaregime.com
2024-11-02 23:56
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:56:24 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://coronaregime.com/>; rel=shortlink Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cross-Origin-Embedder-Policy: unsafe-none Cross-Origin-Opener-Policy: unsafe-none Cross-Origin-Resource-Policy: cross-origin Referrer-Policy: strict-origin-when-cross-origin X-Download-Options: noopen X-Frame-Options: SAMEORIGIN X-XSS-Protection: 1; mode=block X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: vchideactivationmsg_vc11=7.9 Transfer-Encoding: chunked Page title: Site is undergoing maintenance <!DOCTYPE html> <html lang="en-GB"> <head> <meta charset="UTF-8" /> <title>Site is undergoing maintenance</title> <link rel="icon" href="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-32x32.png" sizes="32x32" /> <link rel="icon" href="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-192x192.png" sizes="192x192" /> <link rel="apple-touch-icon" href="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-180x180.png" /> <meta name="msapplication-TileImage" content="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-270x270.png" /> <meta name="viewport" content="width=device-width, maximum-scale=1, initial-scale=1, minimum-scale=1"> <meta name="description" content=""/> <meta http-equiv="X-UA-Compatible" content="" /> <meta property="og:site_name" content="COMING SOON - "/> <meta property="og:title" content="Site is undergoing maintenance"/> <meta property="og:type" content="Maintenance"/> <meta property="og:url" content="https://coronaregime.com"/> <meta property="og:description" content="Site will be available soon. Thank you for your patience!"/> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel='stylesheet' id='mtnc-style-css' href='https://coronaregime.com/stywhops/maintenance/load/css/style.css?ver=1707199968' type='text/css' media='all' /> <link rel='stylesheet' id='mtnc-fonts-css' href='https://coronaregime.com/stywhops/maintenance/load/css/fonts.css?ver=1707199968' type='text/css' media='all' /> <style type="text/css">body {background-color: #111111}.preloader {background-color: #111111}body {font-family: Open Sans; }.site-title, .preloader i, .login-form, .login-form a.lost-pass, .btn-open-login-form, .site-content, .user-content-wrapper, .user-content, footer, .maintenance a{color: #ffffff;} a.close-user-content, #mailchimp-box form input[type="submit"], .login-form input#submit.button {border-color:#ffffff} input[type="submit"]:hover{background-color:#ffffff} input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-text-fill-color:#ffffff} body > .login-form-container{background-color:#111111}.btn-open-login-form{background-color:#111111}input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-box-shadow:0 0 0 50px #111111 inset}input[type='submit']:hover{color:#111111} #custom-subscribe #submit-subscribe:before{background-color:#111111} </style> <!--[if IE]> <style type="text/css"> </style> <script type="text/javascript" src="https://coronaregime.com/stywhops/maintenance/load/js/jquery.backstretch.min.js"></script> <![endif]--> <link rel="stylesheet" href="https://fonts.bunny.net/css?family=Open%20Sans:300,300italic,regular,italic,600,600italic,700,700italic,800,800italic:300"></head> <body class="maintenance "> <div class="main-container"> <div class="preloader"><i class="fi-widget" aria-hidden="true"></i></div> <div id="wrapper"> <div class="center logotype"> <header> <div class="logo-box istext" rel="home"><h1 class="site-title">COMING SOON</h1></div> </header> </div> <div id="content" class="site-content"> <div class="center"> <h2 class="heading font-center" style="font-weight:300;font-style:normal">Maintenance mode is on</h2><div class="description" style="font-weight:300;font-style:normal"><p>Site will be available soon. Thank you for your patience!</p> </div> </div> </div> </div> <footer> <div class="center"> <div style="font-weight:300;font-style:normal">© 2024</div> </div> </footer> <picture class="bg-img"> <img src="https://coronaregime.com/osuwubif/2024/02/mt-sample-background.jpg"> </picture> </div> <div class="login-form-container"> <input type="hidden" id="mtnc_login_check" name="mtnc_login_check" value="a9f5573f59" /><input type="hidden" name="_wp_http_referer" value="/" /><form id="login-form" class="login-form" method="post"><label>User Login</label><span class="login-error"></span><span class="licon user-icon"><input type="text" name="log" id="log" value="" size="20" class="input username" placeholder="UsernamFound 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · villanayalmar.com
2024-11-02 23:55
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:56:04 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: twp_session=9d15c4b78bf47cffa578b30c7b276a2a%7C%7C1730593564%7C%7C1730593204; expires=Sun, 03-Nov-2024 00:26:04 GMT; Max-Age=1800; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.villanayalmar.com/ Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 <!-- WP Super Cache is installed but broken. The constant WPCACHEHOME must be set in the file wp-config.php and point at the WP Super Cache plugin directory. -->
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.oftenplusneverminus.com
2024-11-02 23:55
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:55:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://oftenplusneverminus.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:55:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sallysfault.logical-insanity.com
2024-11-02 23:55
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:55:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Strict-Transport-Security: max-age=63072000; includeSubDomains; preload X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Referrer-Policy: no-referrer-when-downgrade Location: https://sallysfault.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:55:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qrn.ajs.mybluehost.me
2024-11-02 23:54
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:55:01 GMT Server: Apache Link: <https://miahfrancis.com/wp-json/>; rel="https://api.w.org/" Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 31 Oct 2034 23:55:03 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:55:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · quicksignaturenotary.com
2024-11-02 23:54
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:54:24 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://quicksignaturenotary.com/wp-json/>; rel="https://api.w.org/", <https://quicksignaturenotary.com/wp-json/wp/v2/pages/11>; rel="alternate"; type="application/json", <https://quicksignaturenotary.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:54:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ottawallpaper.com
2024-11-02 23:53
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:53:33 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.ottawallpaper.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · restorativerainbowalliance.org
2024-11-02 23:52
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:52:29 GMT Server: Apache Link: <https://restorativerainbowalliance.org/wp-json/>; rel="https://api.w.org/", <https://restorativerainbowalliance.org/wp-json/wp/v2/pages/893>; rel="alternate"; title="JSON"; type="application/json", <https://restorativerainbowalliance.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:52:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.aironbroadway.com
2024-11-02 23:52
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:52:28 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://glj.lgu.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://glj.lgu.mybluehost.me/wp-json/wp/v2/pages/105>; rel="alternate"; title="JSON"; type="application/json", <https://glj.lgu.mybluehost.me/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:52:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.themarketingaigency.com
2024-11-02 23:52
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:52:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://themarketingaigency.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:52:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.neighboravenue.com
2024-11-02 23:52
HTTP/1.1 302 Found Date: Sat, 02 Nov 2024 23:52:16 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=iso-8859-1 Content-Length: 240 Location: http://mail.neighboravenue.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.neighboravenue.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · crz.nmb.mybluehost.me
2024-11-02 23:52
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:52:11 GMT Server: Apache Link: <https://www.thriftanddrift.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Page not found | Thrift and Drift <!DOCTYPE html> <html lang="en-US"> <head> <title>Page not found | Thrift and Drift</title> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://www.thriftanddrift.com/xmlrpc.php" /> <link rel='dns-prefetch' href='//www.thriftanddrift.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Thrift and Drift » Feed" href="https://www.thriftanddrift.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Thrift and Drift » Comments Feed" href="https://www.thriftanddrift.com/?feed=comments-rss2" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.thriftanddrift.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.4.16"}}; /*! This file is auto-generated */ !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://www.thriftanddrift.com/wp-includes/css/dist/block-library/style.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='griffin_ubuntu-css' href='//fonts.googleapis.com/css?family=Ubuntu%3A400%2C700&ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='griffin_bootstrap_css-css' href='https://www.thriftanddrift.com/wp-content/themes/griffin/assets/css/bootstrap.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='griffin_style-css' href='https://www.thriftanddrift.com/wp-content/themes/griffin/style.css?ver=5.4.16' type='Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.fcitoday.com
2024-11-02 23:52
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:52:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fcitoday.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:52:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yesforgreeneview.com
2024-11-02 23:51
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:52:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://yesforgreeneview.com/wp-json/>; rel="https://api.w.org/", <https://yesforgreeneview.com/wp-json/wp/v2/pages/2068>; rel="alternate"; title="JSON"; type="application/json", <https://yesforgreeneview.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:51:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.andyrobinetguitar.androidrobotproductions.com
2024-11-02 23:51
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:51:12 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qdc.vhl.mybluehost.me
2024-11-02 23:50
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:50:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://qdc.vhl.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:50:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cin4m-com.sunmulgift.com
2024-11-02 23:50
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:50:27 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.cine4m.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:50:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · centralvalleyliftpros.com
2024-11-02 23:50
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:50:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://centralvalleyliftpros.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:50:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ryw.etw.mybluehost.me
2024-11-02 23:50
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:50:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Pragma: no-cache Expires: Sun, 03 Nov 2024 00:50:08 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://pcproblems.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=9e381d7c27e4017c8bfbbb157c717a50; path=/
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · pzq.kei.mybluehost.me
2024-11-02 23:48
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:48:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://pzq.kei.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:48:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · avisofitness.com
2024-11-02 23:48
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:48:27 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,Cookie Link: <https://avisofitness.com/wp-json/>; rel="https://api.w.org/", <https://avisofitness.com/wp-json/wp/v2/pages/2770>; rel="alternate"; title="JSON"; type="application/json", <https://avisofitness.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:48:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.thinkdigitalmatter.com
2024-11-02 23:48
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:48:07 GMT Server: Apache Link: <https://www.thinkdigitalmatter.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.thinkdigitalmatter.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.thinkdigitalmatter.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: DigitalMatter LLC – the structure and properties of matter <!DOCTYPE html> <html lang="en-US" class="no-js"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <link rel="profile" href="https://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.thinkdigitalmatter.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.thinkdigitalmatter.com/wp-content/themes/twentyfifteen/js/html5.js?ver=3.7.0"></script> <![endif]--> <script>(function(html){html.className = html.className.replace(/\bno-js\b/,'js')})(document.documentElement);</script> <title>DigitalMatter LLC – the structure and properties of matter</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.thinkdigitalmatter.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link href='https://fonts.gstatic.com' crossorigin rel='preconnect' /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Feed" href="https://www.thinkdigitalmatter.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Comments Feed" href="https://www.thinkdigitalmatter.com/?feed=comments-rss2" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.thinkdigitalmatter.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFound 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.qfp.ths.mybluehost.me
2024-11-02 23:46
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-e95c4881.ane.pzr.mybluehost.me
2024-11-02 23:46
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:46:19 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rachana.io/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:46:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · 227media.net
2024-11-02 23:46
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:46:15 GMT Server: Apache Link: <https://227media.net/wp-json/>; rel="https://api.w.org/", <https://227media.net/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://227media.net/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.recipesandplaces.com
2024-11-02 23:46
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:46:08 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sat, 02 Nov 2024 22:41:40 GMT Cache-Control: max-age=0 Expires: Sat, 02 Nov 2024 23:46:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · alcyonespace.com
2024-11-02 23:45
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:45:48 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:45:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://alcyonespace.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alcyonespace.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alcyonespace.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · sui.noo.mybluehost.me
2024-11-02 23:45
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:45:35 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://coleestyle.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:45:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.lenale.space
2024-11-02 23:45
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:45:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.lenale.space/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:45:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.themompoweredhome.com
2024-11-02 23:45
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:45:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://themompoweredhome.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:45:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · bestboutiquebooks.com
2024-11-02 23:45
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:45:10 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://bestboutiquebooks.com/wp-json/>; rel="https://api.w.org/", <https://bestboutiquebooks.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://bestboutiquebooks.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:45:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · perspectivesireland.perspectivesireland.ie
2024-11-02 23:44
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:44:22 GMT Server: Apache X-UA-Compatible: IE=edge Access-Control-Allow-Origin: https://app.hu-manity.co Access-Control-Allow-Methods: GET X-Redirect-By: WordPress Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.perspectivesireland.com%2F; expires=Sat, 30 Nov 2024 23:44:27 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: wcpay_currency=EUR_1; expires=Sun, 03 Nov 2024 00:44:27 GMT; Max-Age=3600; path=/ Set-Cookie: wcpay_currency=CAD_1.518896; expires=Sun, 03 Nov 2024 00:44:27 GMT; Max-Age=3600; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.perspectivesireland.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.plugovoyhistory.com
2024-11-02 23:43
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:43:31 GMT Server: Apache Link: <https://plugovoyhistory.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://plugovoyhistory.com/index.php?rest_route=/wp/v2/pages/230>; rel="alternate"; title="JSON"; type="application/json", <https://plugovoyhistory.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ehfs.health
2024-11-02 23:42
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:42:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://ehfs.health/wp-json/>; rel="https://api.w.org/", <https://ehfs.health/wp-json/wp/v2/pages/1556>; rel="alternate"; type="application/json", <https://ehfs.health/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lbo.lnl.mybluehost.me
2024-11-02 23:41
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:41:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://ainttooproudtomeg.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:46:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.vip.sfg.mybluehost.me
2024-11-02 23:39
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:39:28 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sun, 03 Nov 2024 00:39:28 GMT Cache-Control: max-age=3600 X-LiteSpeed-Tag: 20c_HTTP.200,20c_HTTP.301,20c_HTTP.301 X-Redirect-By: WordPress Location: https://agriexotic.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-15891645.lyy.wev.mybluehost.me
2024-11-02 23:38
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:38:55 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://maideaz.net/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:38:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rbgbank.com
2024-11-02 23:37
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:37:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:42:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://box5315.temp.domains/~rbgbankc/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5315.temp.domains/~rbgbankc/wp-content/plugins/mojo-marketplace-wp-plugin/assets/styles/coming-soon.css?v=3.2.3" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> Is this your website? Log in to <a href="https://box5315.temp.domains/~rbgbankc/wp-login.php">WordPress</a> or <a href="https://www.mojomarketplace.com/login" target="_blank" rel="noopener noreferrer nofollow">MOJO</a>. </p> </footer> </body> </html> <!--Generated by Newfold Page Cache-->Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.fvb.bof.mybluehost.me
2024-11-02 23:37
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:37:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fvb.bof.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:37:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kidsdeal.us
2024-11-02 23:37
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:37:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kidsdeal.us/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:42:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jeancarlosartist.com
2024-11-02 23:37
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:37:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.jeancarlosartist.com/wp-json/>; rel="https://api.w.org/", <https://www.jeancarlosartist.com/wp-json/wp/v2/pages/670>; rel="alternate"; title="JSON"; type="application/json", <https://www.jeancarlosartist.com/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:42:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Access-Control-Allow-Origin: * X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Jean Carlos Art | Fine Hand Drawing <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <link rel="pingback" href="https://www.jeancarlosartist.com/xmlrpc.php" /> <script type="text/javascript"> document.documentElement.className = 'js'; </script> <script>var et_site_url='https://www.jeancarlosartist.com';var et_post_id='670';function et_core_page_resource_fallback(a,b){"undefined"===typeof b&&(b=a.sheet.cssRules&&0===a.sheet.cssRules.length);b&&(a.onerror=null,a.onload=null,a.href?a.href=et_site_url+"/?et_core_page_resource="+a.id+et_post_id:a.src&&(a.src=et_site_url+"/?et_core_page_resource="+a.id+et_post_id))} </script><title>Jean Carlos Art | Fine Hand Drawing</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Jean Carlos Art » Feed" href="https://www.jeancarlosartist.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Jean Carlos Art » Comments Feed" href="https://www.jeancarlosartist.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.jeancarlosartist.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlaFound 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · texassigningservices.com
2024-11-02 23:37
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:37:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://texassigningservices.com/wp-json/>; rel="https://api.w.org/", <https://texassigningservices.com/wp-json/wp/v2/pages/17>; rel="alternate"; title="JSON"; type="application/json", <https://texassigningservices.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:37:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · greaterpropertysolutions.com
2024-11-02 23:36
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:36:43 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://greaterpropertysolutions.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://greaterpropertysolutions.com/index.php?rest_route=/wp/v2/pages/13>; rel="alternate"; title="JSON"; type="application/json", <https://greaterpropertysolutions.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.rxn.kdf.mybluehost.me
2024-11-02 23:35
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:35:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rxn.kdf.mybluehost.me/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · stowetrails.com
2024-11-02 23:35
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:35:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:35:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.donaldsflyingservice.com
2024-11-02 23:34
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:34:50 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://donaldsflyingservice.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:34:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-a4347e21.projectsmind.com
2024-11-02 23:34
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:34:36 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: track.projectsmind.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>track.projectsmind.com — Coming Soon</title> <script src="https://track.projectsmind.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://track.projectsmind.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://track.projectsmind.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mtn.xem.mybluehost.me
2024-11-02 23:33
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:33:42 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nateharrison.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:33:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-d736f01b.azh.jzw.mybluehost.me
2024-11-02 23:33
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:33:21 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: edb_HTTP.200,edb_HTTP.301 X-Redirect-By: WordPress Location: https://norm-macdonald.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:33:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tny.vtl.mybluehost.me
2024-11-02 23:32
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:33:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:32:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tny.vtl.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tny.vtl.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tny.vtl.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.internationalhealinggroup.com
2024-11-02 23:32
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:32:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://internationalhealinggroup.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:37:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.themodevents.com
2024-11-02 23:32
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:32:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://themodevents.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:32:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.atlaspressurewashingllc.com
2024-11-02 23:31
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:31:09 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:31:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Atlaspressurewashingllc.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Atlaspressurewashingllc.com — Coming Soon</title> <script src="https://atlaspressurewashingllc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://atlaspressurewashingllc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://atlaspressurewashingllc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.atlaspressurewashingllc.com
2024-11-02 23:30
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:30:54 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://atlaspressurewashingllc.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:30:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.offer.spacemanmoving.com
2024-11-02 23:30
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:30:41 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Cache-Enabled: True X-Redirect-By: WordPress Location: https://offer.spacemanmoving.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:30:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.greenlightservices.us
2024-11-02 23:30
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:30:36 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://greenlightservices.us/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.xut.pyw.mybluehost.me
2024-11-02 23:30
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:30:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://xut.pyw.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:30:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-00475774.ane.pzr.mybluehost.me
2024-11-02 23:30
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:30:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:30:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: hmbll — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>hmbll — Coming Soon</title> <script src="https://hmbll.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hmbll.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hmbll.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.metstudies.com
2024-11-02 23:30
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:30:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://metstudies.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:30:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · latincouncilavl.org
2024-11-02 23:29
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:29:40 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://latincouncilavl.org/wp-json/>; rel="https://api.w.org/", <https://latincouncilavl.org/wp-json/wp/v2/pages/254>; rel="alternate"; title="JSON"; type="application/json", <https://latincouncilavl.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:29:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-fde254bc.harmonywithtruenature.com
2024-11-02 23:29
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:29:41 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inspireintegrativehealth.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:29:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.latincouncilavl-org.iib.jso.mybluehost.me
2024-11-02 23:29
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:29:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://latincouncilavl.org/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:29:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kevinflynnmusic.com
2024-11-02 23:29
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:29:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:29:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kevinflynnmusic.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kevinflynnmusic.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kevinflynnmusic.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.a2hdesignstudio.ca
2024-11-02 23:29
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:29:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://a2hdesignstudio.ca/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:29:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.harmonywithtruenature.com
2024-11-02 23:29
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:29:35 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.harmonywithtruenature.com/wp-json/>; rel="https://api.w.org/", <https://www.harmonywithtruenature.com/wp-json/wp/v2/pages/1549>; rel="alternate"; title="JSON"; type="application/json", <https://www.harmonywithtruenature.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.irbf.co.uk
2024-11-02 23:29
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:29:20 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://irbf.co.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dhc.tvd.mybluehost.me
2024-11-02 23:28
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:28:46 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://smileanddialconsulting.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:28:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · badgirlgoodfighter.com
2024-11-02 23:28
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:28:25 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://beccathesun.com/xmlrpc.php X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://beccathesun.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:28:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jeancarlosartist.com
2024-11-02 23:27
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:28:01 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://www.jeancarlosartist.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:33:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Access-Control-Allow-Origin: * X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.stocktobias.com
2024-11-02 23:27
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:27:54 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stocktobias.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:32:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kishafreed.com
2024-11-02 23:27
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:27:50 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kishafreed.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:32:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-3ee2ac1b.andersenlandscaping.com
2024-11-02 23:27
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:27:39 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:27:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Atlaspressurewashingllc.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Atlaspressurewashingllc.com — Coming Soon</title> <script src="https://atlaspressurewashingllc.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://atlaspressurewashingllc.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://atlaspressurewashingllc.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wmi.cra.mybluehost.me
2024-11-02 23:27
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:27:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sunpringextruder.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ett.nce.mybluehost.me
2024-11-02 23:26
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:26:37 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ett.nce.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:26:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cine4m.com
2024-11-02 23:25
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:25:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.cine4m.com/wp-json/>; rel="https://api.w.org/", <https://www.cine4m.com/wp-json/wp/v2/pages/3802>; rel="alternate"; title="JSON"; type="application/json", <https://www.cine4m.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:25:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.greaterpropertysolutions.com
2024-11-02 23:25
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:25:47 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://greaterpropertysolutions.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-d83edc8d.dhw.goc.mybluehost.me
2024-11-02 23:25
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:25:03 GMT Server: Apache Link: <https://dhw.goc.mybluehost.me/website_d83edc8d/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:25:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.shitibuilt.com
2024-11-02 23:24
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:24:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://gebuilds.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:24:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wildlyfaithfulwomen.vmr.arb.mybluehost.me
2024-11-02 23:23
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:23:13 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wildlyfaithfulwomen.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:23:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wildlyfaithfulwomen.com
2024-11-02 23:23
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:23:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wildlyfaithfulwomen.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:23:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · urbanheropoodles.com
2024-11-02 23:22
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:22:15 GMT Server: Apache Link: <https://urbanheropoodles.com/wp-json/>; rel="https://api.w.org/", <https://urbanheropoodles.com/wp-json/wp/v2/pages/10>; rel="alternate"; title="JSON"; type="application/json", <https://urbanheropoodles.com/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:22:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== content-Security-Policy: upgrade-insecure-requests X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · vmr.arb.mybluehost.me
2024-11-02 23:22
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:22:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:22:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://vmr.arb.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://vmr.arb.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://vmr.arb.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.girlglowing.com
2024-11-02 23:21
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:21:34 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://girlglowing.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:21:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kloetzerarms.com
2024-11-02 23:20
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:20:54 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kloetzerarms.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kloetzerarms.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kloetzerarms.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kloetzerarms.com
2024-11-02 23:20
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:20:53 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kloetzerarms.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.insobeau-com.sunmulgift.com
2024-11-02 23:20
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:20:54 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.insobeau.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:20:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · stowemountainbike.stowe-trails.com
2024-11-02 23:20
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:20:56 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:20:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · thefestiveco.com
2024-11-02 23:20
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:20:55 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.thefestiveco.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.partnersdigitalmarketing.com
2024-11-02 23:20
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:20:55 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.partnersdigitalmarketing.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thefestiveco.com
2024-11-02 23:20
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:20:54 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://www.thefestiveco.com/wp-json/>; rel="https://api.w.org/", <https://www.thefestiveco.com/wp-json/wp/v2/pages/6133>; rel="alternate"; type="application/json", <https://wp.me/P5PsUz-1AV>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lusty-store.keyawagroup.com
2024-11-02 23:19
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:20:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://lusty-store.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:19:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wiredss.ae
2024-11-02 23:19
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:19:51 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://wiredss.ae/wp-json/>; rel="https://api.w.org/", <https://wiredss.ae/wp-json/wp/v2/pages/2542>; rel="alternate"; title="JSON"; type="application/json", <https://wiredss.ae/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yxp.plo.mybluehost.me
2024-11-02 23:19
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:19:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aevotechna.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:19:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mql.ghe.mybluehost.me
2024-11-02 23:19
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:19:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:19:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kudenservice200.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kudenservice200.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kudenservice200.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · olivetreetales.com
2024-11-02 23:19
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:19:09 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://olivetreetales.com/wp-json/>; rel="https://api.w.org/", <https://olivetreetales.com/wp-json/wp/v2/pages/40>; rel="alternate"; title="JSON"; type="application/json", <https://olivetreetales.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:19:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mindful2happy.com
2024-11-02 23:19
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:19:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: 750_HTTP.200,750_HTTP.301 X-Redirect-By: WordPress Location: https://mindful2happy.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:19:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · forlogancounty.churchannouncementsolutions.com
2024-11-02 23:18
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:18:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Logan County Community Foundation — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Logan County Community Foundation — Coming Soon</title> <script src="https://forlogancounty.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://forlogancounty.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://forlogancounty.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.gik.dhy.mybluehost.me
2024-11-02 23:17
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:17:51 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://writeesasyeails.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:17:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.neverhadaboss.com
2024-11-02 23:16
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:16:47 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://neverhadaboss.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thelightingofafire.com
2024-11-02 23:16
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:16:33 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thelightingofafire.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:16:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · pixelscott.com
2024-11-02 23:16
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:16:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://pixelscott.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:16:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.donaldsflyingservice.com
2024-11-02 23:15
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:15:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://donaldsflyingservice.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:15:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dynamic-rr.com
2024-11-02 23:15
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:15:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://www.dynamic-rr.com/wp-json/>; rel="https://api.w.org/", <https://www.dynamic-rr.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.dynamic-rr.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:20:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tredemapping.com
2024-11-02 23:15
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:15:37 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://tredemapping.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · catskillsdoublewedding.com
2024-11-02 23:15
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:15:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://catskillsdoublewedding.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:20:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Catskills Double Wedding | August 25th, 2018Catskills Double Wedding – August 25th, 2018 <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) | !(IE 8) ]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <title>Catskills Double Wedding | August 25th, 2018</title> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://catskillsdoublewedding.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://catskillsdoublewedding.com/wp-content/themes/mckinley/js/html5.js"></script> <![endif]--> <title>Catskills Double Wedding – August 25th, 2018</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//patterns.hiive.cloud' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Catskills Double Wedding » Feed" href="https://catskillsdoublewedding.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Catskills Double Wedding » Comments Feed" href="https://catskillsdoublewedding.com/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v9.2.1 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No tracking code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/catskillsdoublewedding.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toStrFound 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.pzq.kei.mybluehost.me
2024-11-02 23:14
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:15:00 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pzq.kei.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:14:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.lyy.wev.mybluehost.me
2024-11-02 23:14
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:14:31 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trendzforlesslb.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:14:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-c7d6b3cd.ttr.bqv.mybluehost.me
2024-11-02 23:14
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:14:16 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:14:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ttr.bqv.mybluehost.me/website_c7d6b3cd/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ttr.bqv.mybluehost.me/website_c7d6b3cd/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ttr.bqv.mybluehost.me/website_c7d6b3cd/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lumie.site
2024-11-02 23:13
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:13:44 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:13:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Lumie — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Lumie — Coming Soon</title> <script src="https://lumie.site/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lumie.site/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lumie.site/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-00475774.ane.pzr.mybluehost.me
2024-11-02 23:13
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:13:46 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:13:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: hmbll — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>hmbll — Coming Soon</title> <script src="https://hmbll.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hmbll.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hmbll.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jen.jdq.mybluehost.me
2024-11-02 23:13
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:13:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 SG-F-Cache: BYPASS X-Redirect-By: WordPress Location: https://trevormusgrove.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.okl.nmy.mybluehost.me
2024-11-02 23:13
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:13:20 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://okl.nmy.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:13:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.alvinwayneweiss.com
2024-11-02 23:13
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:13:07 GMT Server: Apache Link: <https://www.alvinwayneweiss.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.andyrobinetmusic.com
2024-11-02 23:12
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:12:38 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lyy.wev.mybluehost.me
2024-11-02 23:12
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:12:28 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trendzforlesslb.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:12:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.gainthedifference.com
2024-11-02 23:12
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:12:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wwr.rbb.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:12:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · walkabouthills.paintedwolfmedia.com
2024-11-02 23:11
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:11:52 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://walkabouthills.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:11:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.texasdfwrealtor.com
2024-11-02 23:11
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:80 · new.adw.mybluehost.me
2024-11-02 23:11
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:11:22 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://blueforceoptics.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:11:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fblueforceoptics.com%2F; expires=Sat, 30 Nov 2024 23:11:22 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mlu.koc.mybluehost.me
2024-11-02 23:10
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:10:46 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://fitsumberhe.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://fitsumberhe.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; title="JSON"; type="application/json", <https://fitsumberhe.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:10:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.theirsilentscreams.com
2024-11-02 23:10
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:10:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://theirsilentscreams.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.rsc.keb.mybluehost.me
2024-11-02 23:09
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:09:46 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://innovations.zone/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=552a889a9ebf3bf050db0e1270be246a; expires=Tue, 05 Nov 2024 23:09:46 GMT; Max-Age=259200; path=/; domain=www.rsc.keb.mybluehost.me; HttpOnly
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vbk.wxk.mybluehost.me
2024-11-02 23:09
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:09:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://vbk.wxk.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:09:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ebq.rdx.mybluehost.me
2024-11-02 23:09
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:09:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://yeseveryoneeats.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:09:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.efsmi.com
2024-11-02 23:08
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:08:48 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://efsmi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · vip.sfg.mybluehost.me
2024-11-02 23:08
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:08:32 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sun, 03 Nov 2024 00:08:32 GMT Cache-Control: max-age=3600 X-LiteSpeed-Tag: 20c_HTTP.200,20c_HTTP.301,20c_HTTP.301 X-Redirect-By: WordPress Location: https://agriexotic.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · gnsenterprises.com.pk
2024-11-02 23:07
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:07:55 GMT Server: Apache Link: <https://gnsenterprises.com.pk/wp-json/>; rel="https://api.w.org/", <https://gnsenterprises.com.pk/wp-json/wp/v2/pages/13>; rel="alternate"; title="JSON"; type="application/json", <https://gnsenterprises.com.pk/>; rel=shortlink Server-Timing: wp-before-template;dur=1820.8 Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kristianireland.com
2024-11-02 23:07
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:07:47 GMT Server: Apache X-Pingback: https://www.kristianireland.com/xmlrpc.php Link: <https://www.kristianireland.com/wp-json/>; rel="https://api.w.org/", <https://www.kristianireland.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: KRISTIAN IRELAND » Site of composer Kristian Ireland. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en-US"> <head profile="http://gmpg.org/xfn/11"> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title>KRISTIAN IRELAND » Site of composer Kristian Ireland.</title> <link rel="stylesheet" href="https://www.kristianireland.com/wp-content/themes/crescendo/style.css" type="text/css" media="screen" /> <link rel="alternate" type="application/rss+xml" title="KRISTIAN IRELAND RSS Feed" href="https://www.kristianireland.com/feed/" /> <link rel="pingback" href="https://www.kristianireland.com/xmlrpc.php" /> <link rel="stylesheet" type="text/css" media="all" href="https://www.kristianireland.com/wp-content/themes/crescendo/slider.css" /> <link rel="stylesheet" type="text/css" media="all" href="https://www.kristianireland.com/wp-content/themes/crescendo/pagenavi.css" /> <link rel="stylesheet" type="text/css" media="all" href="https://www.kristianireland.com/wp-content/themes/crescendo/mainmenu.css" /> <link rel="stylesheet" type="text/css" media="all" href="https://www.kristianireland.com/wp-content/themes/crescendo/shortcodes.css" /> <link href='https://fonts.googleapis.com/css?family=Oswald' rel='stylesheet' type='text/css'> <script type="text/javascript" src="https://ajax.googleapis.com/ajax/libs/jquery/1/jquery.min.js"></script> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="KRISTIAN IRELAND » Composer Comments Feed" href="https://www.kristianireland.com/home/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.kristianireland.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.7.29"}}; !function(t,a,e){var r,n,i,o=a.createElement("canvas"),l=o.getContext&&o.getContext("2d");function c(t){var e=a.createElement("script");e.src=t,e.defer=e.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(e)}for(i=Array("flag","emoji4"),e.supports={everything:!0,everythingExceptFlag:!0},n=0;n<i.length;n++)e.supports[i[n]]=function(t){var e,a=String.fromCharCode;if(!l||!l.fillText)return!1;switch(l.clearRect(0,0,o.width,o.height),l.textBaseline="top",l.font="600 32px Arial",t){case"flag":return(l.fillText(a(55356,56826,55356,56819),0,0),o.toDataURL().length<3e3)?!1:(l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,65039,8205,55356,57096),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,55356,57096),0,0),e!==o.toDataURL());case"emoji4":return l.fillText(a(55357,56425,55356,57341,8205,55357,56507),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55357,56425,55356,57341,55357,56507),0,0),e!==o.toDataURL()}return!1}(i[n]),e.supports.everything=e.supports.everything&&e.supports[i[n]],"flag"!==i[n]&&(e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&e.supports[i[n]]);e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&!e.supports.flag,e.DOMReady=!1,e.readyCallback=function(){e.DOMReady=!0},e.supports.everything||(r=function(){e.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",r,!1),t.addEventListener("load",r,!1)):(t.attachEvent("onload",r),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&e.readyCallback()})),(r=e.source||{}).concatemoji?c(r.concatemoji):r.wpemoji&&r.twemoji&&(c(r.twemoji),c(r.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </stFound 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · happysoulwhotravels.com
2024-11-02 23:07
HTTP/1.1 404 Not Found Date: Sat, 02 Nov 2024 23:07:39 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://happysoulwhotravels.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Happy Soul Who Travels Page not found – Happy Soul Who Travels <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <title> Happy Soul Who Travels </title> <style> /** CSS Values 2 */ :root { --wb4wp-background: #ffffff; --wb4wp-background-stronger: #e6e6e6; --wb4wp-background-strongest: #cccccc; --wb4wp-background-lighter: #ffffff; --wb4wp-text-color: #212121; --wb4wp-text-color-softer: rgba( 33,33,33,0.75 ); --wb4wp-text-color-20: rgba(33, 33, 33, .2); --wb4wp-text-color-75: rgba(33, 33, 33, .75); --wb4wp-text-color-contrast: rgb(255, 255, 255); --wb4wp-accent1: #bb877c; --wb4wp-text-accent1: #212121; --wb4wp-text-accent1-softer: rgba( 33,33,33,0.75 ); --wb4wp-accent1-stronger: #a97a70; --wb4wp-title-accent1: #212121; --wb4wp-title-accent1-text: #ffffff; --wb4wp-accent2: #8bd4e0; --wb4wp-text-accent2: #000000; --wb4wp-text-accent2-softer: rgba( 0,0,0,0.75 ); --wb4wp-accent2-stronger: #7ebfca; --wb4wp-title-accent2: #212121; --wb4wp-primary-color: #212121; --wb4wp-primary-color-text: #ffffff; --wb4wp-primary-color-light: #383838; --wb4wp-primary-color-lighter: #4e4e4e; --wb4wp-primary-color-lightest: #909090; --wb4wp-primary-color-border: rgb(255,255,255,.1); --wb4wp-primary-color-stronger: #000000; --wb4wp-border-color: rgba(0,0,0,0.1); --wb4wp-font-body: 'Source Serif Pro'; --wb4wp-font-body-weight: 400; --wb4wp-font-heading: 'Princess Sofia'; --wb4wp-font-heading-weight: 400; --wb4wp-font-size-override: 100%; --wb4wp-font-size-factor: 1; } body #page.kv-site .kv-page-content { --kv-ee-global-font-size-factor: var(--wb4wp-font-size-factor); --kv-ee-heading-font-family: var(--wb4wp-font-heading); --kv-ee-heading-font-weight: var(--wb4wp-font-heading-weight); --kv-ee-body-font-family: var(--wb4wp-font-body); --kv-ee-body-font-weight: var(--wb4wp-font-body-weight); } </style> <link rel='stylesheet' href='https://fonts.googleapis.com/css?display=swap&family=Source+Serif+Pro:400|Princess+Sofia:400' /> <title>Page not found – Happy Soul Who Travels</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/happysoulwhotravels.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · androidrobotproductions.com
2024-11-02 23:07
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:07:15 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.androidrobotproductions.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rat.lnr.mybluehost.me
2024-11-02 23:07
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.perspectivesireland.perspectivesireland.ie
2024-11-02 23:06
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:06:56 GMT Server: Apache X-UA-Compatible: IE=edge Access-Control-Allow-Origin: https://app.hu-manity.co Access-Control-Allow-Methods: GET X-Redirect-By: WordPress Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.perspectivesireland.com%2F; expires=Sat, 30 Nov 2024 23:07:01 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: wcpay_currency=EUR_1; expires=Sun, 03 Nov 2024 00:07:01 GMT; Max-Age=3600; path=/ Set-Cookie: wcpay_currency=EUR_1; expires=Sun, 03 Nov 2024 00:07:01 GMT; Max-Age=3600; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.perspectivesireland.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.alisonarcher.com.au
2024-11-02 23:06
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:06:34 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alisonarcher.com.au/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:06:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hkr.vcj.mybluehost.me
2024-11-02 23:06
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:06:29 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://preachfromthehousetops.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:11:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.nateharrison.com
2024-11-02 23:06
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:06:28 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nateharrison.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:06:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.uhm.zca.mybluehost.me
2024-11-02 23:06
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:06:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://josefinarecruitment.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:06:25 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sovereigncapitalnyc.com
2024-11-02 23:06
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:06:09 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://www.sovereigncapitalnyc.com/wp-json/>; rel="https://api.w.org/", <https://www.sovereigncapitalnyc.com/wp-json/wp/v2/pages/49>; rel="alternate"; title="JSON"; type="application/json", <https://www.sovereigncapitalnyc.com/>; rel=shortlink Set-Cookie: PHPSESSID=ca471e0c1e2daa0f12be69a5542ccce6; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.somewhatfair.com
2024-11-02 23:06
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:06:08 GMT Server: Apache Link: <https://somewhatfair.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://somewhatfair.com/index.php?rest_route=/wp/v2/pages/61>; rel="alternate"; title="JSON"; type="application/json", <https://somewhatfair.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: SOMEWHAT FAIR <!DOCTYPE html> <html lang="en-US" itemscope itemtype="https://schema.org/WebPage"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>SOMEWHAT FAIR</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//somewhatfair.com' /> <link rel='dns-prefetch' href='//patterns.hiive.cloud' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="SOMEWHAT FAIR » Feed" href="https://somewhatfair.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="SOMEWHAT FAIR » Comments Feed" href="https://somewhatfair.com/?feed=comments-rss2" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v9.2.1 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No tracking code set --> <!-- / Google Analytics by MonsterInsights --> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/somewhatfair.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythiFound 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · eyesightfoundation-org.sponteconsulting.com
2024-11-02 23:06
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:06:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eyesightfoundation.org/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:11:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jtt.okl.mybluehost.me
2024-11-02 23:06
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:06:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:06:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: MotherhoodLaborandLove — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>MotherhoodLaborandLove — Coming Soon</title> <script src="https://motherhoodlaborandlove.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://motherhoodlaborandlove.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://motherhoodlaborandlove.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lexonenterprises.com
2024-11-02 23:05
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:05:11 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://lexonenterprises.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:05:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · catstealers.com
2024-11-02 23:04
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:04:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://catstealers.com/wp-json/>; rel="https://api.w.org/", <https://catstealers.com/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://catstealers.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:04:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lbo.lnl.mybluehost.me
2024-11-02 23:04
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:04:16 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://ainttooproudtomeg.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:09:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-c7d6b3cd.ttr.bqv.mybluehost.me
2024-11-02 23:03
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:03:59 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:03:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ttr.bqv.mybluehost.me/website_c7d6b3cd/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ttr.bqv.mybluehost.me/website_c7d6b3cd/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ttr.bqv.mybluehost.me/website_c7d6b3cd/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ibfafoundation.com
2024-11-02 23:03
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:03:46 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://ibfafoundation.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://ibfafoundation.com/index.php?rest_route=/wp/v2/pages/23>; rel="alternate"; title="JSON"; type="application/json", <https://ibfafoundation.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:03:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.okl.nmy.mybluehost.me
2024-11-02 23:03
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:03:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:03:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://okl.nmy.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://okl.nmy.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://okl.nmy.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · aquarellegranite.com
2024-11-02 23:02
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:02:24 GMT Server: Apache Link: <https://aquarellegranite.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://aquarellegranite.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; title="JSON"; type="application/json", <https://aquarellegranite.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · stowetrails-org.stowe-trails.com
2024-11-02 23:02
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:02:05 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:02:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wikiactivism.com
2024-11-02 23:01
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:02:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block Expires: Sun, 03 Nov 2024 00:02:02 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://wikiactivism.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tribewoman.com
2024-11-02 23:01
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:02:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://tribewoman.com/wp-json/>; rel="https://api.w.org/", <https://tribewoman.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://tribewoman.com/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mtn.xem.mybluehost.me
2024-11-02 23:01
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:01:58 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nateharrison.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:01:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rln.bur.mybluehost.me
2024-11-02 23:01
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:01:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Strict-Transport-Security: max-age=31536000; X-XSS-Protection: 0 X-Content-Type-Options: nosniff Referrer-Policy: strict-origin-when-cross-origin Content-Security-Policy: upgrade-insecure-requests; Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://phoenixdpi.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:01:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wgb.oha.mybluehost.me
2024-11-02 23:01
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:01:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:01:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://wgb.oha.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://wgb.oha.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://wgb.oha.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.marksolomon.net
2024-11-02 23:00
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:01:01 GMT Server: nginx/1.25.5 Content-Type: text/html Content-Length: 6940 Last-Modified: Fri, 22 Jan 2021 22:38:07 GMT Accept-Ranges: bytes Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Page title: Home | MarkSolomon.net <!DOCTYPE html> <html lang="en"> <head> <!-- Required meta tags always come first --> <meta charset="utf-8"> <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no"> <meta http-equiv="x-ua-compatible" content="ie=edge"> <!-- Head content such as meta tags and encoding options, etc --> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <meta name="author" content="Joel Solomon" /> <meta name="title" content="Mark Solomon.net: editor, consultant, and teacher" /> <meta name="keywords" content="editor, consultant, MarkSolomon, Mark Solomon, marksolomon, mark solomon, Frankenweenie, Chicken Run, Sgt Stubby" /> <meta name="description" content="Mark Solomon Portfolio: editor, consultant, teacher" /> <meta name="robots" content="index, follow" /> <!-- User defined head content --> <!-- Browser title --> <title>Home | MarkSolomon.net</title> <!-- Main Theme Stylesheet --> <link rel="stylesheet" type="text/css" media="all" href="rw_common/themes/Foundry/consolidated.css?rwcache=633047859" /> <!-- RapidWeaver Color Picker Stylesheet --> <!-- Plugin injected code --> <link rel='stylesheet' type='text/css' media='all' href='rw_common/plugins/stacks/stacks.css?rwcache=633047859' /> <link rel='stylesheet' type='text/css' media='all' href='files/stacks_page_page5.css?rwcache=633047859' /> <script type='text/javascript' charset='utf-8' src='rw_common/plugins/stacks/jquery-2.2.4.min.js?rwcache=633047859'></script> <link rel="stylesheet" href="rw_common/plugins/stacks/font-awesome.min.css?rwcache=633047859"> <script type='text/javascript' charset='utf-8' src='files/stacks_page_page5.js?rwcache=633047859'></script> <meta name="formatter" content="Stacks v4.1.4 (5385)" > <meta class="stacks4 stack version" id="com.elixir.stacks.foundry" name="Foundry" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.yuzoolthemes.stacks.navigation" name="Navigation" content="1.3.9"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryBanner" name="Banner" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryHeader" name="Header" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryContainer" name="Container" content="1.3.4.4"> </head> <body class="antialiased"> <div class="blur_wrapper"> <div id='stacks_out_1' class='stacks_top'><div id='stacks_in_1' class=''><div id='stacks_out_20' class='stacks_out'><div id='stacks_in_20' class='stacks_in com_elixir_stacks_foundry_stack'> <!-- Foundry --> </div></div><div id='stacks_out_21' class='stacks_out'><div id='stacks_in_21' class='stacks_in com_yuzoolthemes_stacks_navigation_stack'> <!-- GFL --> <script src="https://ajax.googleapis.com/ajax/libs/webfont/1.6.16/webfont.js"></script> <script> WebFont.load({ google: { families: ['Oswald', 'Open Sans','Ubuntu','Roboto','Oxygen','Orbitron'] } }); </script> <!-- /GFL --> <!-- MENU HTML --> <div id="stacks_in_21" class="fixed"> <div id="fnav" class="fnav"> <div id="max-width-nav"> <ul><li class="Selected"><a href="./" rel="" class="nav_item nav_active">Home</a></li><li><a href="page-3/" rel="" class="nav_item">Editor</a></li><li><a href="page/" rel="" class="nav_item">Consultant</a></li><li><a href="page-2/" rel="" class="nav_item">Teacher</a></li><li><a href="page-4/" rel="" class="nav_item">About Me</a></li></ul> </div> </div> </div> <!-- /MENU HTML --> </div></div><div id='stacks_out_5' class='stacks_out'><div id='stacks_in_5' class='stacks_in com_elixir_stacks_foundryBanner_stack'> <div class="nav_pairing"> <div class="banner"> <div class="banner_inner"> <div class="banner_content"> <div class="container-fluid"> <div id='stacks_out_35' class='stacks_out'><div id='stacks_in_35' class='stacks_in image_stack'> <div class='centered_image' > <img class='imageStyle' src='files/stacks-image-ba7cd42.png' alt='Stacks Image 36' /> <Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.suncoastbaptistchurch.info
2024-11-02 23:00
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 23:00:41 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://suncoastbaptistchurch.info/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 23:05:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lereveluxury.com
2024-11-02 23:00
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 23:00:10 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 01:00:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Lereveluxury.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Lereveluxury.com — Coming Soon</title> <script src="https://lereveluxury.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lereveluxury.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lereveluxury.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-287d5d33.naa.ixy.mybluehost.me
2024-11-02 22:59
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:59:33 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alisonarcher.com.au/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:59:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.orchardhillschristianacademy.com
2024-11-02 22:57
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:57:57 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://orchardhillschristianacademy.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://orchardhillschristianacademy.com/index.php?rest_route=/wp/v2/pages/32>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/P7A0gs-w>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.opandc.com
2024-11-02 22:57
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:57:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://opandc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mhv.rbb.mybluehost.me
2024-11-02 22:57
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:57:34 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://studiobelardo.tech/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:57:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-f0ddad42.ppd.ssy.mybluehost.me
2024-11-02 22:57
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:57:16 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://newhopecounselingonline.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:57:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · rofaendurance.td2travelsandadventures.com
2024-11-02 22:57
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:57:06 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://rofaendurance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=cb97dcc61b7cf6098c3563d6d77e298f; path=/
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.avisofitness.com
2024-11-02 22:56
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:56:45 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://avisofitness.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:56:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · olivetreetales.mindyourown.life
2024-11-02 22:56
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:56:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://olivetreetales.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:56:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.rhextranslations.com
2024-11-02 22:56
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:56:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://rhextranslations.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:56:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.alicethomsen.com
2024-11-02 22:56
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:56:08 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://www.alicethomsen.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/2nrFA>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.independentmusicproduction.com
2024-11-02 22:55
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:55:04 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://independentmusicproduction.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · new.adw.mybluehost.me
2024-11-02 22:54
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:54:46 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://blueforceoptics.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:54:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fblueforceoptics.com%2F; expires=Sat, 30 Nov 2024 22:54:46 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kismetmind.com
2024-11-02 22:53
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:54:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kismetmind.com/wp-json/>; rel="https://api.w.org/", <https://kismetmind.com/wp-json/wp/v2/pages/1012>; rel="alternate"; title="JSON"; type="application/json", <https://kismetmind.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:58:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-0509403a.ccl-us.org
2024-11-02 22:53
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:53:53 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:53:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: stemnetx-test — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>stemnetx-test — Coming Soon</title> <script src="https://ccl-us.org/website_0509403a/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ccl-us.org/website_0509403a/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ccl-us.org/website_0509403a/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.clarivatepublications.zbo.pfi.mybluehost.me
2024-11-02 22:53
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:53:41 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Set-Cookie: PHPSESSID=687030d5b5ca08d5e08f242d09f0e93b; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-6079b47d.wqb.fgc.mybluehost.me
2024-11-02 22:53
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:53:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://georgiaparis.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:53:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mobiushome.com
2024-11-02 22:53
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:53:33 GMT Server: Apache Expires: Sat, 02 Nov 2024 23:53:35 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://mobiushome.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.tny.vtl.mybluehost.me
2024-11-02 22:53
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:53:33 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:53:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tny.vtl.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tny.vtl.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tny.vtl.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hbc.mlg.mybluehost.me
2024-11-02 22:53
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:53:06 GMT Server: Apache Link: <https://www.thinkdigitalmatter.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.thinkdigitalmatter.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.thinkdigitalmatter.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: DigitalMatter LLC – the structure and properties of matter <!DOCTYPE html> <html lang="en-US" class="no-js"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <link rel="profile" href="https://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.thinkdigitalmatter.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.thinkdigitalmatter.com/wp-content/themes/twentyfifteen/js/html5.js?ver=3.7.0"></script> <![endif]--> <script>(function(html){html.className = html.className.replace(/\bno-js\b/,'js')})(document.documentElement);</script> <title>DigitalMatter LLC – the structure and properties of matter</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.thinkdigitalmatter.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link href='https://fonts.gstatic.com' crossorigin rel='preconnect' /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Feed" href="https://www.thinkdigitalmatter.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Comments Feed" href="https://www.thinkdigitalmatter.com/?feed=comments-rss2" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.thinkdigitalmatter.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFound 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · npv.lil.mybluehost.me
2024-11-02 22:51
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:51:19 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mindyourown.life/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.salishseadiatoms.com
2024-11-02 22:50
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:50:24 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://salishseadiatoms.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:50:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.erinnkdaniel.vmr.arb.mybluehost.me
2024-11-02 22:50
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:50:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://erinnkdaniel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:50:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · gagereviews.com
2024-11-02 22:49
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:49:53 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://gagereviews.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:54:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.sai.sbv.mybluehost.me
2024-11-02 22:49
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:49:47 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://blucapinvest.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:49:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.adventureandeat.com
2024-11-02 22:49
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:49:44 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://adventureandeat.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:54:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · adventureandeat.com
2024-11-02 22:49
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:49:44 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://adventureandeat.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/9Bgit>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:54:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.eurohairprosalon.com
2024-11-02 22:49
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:49:39 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.eurohairprosalon.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wundexperte-koeln-de.krankenpflegemiller.com
2024-11-02 22:49
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:49:29 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wundexperte-koeln.de/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:49:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.blueboxsoftware.net
2024-11-02 22:49
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:49:17 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://blueboxsoftware.net/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:54:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cliffsideengineering.com
2024-11-02 22:49
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:49:18 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://cliffsideengineering.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:49:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.medicareplansrx.blueandgrayfinancial.com
2024-11-02 22:49
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:49:15 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=65f3dbb13a5aec05969a6568d1df96c2; path=/; secure; HttpOnly Upgrade: h2,h2c Connection: Upgrade, close Location: https://medicareplansrx.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · josefinarecruitment.com
2024-11-02 22:48
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:49:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://josefinarecruitment.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:49:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mygeotokens.com
2024-11-02 22:46
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:46:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sat, 02 Nov 2024 23:46:14 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://mygeotokens.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.inmyteam.com
2024-11-02 22:45
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:45:34 GMT Server: Apache Link: <https://www.inmyteam.com/wp-json/>; rel="https://api.w.org/", <https://www.inmyteam.com/wp-json/wp/v2/pages/12>; rel="alternate"; type="application/json", <https://www.inmyteam.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · zzj.etw.mybluehost.me
2024-11-02 22:45
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:45:31 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mya1tc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jff.lnl.mybluehost.me
2024-11-02 22:45
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:45:21 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.inmyteam.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.stowemountainbike.stowe-trails.com
2024-11-02 22:45
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:45:22 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:45:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jff.lnl.mybluehost.me
2024-11-02 22:45
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:45:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.inmyteam.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kpb.goj.mybluehost.me
2024-11-02 22:45
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:45:12 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 31 Oct 2034 22:45:15 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://nathaliewallcoaching.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:45:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · bfftestprep.com
2024-11-02 22:44
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:45:01 GMT Server: Apache Link: <https://bfftestprep.com/wp-json/>; rel="https://api.w.org/", <https://bfftestprep.com/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://bfftestprep.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · writeesasyeails.com
2024-11-02 22:44
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:44:49 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://writeesasyeails.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:44:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · reliablessinc.com
2024-11-02 22:44
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:44:40 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.reliablessinc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ascendingarrows.com
2024-11-02 22:44
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:44:39 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://www.ascendingarrows.com/wp-json/>; rel="https://api.w.org/", <https://www.ascendingarrows.com/wp-json/wp/v2/pages/230>; rel="alternate"; title="JSON"; type="application/json", <https://www.ascendingarrows.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:49:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-d736f01b.azh.jzw.mybluehost.me
2024-11-02 22:44
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:44:30 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: edb_HTTP.200,edb_HTTP.301 X-Redirect-By: WordPress Location: https://norm-macdonald.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:44:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.adroitlivingtp.com
2024-11-02 22:44
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:44:14 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://adroitlivingtp.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:44:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-7a584425.partnersdigitalmarketing.com
2024-11-02 22:44
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:44:13 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.akn907.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lesliesbookcase.com
2024-11-02 22:43
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:43:50 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: 58d_HTTP.200 Link: <https://lesliesbookcase.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/7A0b8>; rel=shortlink Vary: accept,content-type,Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kma-spotlight.com
2024-11-02 22:43
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:43:40 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://kma-spotlight.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:48:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kianaturally.com
2024-11-02 22:43
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:43:32 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Link: <https://kianaturally.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:43:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.loapioneers.com
2024-11-02 22:43
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:43:25 GMT Server: Apache Link: <https://www.loapioneers.com/wp-json/>; rel="https://api.w.org/", <https://www.loapioneers.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.loapioneers.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.justingolding.com
2024-11-02 22:43
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:43:25 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://justingolding.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rachana.io
2024-11-02 22:42
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:42:12 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rachana.io/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:42:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · indispensabilitypro.com
2024-11-02 22:41
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:42:02 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:41:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Coaching & Keynote Speaking — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Coaching & Keynote Speaking — Coming Soon</title> <script src="https://indispensabilitypro.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://indispensabilitypro.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://indispensabilitypro.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ujimacultureproject.com
2024-11-02 22:41
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:41:58 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ujimacultureproject.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:41:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.perspectivesireland.com
2024-11-02 22:41
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:41:31 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://www.perspectivesireland.com/wp-json/>; rel="https://api.w.org/", <https://www.perspectivesireland.com/wp-json/wp/v2/pages/839>; rel="alternate"; title="JSON"; type="application/json", <https://www.perspectivesireland.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.perspectivesireland.com%2F; expires=Sat, 30 Nov 2024 22:41:30 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: PHPSESSID=a7104b8d8e718b10c44211af325c4929; path=/ Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.doxentrics.com
2024-11-02 22:41
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:41:23 GMT Server: Apache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://doxentrics.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:41:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ennvisionn.com
2024-11-02 22:41
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:41:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ennvisionn.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:46:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thecaptainjerry.com
2024-11-02 22:41
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:41:07 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thecaptainjerry.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:46:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.theohlab.com
2024-11-02 22:40
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:40:34 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.theohlab.com/wp-json/>; rel="https://api.w.org/", <https://www.theohlab.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PbdGeO-5>; rel=shortlink Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:40:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · plugovoyhistory.com
2024-11-02 22:40
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:40:31 GMT Server: Apache Link: <https://plugovoyhistory.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://plugovoyhistory.com/index.php?rest_route=/wp/v2/pages/230>; rel="alternate"; title="JSON"; type="application/json", <https://plugovoyhistory.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.changeskills.thementoringprogram.com
2024-11-02 22:40
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:40:31 GMT Server: Apache X-Cache-Enabled: True X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://changeskills.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:45:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.agriexotic.com
2024-11-02 22:40
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:40:15 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sat, 02 Nov 2024 23:40:15 GMT Cache-Control: max-age=3600 X-LiteSpeed-Tag: 20c_HTTP.200,20c_HTTP.301,20c_HTTP.301 X-Redirect-By: WordPress Location: https://agriexotic.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mygeotokens.mindyourown.life
2024-11-02 22:40
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:40:08 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sat, 02 Nov 2024 23:40:08 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://mygeotokens.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.boudman.boudman.com
2024-11-02 22:39
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:40:00 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 31 Oct 2034 22:40:01 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:40:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: boudman — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>boudman — Coming Soon</title> <script src="https://boudman.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://boudman.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://boudman.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ane.pzr.mybluehost.me
2024-11-02 22:39
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:39:54 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:39:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: USCIES — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>USCIES — Coming Soon</title> <script src="https://uscies.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://uscies.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.13.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://uscies.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.preachfromthehousetops.com
2024-11-02 22:39
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:39:54 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://preachfromthehousetops.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:44:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wildlyfaithfulwomen.vmr.arb.mybluehost.me
2024-11-02 22:39
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:39:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wildlyfaithfulwomen.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:39:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · sunpring.sunpringextruder.com
2024-11-02 22:39
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:39:37 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sat, 02 Nov 2024 23:39:37 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://sunpring.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cotapult.wewalkwithyou.com
2024-11-02 22:38
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:39:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:44:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Cotapult Pte Ltd — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Cotapult Pte Ltd — Coming Soon</title> <script src="https://cotapult.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cotapult.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cotapult.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.intuitivehealthma.com
2024-11-02 22:38
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:39:03 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://www.intuitivehealthma.com/wp-json/>; rel="https://api.w.org/", <https://www.intuitivehealthma.com/wp-json/wp/v2/pages/19>; rel="alternate"; title="JSON"; type="application/json", <https://www.intuitivehealthma.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:44:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.efectoresponsable-pe.karlosperu.com
2024-11-02 22:38
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:38:48 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://efectoresponsable.pe/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.offer.partnersdigitalmarketing.com
2024-11-02 22:38
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:38:38 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://offer.partnersdigitalmarketing.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.littleocean.dynamicsmachines.com
2024-11-02 22:38
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:38:25 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://littleocean.dynamicsmachines.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · uuq.xxm.mybluehost.me
2024-11-02 22:38
HTTP/1.1 200 OK Date: Sat, 02 Nov 2024 22:38:23 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:38:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://uuq.xxm.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://uuq.xxm.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.15.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://uuq.xxm.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.qcs.mwd.mybluehost.me
2024-11-02 22:38
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:38:26 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://oftenplusneverminus.com/ Cache-Control: max-age=7200 Expires: Sun, 03 Nov 2024 00:38:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
-
Open service 162.241.226.40:443 · intuitivehealthma.com
2024-11-02 22:37
HTTP/1.1 301 Moved Permanently Date: Sat, 02 Nov 2024 22:37:40 GMT Server: nginx/1.25.5 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.intuitivehealthma.com/ Cache-Control: max-age=300 Expires: Sat, 02 Nov 2024 22:42:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2024-11-02 by HttpPluginCreate report
cpanel.smalimousine.comcpcalendars.smalimousine.comcpcontacts.smalimousine.commail.smalimousine.comsmalimousine.comwebdisk.smalimousine.comwebmail.smalimousine.comwebsite-8380379f.hjy.jyk.mybluehost.mewww.smalimousine.comwww.website-8380379f.hjy.jyk.mybluehost.me
autodiscover.qru.jgb.mybluehost.mecpanel.qru.jgb.mybluehost.mecpcalendars.qru.jgb.mybluehost.mecpcontacts.qru.jgb.mybluehost.memail.premics.commail.qru.jgb.mybluehost.mepremics.comqru.jgb.mybluehost.mewebdisk.qru.jgb.mybluehost.mewebmail.qru.jgb.mybluehost.mewww.premics.comwww.qru.jgb.mybluehost.me
autodiscover.eliece.commail.eliece.comwebmail.eliece.com
autodiscover.salishseadiatoms.comcpanel.salishseadiatoms.comcpcalendars.salishseadiatoms.comcpcontacts.salishseadiatoms.commail.salishseadiatoms.comsalishseadiatoms.bludesigns.casalishseadiatoms.comwebdisk.salishseadiatoms.comwebmail.salishseadiatoms.comwww.salishseadiatoms.bludesigns.cawww.salishseadiatoms.com
autodiscover.galenetherapy.comcpanel.galenetherapy.comcpcalendars.galenetherapy.comcpcontacts.galenetherapy.comgalenetherapy.commail.galenetherapy.comwebdisk.galenetherapy.comwebmail.galenetherapy.comwebsite-2e15c7d2.yourstudydoctor.comwww.galenetherapy.comwww.website-2e15c7d2.yourstudydoctor.com
autodiscover.zul.uqp.mybluehost.mecpanel.zul.uqp.mybluehost.mecpcalendars.zul.uqp.mybluehost.mecpcontacts.zul.uqp.mybluehost.memail.neighboravenue.commail.zul.uqp.mybluehost.meneighboravenue.comwebdisk.zul.uqp.mybluehost.mewebmail.zul.uqp.mybluehost.mewww.neighboravenue.comwww.zul.uqp.mybluehost.mezul.uqp.mybluehost.me
andyrobinetguitar.androidrobotproductions.comandyrobinetguitar.comandyrobinetmusic.androidrobotproductions.comandyrobinetmusic.comautodiscover.andyrobinetguitar.comautodiscover.andyrobinetmusic.comcpanel.andyrobinetguitar.comcpanel.andyrobinetmusic.comcpcalendars.andyrobinetguitar.comcpcalendars.andyrobinetmusic.comcpcontacts.andyrobinetguitar.comcpcontacts.andyrobinetmusic.commail.andyrobinetguitar.commail.andyrobinetmusic.comwebdisk.andyrobinetguitar.comwebdisk.andyrobinetmusic.comwebmail.andyrobinetguitar.comwebmail.andyrobinetmusic.comwww.andyrobinetguitar.androidrobotproductions.comwww.andyrobinetguitar.comwww.andyrobinetmusic.androidrobotproductions.comwww.andyrobinetmusic.com
politics.nnhsclubs.comwww.politics.nnhsclubs.com
autodiscover.lightsoutbbq.comcpanel.lightsoutbbq.comcpcalendars.lightsoutbbq.comcpcontacts.lightsoutbbq.comlightsoutbbq.commail.lightsoutbbq.comwebdisk.lightsoutbbq.comwebmail.lightsoutbbq.comwww.lightsoutbbq.com
autodiscover.jkcornett.comcpanel.jkcornett.comcpcalendars.jkcornett.comcpcontacts.jkcornett.comjkcornett.commail.jkcornett.comthewholepetdiet.comthewholepetdiet.jkcornett.comwebdisk.jkcornett.comwebmail.jkcornett.comwpd.jkcornett.comwww.jkcornett.comwww.thewholepetdiet.comwww.thewholepetdiet.jkcornett.comwww.wpd.jkcornett.com
autodiscover.harryvourtsis.comcpanel.harryvourtsis.comcpcalendars.harryvourtsis.comcpcontacts.harryvourtsis.comharryvourtsis.commail.harryvourtsis.comwebdisk.harryvourtsis.comwebmail.harryvourtsis.comwww.harryvourtsis.com
alisongifford.comalisongifford.yourstudydoctor.comautodiscover.alisongifford.comautodiscover.personalconfidencecode.comcpanel.alisongifford.comcpanel.personalconfidencecode.comcpcalendars.alisongifford.comcpcalendars.personalconfidencecode.comcpcontacts.alisongifford.comcpcontacts.personalconfidencecode.commail.alisongifford.commail.personalconfidencecode.compersonalconfidencecode.compersonalconfidencecode.yourstudydoctor.comwebdisk.alisongifford.comwebdisk.personalconfidencecode.comwebmail.alisongifford.comwebmail.personalconfidencecode.comwww.alisongifford.comwww.alisongifford.yourstudydoctor.comwww.personalconfidencecode.comwww.personalconfidencecode.yourstudydoctor.com
autodiscover.onwhatwings.comcpanel.onwhatwings.comcpcalendars.onwhatwings.comcpcontacts.onwhatwings.commail.onwhatwings.comonwhatwings.comwebdisk.onwhatwings.comwebmail.onwhatwings.comwww.onwhatwings.com
autodiscover.kimberlysdesignstudio.comcpanel.kimberlysdesignstudio.comcpcalendars.kimberlysdesignstudio.comcpcontacts.kimberlysdesignstudio.comkimberlysdesignstudio.commail.kimberlysdesignstudio.comwebdisk.kimberlysdesignstudio.comwebmail.kimberlysdesignstudio.comwww.kimberlysdesignstudio.com
autodiscover.dietarycafe.comautodiscover.sunmul-gift.comcpanel.dietarycafe.comcpanel.sunmul-gift.comcpcalendars.dietarycafe.comcpcalendars.sunmul-gift.comcpcontacts.dietarycafe.comcpcontacts.sunmul-gift.comdietarycafe.comdietarycafe.sunmulgift.commail.dietarycafe.commail.sunmul-gift.comsunmul-gift.comsunmul-gift.sunmulgift.comwebdisk.dietarycafe.comwebdisk.sunmul-gift.comwebmail.dietarycafe.comwebmail.sunmul-gift.comwww.dietarycafe.comwww.dietarycafe.sunmulgift.comwww.sunmul-gift.comwww.sunmul-gift.sunmulgift.com
autodiscover.uni.jvd.mybluehost.mecpanel.uni.jvd.mybluehost.mecpcalendars.uni.jvd.mybluehost.mecpcontacts.uni.jvd.mybluehost.memail.uni.jvd.mybluehost.meuni.jvd.mybluehost.mewebdisk.uni.jvd.mybluehost.mewebmail.uni.jvd.mybluehost.mewww.uni.jvd.mybluehost.me
autodiscover.hollybrunelle.comcpanel.hollybrunelle.comcpcalendars.hollybrunelle.comcpcontacts.hollybrunelle.comhollybrunelle.commail.hollybrunelle.comwebdisk.hollybrunelle.comwebmail.hollybrunelle.comwww.hollybrunelle.com
autodiscover.churchannouncementsolutions.comchurchannouncementsolutions.comcpanel.churchannouncementsolutions.comcpcalendars.churchannouncementsolutions.comcpcontacts.churchannouncementsolutions.commail.churchannouncementsolutions.commail.tyd.skj.mybluehost.metyd.skj.mybluehost.mewebdisk.churchannouncementsolutions.comwebmail.churchannouncementsolutions.comwww.churchannouncementsolutions.comwww.tyd.skj.mybluehost.me
perspectivesireland.comwww.perspectivesireland.com
autodiscover.cstalks.orgcpanel.cstalks.orgcpcalendars.cstalks.orgcpcontacts.cstalks.orgcstalks.orgmail.cstalks.orgwebdisk.cstalks.orgwebmail.cstalks.orgwww.cstalks.org
autodiscover.lusty-store.comcpanel.lusty-store.comcpcalendars.lusty-store.comcpcontacts.lusty-store.comlusty-store.comlusty-store.keyawagroup.commail.lusty-store.comwebdisk.lusty-store.comwebmail.lusty-store.comwww.lusty-store.comwww.lusty-store.keyawagroup.com
autodiscover.sju.aef.mybluehost.mecpanel.sju.aef.mybluehost.mecpcalendars.sju.aef.mybluehost.mecpcontacts.sju.aef.mybluehost.memail.mavila.pemail.sju.aef.mybluehost.memavila.pesju.aef.mybluehost.mewebdisk.sju.aef.mybluehost.mewebmail.sju.aef.mybluehost.mewww.mavila.pewww.sju.aef.mybluehost.me
springerspublications-co-uk.zbo.pfi.mybluehost.mewww.springerspublications-co-uk.zbo.pfi.mybluehost.me
autodiscover.nutu.atcpanel.nutu.atcpcalendars.nutu.atcpcontacts.nutu.atmail.nutu.atnutu.atwebdisk.nutu.atwebmail.nutu.atwww.nutu.at
autodiscover.tlk.rfl.mybluehost.mecpanel.tlk.rfl.mybluehost.mecpcalendars.tlk.rfl.mybluehost.mecpcontacts.tlk.rfl.mybluehost.megeogroupcorrections.commail.tlk.rfl.mybluehost.metlk.rfl.mybluehost.mewebdisk.tlk.rfl.mybluehost.mewebmail.tlk.rfl.mybluehost.mewww.geogroupcorrections.comwww.tlk.rfl.mybluehost.me
autodiscover.rachana.iocpanel.rachana.iocpcalendars.rachana.iocpcontacts.rachana.iomail.rachana.iorachana.iowebdisk.rachana.iowebmail.rachana.iowebsite-e95c4881.ane.pzr.mybluehost.mewww.rachana.iowww.website-e95c4881.ane.pzr.mybluehost.me
autodiscover.erinkdaniel.comcpanel.erinkdaniel.comcpcalendars.erinkdaniel.comcpcontacts.erinkdaniel.comerinkdaniel.commail.erinkdaniel.comwebdisk.erinkdaniel.comwebmail.erinkdaniel.comwebsite-69d89cfd.vmr.arb.mybluehost.mewww.erinkdaniel.comwww.website-69d89cfd.vmr.arb.mybluehost.me
accountmanager.dynamicsmachines.comafaqhomeschool.dynamicsmachines.comerpdemo.dynamicsmachines.comobd.dynamicsmachines.comwallet.dynamicsmachines.comwww.accountmanager.dynamicsmachines.comwww.afaqhomeschool.dynamicsmachines.comwww.erpdemo.dynamicsmachines.comwww.obd.dynamicsmachines.comwww.wallet.dynamicsmachines.com
66days.coautodiscover.66days.cocpanel.66days.cocpcalendars.66days.cocpcontacts.66days.comail.66days.cowebdisk.66days.cowebmail.66days.cowww.66days.co
autodiscover.kpb.goj.mybluehost.mecpanel.kpb.goj.mybluehost.mecpcalendars.kpb.goj.mybluehost.mecpcontacts.kpb.goj.mybluehost.mekpb.goj.mybluehost.memail.kpb.goj.mybluehost.mewebdisk.kpb.goj.mybluehost.mewebmail.kpb.goj.mybluehost.mewww.kpb.goj.mybluehost.me
autodiscover.partnersdigitalmarketing.comcpanel.partnersdigitalmarketing.comcpcalendars.partnersdigitalmarketing.comcpcontacts.partnersdigitalmarketing.comlkk.shn.mybluehost.memail.lkk.shn.mybluehost.memail.partnersdigitalmarketing.compartnersdigitalmarketing.comwebdisk.partnersdigitalmarketing.comwebmail.partnersdigitalmarketing.comwww.lkk.shn.mybluehost.mewww.partnersdigitalmarketing.com
autodiscover.hgu.aqd.mybluehost.mecpanel.hgu.aqd.mybluehost.mecpcalendars.hgu.aqd.mybluehost.mecpcontacts.hgu.aqd.mybluehost.mehgu.aqd.mybluehost.memail.hgu.aqd.mybluehost.memail.uppercrustvegan.comuppercrustvegan.comwebdisk.hgu.aqd.mybluehost.mewebmail.hgu.aqd.mybluehost.mewww.hgu.aqd.mybluehost.mewww.uppercrustvegan.com
autodiscover.cotapult.comcotapult.comcotapult.wewalkwithyou.comcpanel.cotapult.comcpcalendars.cotapult.comcpcontacts.cotapult.comwebdisk.cotapult.comwebmail.cotapult.comwww.cotapult.comwww.cotapult.wewalkwithyou.com
cpanel.wundexperte-koeln.decpcalendars.wundexperte-koeln.decpcontacts.wundexperte-koeln.demail.wundexperte-koeln.dewebdisk.wundexperte-koeln.dewebmail.wundexperte-koeln.dewundexperte-koeln-de.krankenpflegemiller.comwundexperte-koeln.dewww.wundexperte-koeln-de.krankenpflegemiller.comwww.wundexperte-koeln.de
autodiscover.doulosapologetics.comcpanel.doulosapologetics.comcpcalendars.doulosapologetics.comcpcontacts.doulosapologetics.comdoulosapologetics.commail.doulosapologetics.comwebdisk.doulosapologetics.comwebmail.doulosapologetics.comwww.doulosapologetics.com
andersenlandscaping.comautodiscover.andersenlandscaping.comcpanel.andersenlandscaping.comcpcalendars.andersenlandscaping.comcpcontacts.andersenlandscaping.comien.klr.mybluehost.memail.andersenlandscaping.commail.ien.klr.mybluehost.mewebdisk.andersenlandscaping.comwebmail.andersenlandscaping.comwww.andersenlandscaping.comwww.ien.klr.mybluehost.me
autodiscover.greenlightservices.uscpanel.greenlightservices.uscpcalendars.greenlightservices.uscpcontacts.greenlightservices.usgreenlightservices-us.aeroventuresllc.comgreenlightservices.usmail.greenlightservices.uswebdisk.greenlightservices.uswebmail.greenlightservices.uswww.greenlightservices-us.aeroventuresllc.comwww.greenlightservices.us
cpanel.printec.sgcpcalendars.printec.sgcpcontacts.printec.sgmail.printec.sgprintec.sgwebdisk.printec.sgwebmail.printec.sgwww.printec.sg
autodiscover.brusselsbeachhouse.comautodiscover.zel.tlh.mybluehost.mebrusselsbeachhouse.combrusselsbeachhouse.zel.tlh.mybluehost.mecpanel.brusselsbeachhouse.comcpanel.zel.tlh.mybluehost.mecpcalendars.brusselsbeachhouse.comcpcalendars.zel.tlh.mybluehost.mecpcontacts.brusselsbeachhouse.comcpcontacts.zel.tlh.mybluehost.memail.brusselsbeachhouse.commail.zel.tlh.mybluehost.mewebdisk.brusselsbeachhouse.comwebdisk.zel.tlh.mybluehost.mewebmail.brusselsbeachhouse.comwebmail.zel.tlh.mybluehost.mewww.brusselsbeachhouse.comwww.brusselsbeachhouse.zel.tlh.mybluehost.mewww.zel.tlh.mybluehost.mezel.tlh.mybluehost.me
autodiscover.stowetrails.comcpanel.stowetrails.comcpanel.stowetrails.orgcpcalendars.stowetrails.comcpcalendars.stowetrails.orgcpcontacts.stowetrails.comcpcontacts.stowetrails.orgmail.stowetrails.commail.stowetrails.orgstowetrails-org.stowe-trails.comstowetrails.comstowetrails.orgstowetrails.stowe-trails.comwebdisk.stowetrails.comwebdisk.stowetrails.orgwebmail.stowetrails.comwebmail.stowetrails.orgwww.stowetrails-org.stowe-trails.comwww.stowetrails.comwww.stowetrails.orgwww.stowetrails.stowe-trails.com
autodiscover.myutahmedicareplans.comautodiscover.vipseniorbenefits.comcpanel.myutahmedicareplans.comcpanel.vipseniorbenefits.comcpcalendars.myutahmedicareplans.comcpcalendars.vipseniorbenefits.comcpcontacts.myutahmedicareplans.comcpcontacts.vipseniorbenefits.commail.myutahmedicareplans.commail.vipseniorbenefits.commyutahmedicareplans.comvipseniorbenefits.comvipseniorbenefits.myutahmedicareplans.comwebdisk.myutahmedicareplans.comwebdisk.vipseniorbenefits.comwebmail.myutahmedicareplans.comwebmail.vipseniorbenefits.comwww.myutahmedicareplans.comwww.vipseniorbenefits.comwww.vipseniorbenefits.myutahmedicareplans.com
autodiscover.edn.lef.mybluehost.mecpanel.edn.lef.mybluehost.mecpcalendars.edn.lef.mybluehost.mecpcontacts.edn.lef.mybluehost.meedn.lef.mybluehost.megrettabevis.commail.edn.lef.mybluehost.memail.grettabevis.comwebdisk.edn.lef.mybluehost.mewebmail.edn.lef.mybluehost.mewww.edn.lef.mybluehost.mewww.grettabevis.com
autodiscover.whooi.comcpanel.whooi.comcpcalendars.whooi.comcpcontacts.whooi.commail.whooi.comwebdisk.whooi.comwebmail.whooi.comwhooi.comwhooi.mwz.rrh.mybluehost.mewww.whooi.comwww.whooi.mwz.rrh.mybluehost.me
cpanel.lawnrangermi.comcpcalendars.lawnrangermi.comcpcontacts.lawnrangermi.comlawnrangermi.commail.lawnrangermi.comwebdisk.lawnrangermi.comwebmail.lawnrangermi.comwww.lawnrangermi.com
autodiscover.bqh.vtl.mybluehost.mebqh.vtl.mybluehost.mecpanel.bqh.vtl.mybluehost.mecpcalendars.bqh.vtl.mybluehost.mecpcontacts.bqh.vtl.mybluehost.memail.bqh.vtl.mybluehost.mewebdisk.bqh.vtl.mybluehost.mewebmail.bqh.vtl.mybluehost.mewww.bqh.vtl.mybluehost.me
autodiscover.voge.pecpanel.voge.pecpcalendars.voge.pecpcontacts.voge.pemail.voge.pevoge.pewebdisk.voge.pewebmail.voge.pewebsite-0e80c00c.sju.aef.mybluehost.mewww.voge.pewww.website-0e80c00c.sju.aef.mybluehost.me
autodiscover.slk.bgd.mybluehost.mecpanel.slk.bgd.mybluehost.mecpcalendars.slk.bgd.mybluehost.mecpcontacts.slk.bgd.mybluehost.memail.slk.bgd.mybluehost.memail.zhane.spaceslk.bgd.mybluehost.mewebdisk.slk.bgd.mybluehost.mewebmail.slk.bgd.mybluehost.mewww.slk.bgd.mybluehost.mewww.zhane.spacezhane.space
autodiscover.rln.bur.mybluehost.mecpanel.rln.bur.mybluehost.mecpcalendars.rln.bur.mybluehost.mecpcontacts.rln.bur.mybluehost.memail.rln.bur.mybluehost.mephoenixdpi.comrln.bur.mybluehost.mewebdisk.rln.bur.mybluehost.mewebmail.rln.bur.mybluehost.mewww.phoenixdpi.comwww.rln.bur.mybluehost.me
autodiscover.sunpring.comcpanel.sunpring.comcpcalendars.sunpring.comcpcontacts.sunpring.comfrkplant-net.sunpringextruder.comfrkplant.netmail.sunpring.comsunpring.comsunpring.sunpringextruder.comsunpringcom.sunpringextruder.comwebdisk.sunpring.comwebmail.sunpring.comwww.frkplant-net.sunpringextruder.comwww.frkplant.netwww.sunpring.comwww.sunpring.sunpringextruder.comwww.sunpringcom.sunpringextruder.com
autodiscover.tct.jwp.mybluehost.mecpanel.tct.jwp.mybluehost.mecpcalendars.tct.jwp.mybluehost.mecpcontacts.tct.jwp.mybluehost.memail.tct.jwp.mybluehost.memail.zachcomputerservice.commail.zachcomputerservices.comtct.jwp.mybluehost.mewebdisk.tct.jwp.mybluehost.mewebmail.tct.jwp.mybluehost.mewww.tct.jwp.mybluehost.mewww.zachcomputerservice.comwww.zachcomputerservices.comzachcomputerservice.comzachcomputerservices.com
cpanel.silverpoint-development.comcpcalendars.silverpoint-development.comcpcontacts.silverpoint-development.commail.silverpoint-development.comsilverpoint-development.comwebdisk.silverpoint-development.comwebmail.silverpoint-development.comwww.silverpoint-development.com
autodiscover.mxx.xng.mybluehost.mecpanel.mxx.xng.mybluehost.mecpcalendars.mxx.xng.mybluehost.mecpcontacts.mxx.xng.mybluehost.memail.mayaelchuco.commail.mxx.xng.mybluehost.memayaelchuco.commxx.xng.mybluehost.mewebdisk.mxx.xng.mybluehost.mewebmail.mxx.xng.mybluehost.mewww.mayaelchuco.comwww.mxx.xng.mybluehost.me
autodiscover.badgesoffraud.combadgesoffraud.comcpanel.badgesoffraud.comcpcalendars.badgesoffraud.comcpcontacts.badgesoffraud.commail.badgesoffraud.comwebdisk.badgesoffraud.comwebmail.badgesoffraud.comwww.badgesoffraud.com
autodiscover.ttw.nqg.mybluehost.mecpanel.ttw.nqg.mybluehost.mecpcalendars.ttw.nqg.mybluehost.mecpcontacts.ttw.nqg.mybluehost.memail.ttw.nqg.mybluehost.mettw.nqg.mybluehost.mewebdisk.ttw.nqg.mybluehost.mewebmail.ttw.nqg.mybluehost.mewww.ttw.nqg.mybluehost.me
autodiscover.globaltravelescapades.comcpanel.globaltravelescapades.comcpcalendars.globaltravelescapades.comcpcontacts.globaltravelescapades.comglobaltravelescapades.commail.globaltravelescapades.comwebdisk.globaltravelescapades.comwebmail.globaltravelescapades.comwww.globaltravelescapades.com
autodiscover.heaveninordinary.comcpanel.heaveninordinary.comcpcalendars.heaveninordinary.comcpcontacts.heaveninordinary.comheaveninordinary.commail.heaveninordinary.comwebdisk.heaveninordinary.comwebmail.heaveninordinary.comwww.heaveninordinary.com
autodiscover.tks.duj.mybluehost.mecpanel.tks.duj.mybluehost.mecpcalendars.tks.duj.mybluehost.mecpcontacts.tks.duj.mybluehost.memail.tks.duj.mybluehost.memail.willow.aetks.duj.mybluehost.mewebdisk.tks.duj.mybluehost.mewebmail.tks.duj.mybluehost.mewillow.aewww.tks.duj.mybluehost.mewww.willow.ae
aps.fts.mybluehost.meautodiscover.aps.fts.mybluehost.mecpanel.aps.fts.mybluehost.mecpcalendars.aps.fts.mybluehost.mecpcontacts.aps.fts.mybluehost.memail.aps.fts.mybluehost.memail.thejedipath.storethejedipath.storewebdisk.aps.fts.mybluehost.mewebmail.aps.fts.mybluehost.mewww.aps.fts.mybluehost.mewww.thejedipath.store
autodiscover.ecowisegadgets.comcpanel.ecowisegadgets.comcpanel.themarketingaigency.comcpcalendars.ecowisegadgets.comcpcalendars.themarketingaigency.comcpcontacts.ecowisegadgets.comcpcontacts.themarketingaigency.comecowisegadgets.comecowisegadgets.mindyourown.lifemail.ecowisegadgets.commail.themarketingaigency.comthemarketingaigency.comthemarketingaigency.mindyourown.lifewebdisk.ecowisegadgets.comwebdisk.themarketingaigency.comwebmail.ecowisegadgets.comwebmail.themarketingaigency.comwww.ecowisegadgets.comwww.ecowisegadgets.mindyourown.lifewww.themarketingaigency.comwww.themarketingaigency.mindyourown.life
autodiscover.pon.lgu.mybluehost.mecpanel.pon.lgu.mybluehost.mecpcalendars.pon.lgu.mybluehost.mecpcontacts.pon.lgu.mybluehost.memail.pon.lgu.mybluehost.memail.supermarket2amigosgmail.compon.lgu.mybluehost.mesupermarket2amigosgmail.comwebdisk.pon.lgu.mybluehost.mewebmail.pon.lgu.mybluehost.mewww.pon.lgu.mybluehost.mewww.supermarket2amigosgmail.com
autodiscover.xut.pyw.mybluehost.mecpanel.xut.pyw.mybluehost.mecpcalendars.xut.pyw.mybluehost.mecpcontacts.xut.pyw.mybluehost.memail.xut.pyw.mybluehost.mewebdisk.xut.pyw.mybluehost.mewebmail.xut.pyw.mybluehost.mewww.xut.pyw.mybluehost.mexut.pyw.mybluehost.me
primepaintingco.comwww.primepaintingco.com
thesilvergym.booktipper.comwww.thesilvergym.booktipper.com
autodiscover.bowlinefinancial.combowlinefinancial.comcpanel.bowlinefinancial.comcpcalendars.bowlinefinancial.comcpcontacts.bowlinefinancial.comwebdisk.bowlinefinancial.comwebmail.bowlinefinancial.comwww.bowlinefinancial.com
cpanel.merakimortgage.comcpcalendars.merakimortgage.comcpcontacts.merakimortgage.commail.merakimortgage.commerakimortgage.comwebdisk.merakimortgage.comwebmail.merakimortgage.comwww.merakimortgage.com
autodiscover.mgp.zyv.mybluehost.mecpanel.mgp.zyv.mybluehost.mecpcalendars.mgp.zyv.mybluehost.mecpcontacts.mgp.zyv.mybluehost.memail.mgp.zyv.mybluehost.memail.yanbenotmane.commgp.zyv.mybluehost.mewebdisk.mgp.zyv.mybluehost.mewebmail.mgp.zyv.mybluehost.mewww.mgp.zyv.mybluehost.mewww.yanbenotmane.comyanbenotmane.com
afaqadmin.dynamicsmachines.combusinessclub.dynamicsmachines.comlittleocean.dynamicsmachines.comwww.afaqadmin.dynamicsmachines.comwww.businessclub.dynamicsmachines.comwww.littleocean.dynamicsmachines.com
autodiscover.happy-houseplants.comcpanel.happy-houseplants.comcpcalendars.happy-houseplants.comcpcontacts.happy-houseplants.comhappy-houseplants.commail.happy-houseplants.comwebdisk.happy-houseplants.comwebmail.happy-houseplants.comwww.happy-houseplants.com
autodiscover.plansformoms.comcpanel.plansformoms.comcpcalendars.plansformoms.comcpcontacts.plansformoms.commail.plansformoms.complansformoms.comwebdisk.plansformoms.comwebmail.plansformoms.comwww.plansformoms.com
autodiscover.kmi.aqd.mybluehost.mecpanel.kmi.aqd.mybluehost.mecpcalendars.kmi.aqd.mybluehost.mecpcontacts.kmi.aqd.mybluehost.meexpressfundr.comkmi.aqd.mybluehost.memail.kmi.aqd.mybluehost.mewebdisk.kmi.aqd.mybluehost.mewebmail.kmi.aqd.mybluehost.mewww.expressfundr.comwww.kmi.aqd.mybluehost.me
cpanel.williammazza.comcpcalendars.williammazza.comcpcontacts.williammazza.commail.williammazza.comwebdisk.williammazza.comwebmail.williammazza.comwilliammazza.comwww.williammazza.com
autodiscover.ykj.enu.mybluehost.mecpanel.ykj.enu.mybluehost.mecpcalendars.ykj.enu.mybluehost.mecpcontacts.ykj.enu.mybluehost.memail.sizzlesalsyoutube.commail.ykj.enu.mybluehost.mesizzlesalsyoutube.comwebdisk.ykj.enu.mybluehost.mewebmail.ykj.enu.mybluehost.mewww.sizzlesalsyoutube.comwww.ykj.enu.mybluehost.meykj.enu.mybluehost.me
autodiscover.gwl.oqp.mybluehost.mecpanel.gwl.oqp.mybluehost.mecpcalendars.gwl.oqp.mybluehost.mecpcontacts.gwl.oqp.mybluehost.megwl.oqp.mybluehost.memail.gwl.oqp.mybluehost.mewebdisk.gwl.oqp.mybluehost.mewebmail.gwl.oqp.mybluehost.mewww.gwl.oqp.mybluehost.me
autodiscover.bwo.uqp.mybluehost.mebwo.uqp.mybluehost.mecpanel.bwo.uqp.mybluehost.mecpcalendars.bwo.uqp.mybluehost.mecpcontacts.bwo.uqp.mybluehost.memail.bwo.uqp.mybluehost.memail.rokaymedia.carokaymedia.cawebdisk.bwo.uqp.mybluehost.mewebmail.bwo.uqp.mybluehost.mewww.bwo.uqp.mybluehost.mewww.rokaymedia.ca
autodiscover.ypk.abf.mybluehost.mecascadesignaturephotography.comcpanel.ypk.abf.mybluehost.mecpcalendars.ypk.abf.mybluehost.mecpcontacts.ypk.abf.mybluehost.memail.cascadesignaturephotography.commail.ypk.abf.mybluehost.mewebdisk.ypk.abf.mybluehost.mewebmail.ypk.abf.mybluehost.mewww.cascadesignaturephotography.comwww.ypk.abf.mybluehost.meypk.abf.mybluehost.me
autodiscover.dynamic-rr.comcpanel.dynamic-rr.comcpcalendars.dynamic-rr.comcpcontacts.dynamic-rr.comdynamic-rr.commail.dynamic-rr.comroofestimator.dynamic-rr.comwebdisk.dynamic-rr.comwebmail.dynamic-rr.comwww.dynamic-rr.comwww.roofestimator.dynamic-rr.com
alcyonespace.comautodiscover.mse.ihh.mybluehost.mecpanel.mse.ihh.mybluehost.mecpcalendars.mse.ihh.mybluehost.mecpcontacts.mse.ihh.mybluehost.memail.alcyonespace.commail.mse.ihh.mybluehost.memse.ihh.mybluehost.mewebdisk.mse.ihh.mybluehost.mewebmail.mse.ihh.mybluehost.mewww.alcyonespace.comwww.mse.ihh.mybluehost.me
4thquarterliving-io.alvinwayneweiss.comautodiscover.theirsilentscreams.comcpanel.theirsilentscreams.comcpcalendars.theirsilentscreams.comcpcontacts.theirsilentscreams.commail.theirsilentscreams.comonourwaytotanzania.alvinwayneweiss.comtheirsilentscreams.alvinwayneweiss.comtheirsilentscreams.comtheverifiedalvinweiss.alvinwayneweiss.comwebdisk.theirsilentscreams.comwebmail.theirsilentscreams.comwww.4thquarterliving-io.alvinwayneweiss.comwww.onourwaytotanzania.alvinwayneweiss.comwww.theirsilentscreams.alvinwayneweiss.comwww.theirsilentscreams.comwww.theverifiedalvinweiss.alvinwayneweiss.com
theaboutsports.recipesandplaces.comwww.theaboutsports.recipesandplaces.com
autodiscover.catheryngrivna.comcatheryngrivna.comcpanel.catheryngrivna.comcpcalendars.catheryngrivna.comcpcontacts.catheryngrivna.commail.catheryngrivna.comwebdisk.catheryngrivna.comwebmail.catheryngrivna.comwww.catheryngrivna.com
autodiscover.thinkdigitalmatter.comcpanel.thinkdigitalmatter.comcpcalendars.thinkdigitalmatter.comcpcontacts.thinkdigitalmatter.comhbc.mlg.mybluehost.memail.hbc.mlg.mybluehost.memail.thinkdigitalmatter.comthinkdigitalmatter.comwebdisk.thinkdigitalmatter.comwebmail.thinkdigitalmatter.comwww.hbc.mlg.mybluehost.mewww.thinkdigitalmatter.com
autodiscover.justingolding.comcpanel.justingolding.comcpcalendars.justingolding.comcpcontacts.justingolding.comjustingolding.commail.justingolding.comwebdisk.justingolding.comwebmail.justingolding.comwww.justingolding.com
autodiscover.mr-quackersartistry.comautodiscover.sabrinamtzart.comcpanel.mr-quackersartistry.comcpanel.sabrinamtzart.comcpcalendars.mr-quackersartistry.comcpcalendars.sabrinamtzart.comcpcontacts.mr-quackersartistry.comcpcontacts.sabrinamtzart.commail.mr-quackersartistry.commail.sabrinamtzart.commr-quackersartistry.comsabrinamtzart.comsabrinamtzart.mr-quackersartistry.comwebdisk.mr-quackersartistry.comwebdisk.sabrinamtzart.comwebmail.mr-quackersartistry.comwebmail.sabrinamtzart.comwww.mail.mr-quackersartistry.comwww.mr-quackersartistry.comwww.sabrinamtzart.comwww.sabrinamtzart.mr-quackersartistry.com
autodiscover.fhg.plx.mybluehost.mecpanel.fhg.plx.mybluehost.mecpcalendars.fhg.plx.mybluehost.mecpcontacts.fhg.plx.mybluehost.mefhg.plx.mybluehost.mejennayoungconsulting.commail.fhg.plx.mybluehost.memail.jennayoungconsulting.comwebdisk.fhg.plx.mybluehost.mewebmail.fhg.plx.mybluehost.mewww.fhg.plx.mybluehost.mewww.jennayoungconsulting.com
autodiscover.vsj.tdd.mybluehost.mecpanel.vsj.tdd.mybluehost.mecpcalendars.vsj.tdd.mybluehost.mecpcontacts.vsj.tdd.mybluehost.mekrishmorgan.commail.vsj.tdd.mybluehost.mevsj.tdd.mybluehost.mewebdisk.vsj.tdd.mybluehost.mewebmail.vsj.tdd.mybluehost.mewww.krishmorgan.comwww.vsj.tdd.mybluehost.me
autodiscover.melissarevels.comcpanel.melissarevels.comcpcalendars.melissarevels.comcpcontacts.melissarevels.commail.melissarevels.commelissarevels.comwebdisk.melissarevels.comwebmail.melissarevels.comwww.melissarevels.com
autodiscover.wiq.jru.mybluehost.mecpanel.wiq.jru.mybluehost.mecpcalendars.wiq.jru.mybluehost.mecpcontacts.wiq.jru.mybluehost.memail.wiq.jru.mybluehost.mewebdisk.wiq.jru.mybluehost.mewebmail.wiq.jru.mybluehost.mewiq.jru.mybluehost.mewww.wiq.jru.mybluehost.me
autodiscover.yrh.nmb.mybluehost.mecpanel.yrh.nmb.mybluehost.mecpcalendars.yrh.nmb.mybluehost.mecpcontacts.yrh.nmb.mybluehost.memail.samicherkaouipublishings.commail.yrh.nmb.mybluehost.mesamicherkaouipublishings.comwebdisk.yrh.nmb.mybluehost.mewebmail.yrh.nmb.mybluehost.mewww.samicherkaouipublishings.comwww.yrh.nmb.mybluehost.meyrh.nmb.mybluehost.me
autodiscover.ftj.rdx.mybluehost.mecpanel.ftj.rdx.mybluehost.mecpcalendars.ftj.rdx.mybluehost.mecpcontacts.ftj.rdx.mybluehost.meftj.rdx.mybluehost.memail.ftj.rdx.mybluehost.mewebdisk.ftj.rdx.mybluehost.mewebmail.ftj.rdx.mybluehost.mewww.ftj.rdx.mybluehost.me
autodiscover.olivetreetales.comcpanel.olivetreetales.comcpcalendars.olivetreetales.comcpcontacts.olivetreetales.commail.olivetreetales.comolivetreetales.comolivetreetales.mindyourown.lifewebdisk.olivetreetales.comwebmail.olivetreetales.comwww.olivetreetales.comwww.olivetreetales.mindyourown.life
trading.kismetmind.comwww.trading.kismetmind.com
autodiscover.foolersinc.comautodiscover.keyawagroup.comcpanel.foolersinc.comcpanel.keyawagroup.comcpcalendars.foolersinc.comcpcalendars.keyawagroup.comcpcontacts.foolersinc.comcpcontacts.keyawagroup.comfoolersinc.comfoolersinc.keyawagroup.comgustordonez.keyawagroup.comkeyawagroup.comkeyawagroup.keyawagroup.commail.foolersinc.commail.keyawagroup.comwebdisk.foolersinc.comwebdisk.keyawagroup.comwebmail.foolersinc.comwebmail.keyawagroup.comwww.foolersinc.comwww.foolersinc.keyawagroup.comwww.gustordonez.keyawagroup.comwww.keyawagroup.comwww.keyawagroup.keyawagroup.com
autodiscover.kishafreed.comautodiscover.wordxpressllc.comcpanel.kishafreed.comcpanel.wordxpressllc.comcpcalendars.kishafreed.comcpcalendars.wordxpressllc.comcpcontacts.kishafreed.comcpcontacts.wordxpressllc.comkishafreed.commail.kishafreed.commail.wordxpressllc.comwebdisk.kishafreed.comwebdisk.wordxpressllc.comwebmail.kishafreed.comwebmail.wordxpressllc.comwordxpressllc.comwordxpressllc.kishafreed.comwww.kishafreed.comwww.wordxpressllc.comwww.wordxpressllc.kishafreed.com
autodiscover.foodmarketgypsy.comcpanel.foodmarketgypsy.comcpcalendars.foodmarketgypsy.comcpcontacts.foodmarketgypsy.comfoodmarketgypsy.commail.foodmarketgypsy.comold.foodmarketgypsy.comwebdisk.foodmarketgypsy.comwebmail.foodmarketgypsy.comwww.foodmarketgypsy.comwww.old.foodmarketgypsy.com
adroitlivingtp.comautodiscover.xvb.fts.mybluehost.mecpanel.xvb.fts.mybluehost.mecpcalendars.xvb.fts.mybluehost.mecpcontacts.xvb.fts.mybluehost.memail.adroitlivingtp.commail.xvb.fts.mybluehost.mewebdisk.xvb.fts.mybluehost.mewebmail.xvb.fts.mybluehost.mewww.adroitlivingtp.comwww.xvb.fts.mybluehost.mexvb.fts.mybluehost.me
autodiscover.svc.uzz.mybluehost.mecpanel.svc.uzz.mybluehost.mecpcalendars.svc.uzz.mybluehost.mecpcontacts.svc.uzz.mybluehost.memail.martinispickleball.commail.svc.uzz.mybluehost.memartinispickleball.comsvc.uzz.mybluehost.mewebdisk.svc.uzz.mybluehost.mewebmail.svc.uzz.mybluehost.mewww.martinispickleball.comwww.svc.uzz.mybluehost.me
autodiscover.texassigningservices.comcpanel.texassigningservices.comcpcalendars.texassigningservices.comcpcontacts.texassigningservices.commail.texassigningservices.comtexassigningservices.comwebdisk.texassigningservices.comwebmail.texassigningservices.comwebsite-ef326f66.nqf.egd.mybluehost.mewww.texassigningservices.comwww.website-ef326f66.nqf.egd.mybluehost.me
autodiscover.gti.etu.mybluehost.mechristinesstylingbags.comcpanel.gti.etu.mybluehost.mecpcalendars.gti.etu.mybluehost.mecpcontacts.gti.etu.mybluehost.megti.etu.mybluehost.memail.christinesstylingbags.commail.gti.etu.mybluehost.mewebdisk.gti.etu.mybluehost.mewebmail.gti.etu.mybluehost.mewww.christinesstylingbags.comwww.gti.etu.mybluehost.me
autodiscover.waterpurifierrental.comcpanel.waterpurifierrental.comcpcalendars.waterpurifierrental.comcpcontacts.waterpurifierrental.commail.waterpurifierrental.comwaterpurifierrental-com.sunmulgift.comwaterpurifierrental.comwebdisk.waterpurifierrental.comwebmail.waterpurifierrental.comwww.waterpurifierrental-com.sunmulgift.comwww.waterpurifierrental.com
autodiscover.ooa.pvh.mybluehost.mebrightaiideas.comcpanel.ooa.pvh.mybluehost.mecpcalendars.ooa.pvh.mybluehost.mecpcontacts.ooa.pvh.mybluehost.memail.brightaiideas.commail.ooa.pvh.mybluehost.meooa.pvh.mybluehost.mewebdisk.ooa.pvh.mybluehost.mewebmail.ooa.pvh.mybluehost.mewww.brightaiideas.comwww.ooa.pvh.mybluehost.me
autodiscover.capemaydecks.comautodiscover.capemayhomeimprovements.comcapemaydecks.comcapemayhomeimprovements.comcpanel.capemaydecks.comcpanel.capemayhomeimprovements.comcpcalendars.capemaydecks.comcpcalendars.capemayhomeimprovements.comcpcontacts.capemaydecks.comcpcontacts.capemayhomeimprovements.commail.capemaydecks.commail.capemayhomeimprovements.comwebdisk.capemaydecks.comwebdisk.capemayhomeimprovements.comwebmail.capemaydecks.comwebmail.capemayhomeimprovements.comwebsite-a91e0cf6.ygo.bsd.mybluehost.mewebsite-cab72c0c.ygo.bsd.mybluehost.mewww.capemaydecks.comwww.capemayhomeimprovements.comwww.website-a91e0cf6.ygo.bsd.mybluehost.mewww.website-cab72c0c.ygo.bsd.mybluehost.me
autodiscover.islandaircontrol.comcpanel.islandaircontrol.comcpcalendars.islandaircontrol.comcpcontacts.islandaircontrol.comislandaircontrol.commail.islandaircontrol.comwebdisk.islandaircontrol.comwebmail.islandaircontrol.comwww.islandaircontrol.com
autodiscover.pok.tqd.mybluehost.mecpanel.pok.tqd.mybluehost.mecpcalendars.pok.tqd.mybluehost.mecpcontacts.pok.tqd.mybluehost.melumie.sitemail.lumie.sitemail.pok.tqd.mybluehost.mepok.tqd.mybluehost.mewebdisk.pok.tqd.mybluehost.mewebmail.pok.tqd.mybluehost.mewww.lumie.sitewww.pok.tqd.mybluehost.me
autodiscover.hfo.yhy.mybluehost.mebalancebusinesssolution.netcpanel.hfo.yhy.mybluehost.mecpcalendars.hfo.yhy.mybluehost.mecpcontacts.hfo.yhy.mybluehost.mehfo.yhy.mybluehost.memail.balancebusinesssolution.netmail.hfo.yhy.mybluehost.mewebdisk.hfo.yhy.mybluehost.mewebmail.hfo.yhy.mybluehost.mewww.balancebusinesssolution.netwww.hfo.yhy.mybluehost.me
autodiscover.lzv.xem.mybluehost.mecpanel.lzv.xem.mybluehost.mecpcalendars.lzv.xem.mybluehost.mecpcontacts.lzv.xem.mybluehost.melzv.xem.mybluehost.memail.lzv.xem.mybluehost.metimswritingpeace.orgwebdisk.lzv.xem.mybluehost.mewebmail.lzv.xem.mybluehost.mewww.lzv.xem.mybluehost.me
autodiscover.zain-alemaar.comcpanel.zain-alemaar.comcpcalendars.zain-alemaar.comcpcontacts.zain-alemaar.commail.zain-alemaar.comwebdisk.zain-alemaar.comwebmail.zain-alemaar.comwww.zain-alemaar.comzain-alemaar.com
autodiscover.sunpringextruder.comautodiscover.tr.sunpringextruder.comcpanel.sunpringextruder.comcpanel.tr.sunpringextruder.comcpcalendars.sunpringextruder.comcpcalendars.tr.sunpringextruder.comcpcontacts.sunpringextruder.comcpcontacts.tr.sunpringextruder.commail.sunpringextruder.commail.tr.sunpringextruder.commail.wmi.cra.mybluehost.mesunpringextruder.comtr.sunpringextruder.comwebdisk.sunpringextruder.comwebdisk.tr.sunpringextruder.comwebmail.sunpringextruder.comwebmail.tr.sunpringextruder.comwebsite-d20a7248.sunpringextruder.comwmi.cra.mybluehost.mewww.sunpringextruder.comwww.tr.sunpringextruder.comwww.website-d20a7248.sunpringextruder.comwww.wmi.cra.mybluehost.me
autodiscover.eidegames.comcpanel.eidegames.comcpcalendars.eidegames.comcpcontacts.eidegames.comeidegames.comeidegames.eoj.xmy.mybluehost.memail.eidegames.comwebdisk.eidegames.comwebmail.eidegames.comwww.eidegames.comwww.eidegames.eoj.xmy.mybluehost.me
autodiscover.jcmagazine.comcpanel.jcmagazine.comcpcalendars.jcmagazine.comcpcontacts.jcmagazine.comjcmagazine.commail.jcmagazine.comwebdisk.jcmagazine.comwebmail.jcmagazine.comwww.jcmagazine.com
autodiscover.pixelscott.comcpanel.pixelscott.comcpcalendars.pixelscott.comcpcontacts.pixelscott.commail.pixelscott.compixelscott.comwebdisk.pixelscott.comwebmail.pixelscott.comwebsite-84d10498.qmd.bzx.mybluehost.mewww.pixelscott.comwww.website-84d10498.qmd.bzx.mybluehost.me
autodiscover.dnp.tqp.mybluehost.mecpanel.dnp.tqp.mybluehost.mecpcalendars.dnp.tqp.mybluehost.mecpcontacts.dnp.tqp.mybluehost.mednp.tqp.mybluehost.memail.dnp.tqp.mybluehost.memail.spicedock.comspicedock.comwebdisk.dnp.tqp.mybluehost.mewebmail.dnp.tqp.mybluehost.mewww.dnp.tqp.mybluehost.mewww.spicedock.com
autodiscover.yis.oco.mybluehost.meboredchickens.spacecpanel.yis.oco.mybluehost.mecpcalendars.yis.oco.mybluehost.mecpcontacts.yis.oco.mybluehost.memail.boredchickens.spacemail.yis.oco.mybluehost.mewebdisk.yis.oco.mybluehost.mewebmail.yis.oco.mybluehost.mewww.boredchickens.spacewww.yis.oco.mybluehost.meyis.oco.mybluehost.me
autodiscover.nrk.hsk.mybluehost.meclasswings.netcpanel.nrk.hsk.mybluehost.mecpcalendars.nrk.hsk.mybluehost.mecpcontacts.nrk.hsk.mybluehost.memail.classwings.netmail.nrk.hsk.mybluehost.menrk.hsk.mybluehost.mewebdisk.nrk.hsk.mybluehost.mewebmail.nrk.hsk.mybluehost.mewww.classwings.netwww.nrk.hsk.mybluehost.me
autodiscover.usw.zbc.mybluehost.mecpanel.usw.zbc.mybluehost.mecpcalendars.usw.zbc.mybluehost.mecpcontacts.usw.zbc.mybluehost.memail.msmassagesandacupunctures.commail.usw.zbc.mybluehost.memsmassagesandacupunctures.comusw.zbc.mybluehost.mewebdisk.usw.zbc.mybluehost.mewebmail.usw.zbc.mybluehost.mewww.msmassagesandacupunctures.comwww.usw.zbc.mybluehost.me
alexcriddle.comautodiscover.alexcriddle.comcpanel.alexcriddle.comcpcalendars.alexcriddle.comcpcontacts.alexcriddle.commail.alexcriddle.comwebdisk.alexcriddle.comwebmail.alexcriddle.comwww.alexcriddle.com
autodiscover.dynamicsmachines.comcpanel.dynamicsmachines.comcpcalendars.dynamicsmachines.comcpcontacts.dynamicsmachines.comdynamicsmachines.commail.dynamicsmachines.commail.try.ebq.mybluehost.metry.ebq.mybluehost.mewebdisk.dynamicsmachines.comwebmail.dynamicsmachines.comwww.dynamicsmachines.comwww.try.ebq.mybluehost.me
outofoffice.businesswebsite-a93fb326.aps.fts.mybluehost.mewww.website-a93fb326.aps.fts.mybluehost.me
autodiscover.qrz.pbv.mybluehost.mecpanel.qrz.pbv.mybluehost.mecpcalendars.qrz.pbv.mybluehost.mecpcontacts.qrz.pbv.mybluehost.memail.qrz.pbv.mybluehost.meqrz.pbv.mybluehost.mewebdisk.qrz.pbv.mybluehost.mewebmail.qrz.pbv.mybluehost.mewww.qrz.pbv.mybluehost.me
autodiscover.kgq.wyy.mybluehost.mecpanel.kgq.wyy.mybluehost.mecpcalendars.kgq.wyy.mybluehost.mecpcontacts.kgq.wyy.mybluehost.mehealthy-queen.comkgq.wyy.mybluehost.memail.healthy-queen.commail.kgq.wyy.mybluehost.mewebdisk.kgq.wyy.mybluehost.mewebmail.kgq.wyy.mybluehost.mewww.healthy-queen.comwww.kgq.wyy.mybluehost.me
autodiscover.kidzcomics.comcpanel.kidzcomics.comcpcalendars.kidzcomics.comcpcontacts.kidzcomics.comkidzcomics.comkidzcomics.sunmulgift.commail.kidzcomics.comwebdisk.kidzcomics.comwebmail.kidzcomics.comwww.kidzcomics.comwww.kidzcomics.sunmulgift.com
autodiscover.charbonneaugreenshoa.orgcharbonneaugreenhoa.orgcharbonneaugreenshoa.orgcpanel.charbonneaugreenshoa.orgcpcalendars.charbonneaugreenshoa.orgcpcontacts.charbonneaugreenshoa.orgmail.charbonneaugreenhoa.orgmail.charbonneaugreenshoa.orgwebdisk.charbonneaugreenshoa.orgwebmail.charbonneaugreenshoa.orgwww.charbonneaugreenhoa.orgwww.charbonneaugreenshoa.org
autodiscover.freewebtoonsite.comautodiscover.ghealthfood.comcpanel.freewebtoonsite.comcpanel.ghealthfood.comcpcalendars.freewebtoonsite.comcpcalendars.ghealthfood.comcpcontacts.freewebtoonsite.comcpcontacts.ghealthfood.comfreewebtoonsite-com.sunmulgift.comfreewebtoonsite.comghealthfood-com.sunmulgift.comghealthfood.commail.freewebtoonsite.commail.ghealthfood.comwebdisk.freewebtoonsite.comwebdisk.ghealthfood.comwebmail.freewebtoonsite.comwebmail.ghealthfood.comwww.freewebtoonsite-com.sunmulgift.comwww.freewebtoonsite.comwww.ghealthfood-com.sunmulgift.comwww.ghealthfood.com
autodiscover.buttnerreisdias.combuttnerreisdias.comcpanel.buttnerreisdias.comcpcalendars.buttnerreisdias.comcpcontacts.buttnerreisdias.commail.buttnerreisdias.comwebdisk.buttnerreisdias.comwebmail.buttnerreisdias.comwww.buttnerreisdias.com
abundantlovechildrenshome.comautodiscover.abundantlovechildrenshome.comcpanel.abundantlovechildrenshome.comcpcalendars.abundantlovechildrenshome.comcpcontacts.abundantlovechildrenshome.commail.abundantlovechildrenshome.comwebdisk.abundantlovechildrenshome.comwebmail.abundantlovechildrenshome.comwww.abundantlovechildrenshome.com
frk-machine.comfrk-machine.sunpringextruder.comru.sunpringextruder.comwww.frk-machine.comwww.frk-machine.sunpringextruder.comwww.ru.sunpringextruder.com
autodiscover.breakupglowupfight.combadgirlgoodfighter.combeccathesun.combingefreeathlete.combreakupglowupfight.comcpanel.breakupglowupfight.comcpcalendars.breakupglowupfight.comcpcontacts.breakupglowupfight.commail.badgirlgoodfighter.commail.beccathesun.commail.bingefreeathlete.commail.breakupglowupfight.comwebdisk.breakupglowupfight.comwebmail.breakupglowupfight.comwww.badgirlgoodfighter.comwww.beccathesun.comwww.bingefreeathlete.comwww.breakupglowupfight.com
autodiscover.vhk.hal.mybluehost.mecpanel.vhk.hal.mybluehost.mecpcalendars.vhk.hal.mybluehost.mecpcontacts.vhk.hal.mybluehost.memail.vhk.hal.mybluehost.mevhk.hal.mybluehost.mewebdisk.vhk.hal.mybluehost.mewebmail.vhk.hal.mybluehost.mewww.vhk.hal.mybluehost.me
autodiscover.healingwithmary.netcpanel.healingwithmary.netcpcalendars.healingwithmary.netcpcontacts.healingwithmary.nethealingwithmary.netmail.healingwithmary.netwebdisk.healingwithmary.netwebmail.healingwithmary.netwww.healingwithmary.net
cookingwithkittycat.comcpanel.cookingwithkittycat.comcpcalendars.cookingwithkittycat.comcpcontacts.cookingwithkittycat.commail.cookingwithkittycat.comwebdisk.cookingwithkittycat.comwebmail.cookingwithkittycat.comwww.cookingwithkittycat.com
autodiscover.taemenkr.comcpanel.taemenkr.comcpcalendars.taemenkr.comcpcontacts.taemenkr.commail.taemenkr.comtaemenkr.comwebdisk.taemenkr.comwebmail.taemenkr.comwebsite-63d89594.sunmulgift.comwww.taemenkr.comwww.website-63d89594.sunmulgift.com
autodiscover.wamlblog.netcpanel.wamlblog.netcpcalendars.wamlblog.netcpcontacts.wamlblog.netfwv.viq.mybluehost.memail.fwv.viq.mybluehost.memail.wamlblog.netwamlblog.netwebdisk.wamlblog.netwebmail.wamlblog.netwww.fwv.viq.mybluehost.mewww.wamlblog.net
autodiscover.yorktownday.comcpanel.yorktownday.comcpcalendars.yorktownday.comcpcontacts.yorktownday.commail.yorktownday.comwebdisk.yorktownday.comwebmail.yorktownday.comwww.yorktownday.comwww.yorktownday.ypsva.orgyorktownday.comyorktownday.ypsva.org
autodiscover.hillts.comcpanel.hillts.comcpcalendars.hillts.comcpcontacts.hillts.comhillts.commail.hillts.comwebdisk.hillts.comwebmail.hillts.comwebsite-0bcb091d.tks.duj.mybluehost.mewww.hillts.comwww.website-0bcb091d.tks.duj.mybluehost.me
autodiscover.ttr.bqv.mybluehost.mecpanel.ttr.bqv.mybluehost.mecpcalendars.ttr.bqv.mybluehost.mecpcontacts.ttr.bqv.mybluehost.memail.ttr.bqv.mybluehost.mettr.bqv.mybluehost.mewebdisk.ttr.bqv.mybluehost.mewebmail.ttr.bqv.mybluehost.mewww.ttr.bqv.mybluehost.me
aeroventuresllc.comaeroventuresusa.aeroventuresllc.comaeroventuresusa.comalliedinternationalgroup.aeroventuresllc.comalliesinternationalgroup.aeroventuresllc.comautodiscover.aeroventuresllc.combeehiveflower.orgcpanel.aeroventuresllc.comcpcalendars.aeroventuresllc.comcpcontacts.aeroventuresllc.commail.aeroventuresllc.commail.beehiveflower.orgmail.xwk.lnl.mybluehost.mewebdisk.aeroventuresllc.comwebmail.aeroventuresllc.comwww.aeroventuresllc.comwww.aeroventuresusa.aeroventuresllc.comwww.aeroventuresusa.comwww.alliedinternationalgroup.aeroventuresllc.comwww.alliesinternationalgroup.aeroventuresllc.comwww.beehiveflower.orgwww.xwk.lnl.mybluehost.mexwk.lnl.mybluehost.me
autodiscover.yrj.ela.mybluehost.mecpanel.yrj.ela.mybluehost.mecpcalendars.yrj.ela.mybluehost.mecpcontacts.yrj.ela.mybluehost.memail.yrj.ela.mybluehost.mewebdisk.yrj.ela.mybluehost.mewebmail.yrj.ela.mybluehost.mewww.yrj.ela.mybluehost.meyrj.ela.mybluehost.me
autodiscover.wcag.grettabevis.comcpanel.wcag.grettabevis.comcpcalendars.wcag.grettabevis.comcpcontacts.wcag.grettabevis.commail.wcag.grettabevis.comwcag-grettabevis-com.edn.lef.mybluehost.mewcag.grettabevis.comwebdisk.wcag.grettabevis.comwebmail.wcag.grettabevis.comwww.wcag-grettabevis-com.edn.lef.mybluehost.mewww.wcag.grettabevis.com
abatementsolutionslacrosse.comautodiscover.abatementsolutionslacrosse.comcpanel.abatementsolutionslacrosse.comcpcalendars.abatementsolutionslacrosse.comcpcontacts.abatementsolutionslacrosse.commail.abatementsolutionslacrosse.comwebdisk.abatementsolutionslacrosse.comwebmail.abatementsolutionslacrosse.comwww.abatementsolutionslacrosse.com
anisumakenya.co.keanisumatraders.comautodiscover.anisumakenya.co.keautodiscover.anisumatraders.comcpanel.anisumakenya.co.kecpanel.anisumatraders.comcpcalendars.anisumakenya.co.kecpcalendars.anisumatraders.comcpcontacts.anisumakenya.co.kecpcontacts.anisumatraders.commail.anisumakenya.co.kemail.anisumatraders.commail.wpr.bwk.mybluehost.mewebdisk.anisumakenya.co.kewebdisk.anisumatraders.comwebmail.anisumakenya.co.kewebmail.anisumatraders.comwebsite-d7854ecc.anisumakenya.co.kewpr.bwk.mybluehost.mewww.anisumakenya.co.kewww.anisumatraders.comwww.website-d7854ecc.anisumakenya.co.kewww.wpr.bwk.mybluehost.me
autodiscover.thesatiricalhousewife.comcpanel.thesatiricalhousewife.comcpcalendars.thesatiricalhousewife.comcpcontacts.thesatiricalhousewife.commail.thesatiricalhousewife.comthesatiricalhousewife.comwebdisk.thesatiricalhousewife.comwebmail.thesatiricalhousewife.comwww.thesatiricalhousewife.com
autodiscover.dgk.rts.mybluehost.mecpanel.dgk.rts.mybluehost.mecpcalendars.dgk.rts.mybluehost.mecpcontacts.dgk.rts.mybluehost.medgk.rts.mybluehost.memail.dgk.rts.mybluehost.mesandiparkhurst.comwebdisk.dgk.rts.mybluehost.mewebmail.dgk.rts.mybluehost.mewww.dgk.rts.mybluehost.mewww.sandiparkhurst.com
autodiscover.magneticminstrel.netcpanel.magneticminstrel.netcpcalendars.magneticminstrel.netcpcontacts.magneticminstrel.netmagneticminstrel.netmail.magneticminstrel.netwebdisk.magneticminstrel.netwebmail.magneticminstrel.netwebsite-0fe27fd5.wqb.fgc.mybluehost.mewww.magneticminstrel.netwww.website-0fe27fd5.wqb.fgc.mybluehost.me
www.reaunique.orgreaunique.org
autodiscover.bsv.kdq.mybluehost.mebsv.kdq.mybluehost.mecpanel.bsv.kdq.mybluehost.mecpcalendars.bsv.kdq.mybluehost.mecpcontacts.bsv.kdq.mybluehost.memail.bsv.kdq.mybluehost.memail.mossbayhall.commossbayhall.comwebdisk.bsv.kdq.mybluehost.mewebmail.bsv.kdq.mybluehost.mewww.bsv.kdq.mybluehost.mewww.mossbayhall.com
autodiscover.hollytoscanini.comautodiscover.howtolosethewait.comcpanel.hollytoscanini.comcpanel.howtolosethewait.comcpcalendars.hollytoscanini.comcpcalendars.howtolosethewait.comcpcontacts.hollytoscanini.comcpcontacts.howtolosethewait.comhollytoscanini.comhowtolosethewait.commail.hollytoscanini.commail.howtolosethewait.commail.ujo.oef.mybluehost.meujo.oef.mybluehost.mewebdisk.hollytoscanini.comwebdisk.howtolosethewait.comwebmail.hollytoscanini.comwebmail.howtolosethewait.comwebsite-d8fc586a.hollytoscanini.comwww.hollytoscanini.comwww.howtolosethewait.comwww.ujo.oef.mybluehost.mewww.website-d8fc586a.hollytoscanini.com
website-6301f4d6.geckographix.cawebsite-7d613f40.geckographix.cawww.website-6301f4d6.geckographix.cawww.website-7d613f40.geckographix.ca
supermartt.xlr.kdb.mybluehost.mewww.supermartt.xlr.kdb.mybluehost.me
autodiscover.newhopecounselingonline.comcpanel.newhopecounselingonline.comcpcalendars.newhopecounselingonline.comcpcontacts.newhopecounselingonline.commail.newhopecounselingonline.comnewhopecounselingonline.comwebdisk.newhopecounselingonline.comwebmail.newhopecounselingonline.comwebsite-f0ddad42.ppd.ssy.mybluehost.mewww.newhopecounselingonline.comwww.website-f0ddad42.ppd.ssy.mybluehost.me
autodiscover.way.tdd.mybluehost.mecpanel.way.tdd.mybluehost.mecpcalendars.way.tdd.mybluehost.mecpcontacts.way.tdd.mybluehost.mefieldrosaries.orgmail.fieldrosaries.orgmail.way.tdd.mybluehost.meway.tdd.mybluehost.mewebdisk.way.tdd.mybluehost.mewebmail.way.tdd.mybluehost.mewww.fieldrosaries.orgwww.way.tdd.mybluehost.me
autodiscover.easybillingrcm.comcpanel.easybillingrcm.comcpcalendars.easybillingrcm.comcpcontacts.easybillingrcm.comeasybillingrcm.comeasybillingrcm.xlr.kdb.mybluehost.memail.easybillingrcm.comwebdisk.easybillingrcm.comwebmail.easybillingrcm.comwebsite-0e92c92e.xlr.kdb.mybluehost.mewww.easybillingrcm.comwww.easybillingrcm.xlr.kdb.mybluehost.mewww.website-0e92c92e.xlr.kdb.mybluehost.me
autodiscover.zdk.sco.mybluehost.mecpanel.zdk.sco.mybluehost.mecpcalendars.zdk.sco.mybluehost.mecpcontacts.zdk.sco.mybluehost.meinkfurie.commail.zdk.sco.mybluehost.mewebdisk.zdk.sco.mybluehost.mewebmail.zdk.sco.mybluehost.mewww.inkfurie.comwww.zdk.sco.mybluehost.mezdk.sco.mybluehost.me
autodiscover.wekickitup.comcpanel.wekickitup.comcpcalendars.wekickitup.comcpcontacts.wekickitup.commail.wekickitup.comwebdisk.wekickitup.comwebmail.wekickitup.comwekickitup.comwww.wekickitup.com
autodiscover.lereveluxury.comcpanel.lereveluxury.comcpcalendars.lereveluxury.comcpcontacts.lereveluxury.comlereveluxury.commail.lereveluxury.comwebdisk.lereveluxury.comwebsite-486dc152.thinkdigitalmatter.comwww.website-486dc152.thinkdigitalmatter.com
alphacornersglobal.techautodiscover.alphacornersglobal.techcpanel.alphacornersglobal.techcpcalendars.alphacornersglobal.techcpcontacts.alphacornersglobal.techmail.alphacornersglobal.techwebdisk.alphacornersglobal.techwebmail.alphacornersglobal.techwebsite-97cb9c6b.yrj.ela.mybluehost.mewww.alphacornersglobal.techwww.website-97cb9c6b.yrj.ela.mybluehost.me
autodiscover.iamdrcole.comcpanel.iamdrcole.comcpcalendars.iamdrcole.comcpcontacts.iamdrcole.comiamdrcole.commail.iamdrcole.comwebdisk.iamdrcole.comwebmail.iamdrcole.comwww.iamdrcole.com
autodiscover.gapscience.comcpanel.gapscience.comcpcalendars.gapscience.comcpcontacts.gapscience.comgapscience.comgapscience.forensicpocketguide.comwebdisk.gapscience.comwebmail.gapscience.comwww.gapscience.comwww.gapscience.forensicpocketguide.com
autodiscover.ccl-us.orgccl-us.orgcpanel.ccl-us.orgcpcalendars.ccl-us.orgcpcontacts.ccl-us.orgmail.ccl-us.orgmail.mxv.rew.mybluehost.memxv.rew.mybluehost.mewebdisk.ccl-us.orgwebmail.ccl-us.orgwebsite-32b76e56.ccl-us.orgwww.ccl-us.orgwww.mxv.rew.mybluehost.mewww.website-32b76e56.ccl-us.org
autodiscover.logical-insanity.comcpanel.logical-insanity.comcpcalendars.logical-insanity.comcpcontacts.logical-insanity.comkkn.jpm.mybluehost.melogical-insanity.commail.kkn.jpm.mybluehost.memail.logical-insanity.comoan.logical-insanity.comwebdisk.logical-insanity.comwebmail.logical-insanity.comwww.kkn.jpm.mybluehost.mewww.logical-insanity.comwww.oan.logical-insanity.com
autodiscover.ram.zga.mybluehost.mecpanel.ram.zga.mybluehost.mecpcalendars.ram.zga.mybluehost.mecpcontacts.ram.zga.mybluehost.medrrussyaconnor.com.aumail.drrussyaconnor.com.aumail.ram.zga.mybluehost.meram.zga.mybluehost.mewebdisk.ram.zga.mybluehost.mewebmail.ram.zga.mybluehost.mewww.drrussyaconnor.com.auwww.ram.zga.mybluehost.me
autodiscover.ecg.abf.mybluehost.mecpanel.ecg.abf.mybluehost.mecpcalendars.ecg.abf.mybluehost.mecpcontacts.ecg.abf.mybluehost.meecg.abf.mybluehost.memail.ecg.abf.mybluehost.mewebdisk.ecg.abf.mybluehost.mewebmail.ecg.abf.mybluehost.mewww.ecg.abf.mybluehost.me
autodiscover.internationalkenpokobudohakutsuruassociation.comcpanel.internationalkenpokobudohakutsuruassociation.comcpcalendars.internationalkenpokobudohakutsuruassociation.comcpcontacts.internationalkenpokobudohakutsuruassociation.cominternationalkenpokobudohakutsuruassociation.commail.internationalkenpokobudohakutsuruassociation.comwebdisk.internationalkenpokobudohakutsuruassociation.comwebmail.internationalkenpokobudohakutsuruassociation.comwww.internationalkenpokobudohakutsuruassociation.com
autodiscover.kcr.rfn.mybluehost.mecpanel.kcr.rfn.mybluehost.mecpcalendars.kcr.rfn.mybluehost.mecpcontacts.kcr.rfn.mybluehost.mekcr.rfn.mybluehost.melicenselogicsolutions.commail.kcr.rfn.mybluehost.memail.licenselogicsolutions.comwebdisk.kcr.rfn.mybluehost.mewebmail.kcr.rfn.mybluehost.mewww.kcr.rfn.mybluehost.mewww.licenselogicsolutions.com
autodiscover.latincouncilavl.orgcpanel.latincouncilavl.orgcpcalendars.latincouncilavl.orgcpcontacts.latincouncilavl.orglatincouncilavl-org.iib.jso.mybluehost.melatincouncilavl.orgmail.latincouncilavl.orgwebdisk.latincouncilavl.orgwebmail.latincouncilavl.orgwww.latincouncilavl-org.iib.jso.mybluehost.mewww.latincouncilavl.org
autodiscover.issavalli.comcpanel.issavalli.comcpcalendars.issavalli.comcpcontacts.issavalli.comissavalli.commail.issavalli.comwebdisk.issavalli.comwebmail.issavalli.comwebsite-8f411754.yxp.plo.mybluehost.mewww.issavalli.comwww.website-8f411754.yxp.plo.mybluehost.me
aevotechna.comautodiscover.yxp.plo.mybluehost.mecpanel.yxp.plo.mybluehost.mecpcalendars.yxp.plo.mybluehost.mecpcontacts.yxp.plo.mybluehost.meissavalli.commail.aevotechna.commail.issavalli.commail.yxp.plo.mybluehost.mewebdisk.yxp.plo.mybluehost.mewebmail.yxp.plo.mybluehost.mewww.aevotechna.comwww.issavalli.comwww.yxp.plo.mybluehost.meyxp.plo.mybluehost.me
autodiscover.prx.doq.mybluehost.mecpanel.prx.doq.mybluehost.mecpcalendars.prx.doq.mybluehost.mecpcontacts.prx.doq.mybluehost.memail.prx.doq.mybluehost.memail.simbaonlinestore.comprx.doq.mybluehost.mesimbaonlinestore.comwebdisk.prx.doq.mybluehost.mewebmail.prx.doq.mybluehost.mewww.prx.doq.mybluehost.mewww.simbaonlinestore.com
autodiscover.qqu.lnr.mybluehost.mecpanel.qqu.lnr.mybluehost.mecpcalendars.qqu.lnr.mybluehost.mecpcontacts.qqu.lnr.mybluehost.memail.pediatricsupportandintervention.commail.qqu.lnr.mybluehost.mepediatricsupportandintervention.comqqu.lnr.mybluehost.mewebdisk.qqu.lnr.mybluehost.mewebmail.qqu.lnr.mybluehost.mewww.pediatricsupportandintervention.comwww.qqu.lnr.mybluehost.me
autodiscover.vbp.pmc.mybluehost.mecpanel.vbp.pmc.mybluehost.mecpcalendars.vbp.pmc.mybluehost.mecpcontacts.vbp.pmc.mybluehost.memail.vbp.pmc.mybluehost.mevbp.pmc.mybluehost.mewebdisk.vbp.pmc.mybluehost.mewebmail.vbp.pmc.mybluehost.mewww.vbp.pmc.mybluehost.me
autodiscover.hstex.com.twcpanel.hstex.com.twcpcalendars.hstex.com.twcpcontacts.hstex.com.twhstex.com.twwebdisk.hstex.com.twwww.hstex.com.tw
autodiscover.sallysfault.comcpanel.sallysfault.comcpcalendars.sallysfault.comcpcontacts.sallysfault.comsallysfault.comsallysfault.logical-insanity.comwebdisk.sallysfault.comwebmail.sallysfault.comwww.sallysfault.comwww.sallysfault.logical-insanity.com
cpanel.fords-ip.comcpcalendars.fords-ip.comcpcontacts.fords-ip.comfords-ip.comwebdisk.fords-ip.comwebmail.fords-ip.comwww.fords-ip.com
autodiscover.bentplyword.comautodiscover.patrickcheatham.combentplyword.combentplyword.fqy.bsv.mybluehost.mecpanel.bentplyword.comcpanel.patrickcheatham.comcpcalendars.bentplyword.comcpcalendars.patrickcheatham.comcpcontacts.bentplyword.comcpcontacts.patrickcheatham.commail.bentplyword.commail.patrickcheatham.compatrickcheatham.compatrickcheatham.fqy.bsv.mybluehost.mewebdisk.bentplyword.comwebdisk.patrickcheatham.comwebmail.bentplyword.comwebmail.patrickcheatham.comwww.bentplyword.comwww.bentplyword.fqy.bsv.mybluehost.mewww.patrickcheatham.comwww.patrickcheatham.fqy.bsv.mybluehost.me
autodiscover.childrensfrenchbookcorner.comchildrensfrenchbookcorner.comcpanel.childrensfrenchbookcorner.comcpcalendars.childrensfrenchbookcorner.comcpcontacts.childrensfrenchbookcorner.comwebdisk.childrensfrenchbookcorner.comwebmail.childrensfrenchbookcorner.comwww.childrensfrenchbookcorner.com
autodiscover.kqv.zzt.mybluehost.mecpanel.kqv.zzt.mybluehost.mecpcalendars.kqv.zzt.mybluehost.mecpcontacts.kqv.zzt.mybluehost.mekqv.zzt.mybluehost.memail.kqv.zzt.mybluehost.mewebdisk.kqv.zzt.mybluehost.mewebmail.kqv.zzt.mybluehost.mewww.kqv.zzt.mybluehost.me
autodiscover.uhm.zca.mybluehost.mecpanel.uhm.zca.mybluehost.mecpcalendars.uhm.zca.mybluehost.mecpcontacts.uhm.zca.mybluehost.mejosefinarecruitment.commail.uhm.zca.mybluehost.meuhm.zca.mybluehost.mewebdisk.uhm.zca.mybluehost.mewebmail.uhm.zca.mybluehost.mewww.josefinarecruitment.comwww.uhm.zca.mybluehost.me
autodiscover.coopstrat.comcoopstrat.comcpanel.coopstrat.comcpcalendars.coopstrat.comcpcontacts.coopstrat.commail.coopstrat.comwebdisk.coopstrat.comwebmail.coopstrat.comwww.coopstrat.com
autodiscover.urbanheropoodles.comcpanel.urbanheropoodles.comcpcalendars.urbanheropoodles.comcpcontacts.urbanheropoodles.commail.urbanheropoodles.comurbanheropoodles.comurbanheropoodles.veterinarybootcampce.comwebdisk.urbanheropoodles.comwebmail.urbanheropoodles.comwww.urbanheropoodles.comwww.urbanheropoodles.veterinarybootcampce.com
autodiscover.forlogancounty.comautodiscover.kbcreative.orgbeardedbudgeter.churchannouncementsolutions.comcpanel.forlogancounty.comcpanel.kbcreative.orgcpcalendars.forlogancounty.comcpcalendars.kbcreative.orgcpcontacts.forlogancounty.comcpcontacts.kbcreative.orgforlogancounty.churchannouncementsolutions.comforlogancounty.comkbcreative-org.churchannouncementsolutions.comkbcreative.orgmail.forlogancounty.commail.kbcreative.orgwebdisk.forlogancounty.comwebdisk.kbcreative.orgwebmail.forlogancounty.comwebmail.kbcreative.orgwww.beardedbudgeter.churchannouncementsolutions.comwww.forlogancounty.churchannouncementsolutions.comwww.forlogancounty.comwww.kbcreative-org.churchannouncementsolutions.comwww.kbcreative.org
autodiscover.qmd.bzx.mybluehost.mecpanel.qmd.bzx.mybluehost.mecpcalendars.qmd.bzx.mybluehost.mecpcontacts.qmd.bzx.mybluehost.memail.qmd.bzx.mybluehost.memail.scottpysher.comqmd.bzx.mybluehost.mescottpysher.comwebdisk.qmd.bzx.mybluehost.mewebmail.qmd.bzx.mybluehost.mewww.qmd.bzx.mybluehost.mewww.scottpysher.com
castellonfloreslaw.comcpanel.castellonfloreslaw.comcpcalendars.castellonfloreslaw.comcpcontacts.castellonfloreslaw.commail.castellonfloreslaw.comwebdisk.castellonfloreslaw.comwebmail.castellonfloreslaw.comwww.castellonfloreslaw.com
autodiscover.createwebsiteseasily.comautodiscover.ennvisionn.comcpanel.createwebsiteseasily.comcpanel.ennvisionn.comcpcalendars.createwebsiteseasily.comcpcalendars.ennvisionn.comcpcontacts.createwebsiteseasily.comcpcontacts.ennvisionn.comcreatewebsiteseasily.comennvisionn.comennvisionn.createwebsiteseasily.commail.createwebsiteseasily.commail.ennvisionn.comwebdisk.createwebsiteseasily.comwebdisk.ennvisionn.comwebmail.createwebsiteseasily.comwebmail.ennvisionn.comwww.createwebsiteseasily.comwww.ennvisionn.comwww.ennvisionn.createwebsiteseasily.com
artaffairs.galleryautodiscover.artaffairs.gallerycpanel.artaffairs.gallerycpcalendars.artaffairs.gallerycpcontacts.artaffairs.gallerymail.artaffairs.gallerywebdisk.artaffairs.gallerywebmail.artaffairs.gallerywww.artaffairs.gallery
autodiscover.justallgxxd.comcpanel.justallgxxd.comcpcalendars.justallgxxd.comcpcontacts.justallgxxd.comjustallgxxd.commail.justallgxxd.comwebdisk.justallgxxd.comwebmail.justallgxxd.comwww.justallgxxd.com
autodiscover.forensictrainersymposium.comcpanel.forensictrainersymposium.comcpcalendars.forensictrainersymposium.comcpcontacts.forensictrainersymposium.comforensictrainersymposium.commail.forensictrainersymposium.comwebdisk.forensictrainersymposium.comwebmail.forensictrainersymposium.comwebsite-4305e3a8.forensicpocketguide.comwww.forensictrainersymposium.comwww.website-4305e3a8.forensicpocketguide.com
renewyou.alvinwayneweiss.comwww.renewyou.alvinwayneweiss.com
autodiscover.karenjadams.netcpanel.karenjadams.netcpcalendars.karenjadams.netcpcontacts.karenjadams.netkarenjadams.netmail.karenjadams.netmail.penprojects.compenprojects.comwebdisk.karenjadams.netwebmail.karenjadams.netwww.karenjadams.netwww.penprojects.com
autodiscover.tuukkablab.comcpanel.tuukkablab.comcpcalendars.tuukkablab.comcpcontacts.tuukkablab.commail.tuukkablab.comtuukkablab.comwebdisk.tuukkablab.comwebmail.tuukkablab.comwww.tuukkablab.com
autodiscover.iig.ocl.mybluehost.mecpanel.iig.ocl.mybluehost.mecpcalendars.iig.ocl.mybluehost.mecpcontacts.iig.ocl.mybluehost.meiig.ocl.mybluehost.memail.iig.ocl.mybluehost.memail.wealthywallets.orgwealthywallets.orgwebdisk.iig.ocl.mybluehost.mewebmail.iig.ocl.mybluehost.mewww.iig.ocl.mybluehost.mewww.wealthywallets.org
autodiscover.yke.cup.mybluehost.mecpanel.yke.cup.mybluehost.mecpcalendars.yke.cup.mybluehost.mecpcontacts.yke.cup.mybluehost.medunestrailers.commail.dunestrailers.commail.yke.cup.mybluehost.mewebdisk.yke.cup.mybluehost.mewebmail.yke.cup.mybluehost.mewww.dunestrailers.comwww.yke.cup.mybluehost.meyke.cup.mybluehost.me
autodiscover.katiagupta.comcpanel.katiagupta.comcpcalendars.katiagupta.comcpcontacts.katiagupta.comkatiagupta.commail.katiagupta.comwebdisk.katiagupta.comwebmail.katiagupta.comwww.katiagupta.com
autodiscover.kreativeways.com.aucpcalendars.kreativeways.com.aucpcontacts.kreativeways.com.aukreativeways.com.aumail.kreativeways.com.auwebdisk.kreativeways.com.auwebsite-d4c38e9c.ram.zga.mybluehost.mewww.kreativeways.com.auwww.website-d4c38e9c.ram.zga.mybluehost.me
autodiscover.vjo.hgs.mybluehost.mecpanel.vjo.hgs.mybluehost.mecpcalendars.vjo.hgs.mybluehost.mecpcontacts.vjo.hgs.mybluehost.meindispensabilitypro.commail.vjo.hgs.mybluehost.mevjo.hgs.mybluehost.mewebdisk.vjo.hgs.mybluehost.mewebmail.vjo.hgs.mybluehost.mewww.indispensabilitypro.comwww.vjo.hgs.mybluehost.me
autodiscover.newhurleychurch.orgcpanel.newhurleychurch.orgcpcalendars.newhurleychurch.orgcpcontacts.newhurleychurch.orgmail.newhurleychurch.orgnewhurleychurch.orgwebdisk.newhurleychurch.orgwebmail.newhurleychurch.orgwww.newhurleychurch.org
autodiscover.fjh.dwa.mybluehost.mecpanel.fjh.dwa.mybluehost.mecpcalendars.fjh.dwa.mybluehost.mecpcontacts.fjh.dwa.mybluehost.mefjh.dwa.mybluehost.memail.fjh.dwa.mybluehost.mewebdisk.fjh.dwa.mybluehost.mewebmail.fjh.dwa.mybluehost.mewww.fjh.dwa.mybluehost.me
androidrobotproductions.comandroidrobotstudios.androidrobotproductions.comandroidrobotstudios.comautodiscover.androidrobotproductions.comautodiscover.androidrobotstudios.comcpanel.androidrobotproductions.comcpanel.androidrobotstudios.comcpcalendars.androidrobotproductions.comcpcalendars.androidrobotstudios.comcpcontacts.androidrobotproductions.comcpcontacts.androidrobotstudios.commail.androidrobotproductions.commail.androidrobotstudios.comwebdisk.androidrobotproductions.comwebdisk.androidrobotstudios.comwebmail.androidrobotproductions.comwebmail.androidrobotstudios.comwww.androidrobotproductions.comwww.androidrobotstudios.androidrobotproductions.comwww.androidrobotstudios.com
autodiscover.sof.frl.mybluehost.mecpanel.sof.frl.mybluehost.mecpcalendars.sof.frl.mybluehost.mecpcontacts.sof.frl.mybluehost.medarkkamala.commail.darkkamala.commail.sof.frl.mybluehost.mesof.frl.mybluehost.mewebdisk.sof.frl.mybluehost.mewebmail.sof.frl.mybluehost.mewww.darkkamala.comwww.sof.frl.mybluehost.me
alwehdaclub.saksi.fnp.mybluehost.memail.alwehdaclub.samail.ksi.fnp.mybluehost.mewww.alwehdaclub.sawww.ksi.fnp.mybluehost.me
autodiscover.formydiet.comcpanel.formydiet.comcpcalendars.formydiet.comcpcontacts.formydiet.comformydiet-com.sunmulgift.comformydiet.commail.formydiet.comwebdisk.formydiet.comwebmail.formydiet.comwww.formydiet-com.sunmulgift.comwww.formydiet.com
autodiscover.xfv.peu.mybluehost.mecpanel.xfv.peu.mybluehost.mecpcalendars.xfv.peu.mybluehost.mecpcontacts.xfv.peu.mybluehost.memail.volleykats.commail.xfv.peu.mybluehost.mevolleykats.comwebdisk.xfv.peu.mybluehost.mewebmail.xfv.peu.mybluehost.mewww.volleykats.comwww.xfv.peu.mybluehost.mexfv.peu.mybluehost.me
autodiscover.paintedwolfhealingarts.comcpanel.paintedwolfhealingarts.comcpcalendars.paintedwolfhealingarts.comcpcontacts.paintedwolfhealingarts.commail.paintedwolfhealingarts.compaintedwolfhealingarts.compaintedwolfhealingarts.paintedwolfmedia.comwebdisk.paintedwolfhealingarts.comwebmail.paintedwolfhealingarts.comwww.paintedwolfhealingarts.comwww.paintedwolfhealingarts.paintedwolfmedia.com
autodiscover.canada-shogi.comcanada-shogi.comcpanel.canada-shogi.comcpcalendars.canada-shogi.comcpcontacts.canada-shogi.commail.canada-shogi.comwebdisk.canada-shogi.comwebmail.canada-shogi.comwww.canada-shogi.com
autodiscover.xdg.fsx.mybluehost.mecpanel.xdg.fsx.mybluehost.mecpcalendars.xdg.fsx.mybluehost.mecpcontacts.xdg.fsx.mybluehost.megulfcoastsurveys.commail.gulfcoastsurveys.commail.xdg.fsx.mybluehost.mewebdisk.xdg.fsx.mybluehost.mewebmail.xdg.fsx.mybluehost.mewww.gulfcoastsurveys.comwww.xdg.fsx.mybluehost.mexdg.fsx.mybluehost.me
autodiscover.fresaj.comcpanel.fresaj.comcpcalendars.fresaj.comcpcontacts.fresaj.comfresaj.commail.fresaj.comwebdisk.fresaj.comwebmail.fresaj.comwww.fresaj.com
autodiscover.hra.uzz.mybluehost.mecpanel.hra.uzz.mybluehost.mecpcalendars.hra.uzz.mybluehost.mecpcontacts.hra.uzz.mybluehost.mehra.uzz.mybluehost.memail.hra.uzz.mybluehost.mewebdisk.hra.uzz.mybluehost.mewebmail.hra.uzz.mybluehost.mewww.hra.uzz.mybluehost.me
autodiscover.jafferhasan.comcpanel.jafferhasan.comcpcalendars.jafferhasan.comcpcontacts.jafferhasan.comjafferhasan.commail.jafferhasan.comwebdisk.jafferhasan.comwebmail.jafferhasan.comwebsite-add0827e.xlr.kdb.mybluehost.mewww.jafferhasan.comwww.website-add0827e.xlr.kdb.mybluehost.me
autodiscover.gpe.rsl.mybluehost.mecpanel.gpe.rsl.mybluehost.mecpcalendars.gpe.rsl.mybluehost.mecpcontacts.gpe.rsl.mybluehost.megpe.rsl.mybluehost.memail.gpe.rsl.mybluehost.memail.thelatenotes.commail.thelatenotesband.com.authelatenotes.comthelatenotesband.com.auwebdisk.gpe.rsl.mybluehost.mewebmail.gpe.rsl.mybluehost.mewww.gpe.rsl.mybluehost.mewww.thelatenotes.comwww.thelatenotesband.com.au
autodiscover.sai.sbv.mybluehost.meblucapinvest.comcpanel.sai.sbv.mybluehost.mecpcalendars.sai.sbv.mybluehost.mecpcontacts.sai.sbv.mybluehost.memail.sai.sbv.mybluehost.mesai.sbv.mybluehost.mewebdisk.sai.sbv.mybluehost.mewebmail.sai.sbv.mybluehost.mewww.blucapinvest.comwww.sai.sbv.mybluehost.me
autodiscover.blueandgrayfinancial.comblueandgrayfinancial.comcpanel.blueandgrayfinancial.comcpcalendars.blueandgrayfinancial.comcpcontacts.blueandgrayfinancial.commail.blueandgrayfinancial.commail.nln.pvh.mybluehost.menln.pvh.mybluehost.mepatriotfederal.comwebdisk.blueandgrayfinancial.comwebmail.blueandgrayfinancial.comwww.blueandgrayfinancial.comwww.nln.pvh.mybluehost.mewww.patriotfederal.com
autodiscover.freedomafter50club.comcpanel.freedomafter50club.comcpcalendars.freedomafter50club.comcpcontacts.freedomafter50club.comfreedomafter50club.commail.freedomafter50club.comwebdisk.freedomafter50club.comwebmail.freedomafter50club.comwww.freedomafter50club.com
autodiscover.strategicmathsolutions.comcpanel.strategicmathsolutions.comcpcalendars.strategicmathsolutions.comcpcontacts.strategicmathsolutions.commail.strategicmathsolutions.comstrategicmathsolutions.comwebdisk.strategicmathsolutions.comwebmail.strategicmathsolutions.comwww.strategicmathsolutions.com
autodiscover.robertdryer.comcpanel.robertdryer.comcpcalendars.robertdryer.comcpcontacts.robertdryer.commail.robertdryer.comrobertdryer.comwebdisk.robertdryer.comwebmail.robertdryer.comwww.robertdryer.com
autodiscover.ond.emu.mybluehost.mecpanel.ond.emu.mybluehost.mecpcalendars.ond.emu.mybluehost.mecpcontacts.ond.emu.mybluehost.memail.ond.emu.mybluehost.meond.emu.mybluehost.mewebdisk.ond.emu.mybluehost.mewebmail.ond.emu.mybluehost.mewww.ond.emu.mybluehost.me
autodiscover.kfarringtondesigns.comcpanel.kfarringtondesigns.comcpcalendars.kfarringtondesigns.comcpcontacts.kfarringtondesigns.comkfarringtondesigns.commail.kfarringtondesigns.comwebdisk.kfarringtondesigns.comwebmail.kfarringtondesigns.comwww.kfarringtondesigns.com
autodiscover.drwendylevy.comcpanel.drwendylevy.comcpcalendars.drwendylevy.comcpcontacts.drwendylevy.comdrwendylevy.commail.drwendylevy.comwebdisk.drwendylevy.comwebmail.drwendylevy.comwww.drwendylevy.com
autodiscover.julietafumberg.combalancedvirtually.combalancedvirtually.iib.jso.mybluehost.mecpanel.balancedvirtually.comcpanel.julietafumberg.comcpcalendars.balancedvirtually.comcpcalendars.julietafumberg.comcpcontacts.balancedvirtually.comcpcontacts.julietafumberg.comjulietafumberg.comjulietafumberg.iib.jso.mybluehost.memail.balancedvirtually.commail.julietafumberg.comwebdisk.balancedvirtually.comwebdisk.julietafumberg.comwebmail.balancedvirtually.comwebmail.julietafumberg.comwww.balancedvirtually.comwww.balancedvirtually.iib.jso.mybluehost.mewww.julietafumberg.comwww.julietafumberg.iib.jso.mybluehost.me
autodiscover.zzj.etw.mybluehost.mecpanel.zzj.etw.mybluehost.mecpcalendars.zzj.etw.mybluehost.mecpcontacts.zzj.etw.mybluehost.memail.zzj.etw.mybluehost.memya1tc.comwebdisk.zzj.etw.mybluehost.mewebmail.zzj.etw.mybluehost.mewww.zzj.etw.mybluehost.mezzj.etw.mybluehost.me
autodiscover.forensicpocketguide.comcpanel.forensicpocketguide.comcpcalendars.forensicpocketguide.comcpcontacts.forensicpocketguide.comforensicpocketguide.comine.rdx.mybluehost.memail.forensicpocketguide.commail.ine.rdx.mybluehost.mewebdisk.forensicpocketguide.comwebmail.forensicpocketguide.comwww.forensicpocketguide.comwww.ine.rdx.mybluehost.me
autodiscover.kkcf-gmi.orgcpanel.kkcf-gmi.orgcpcalendars.kkcf-gmi.orgcpcontacts.kkcf-gmi.orgkkcf-gmi.orgmail.kkcf-gmi.orgwebdisk.kkcf-gmi.orgwebmail.kkcf-gmi.orgwww.kkcf-gmi.org
autodiscover.mygeotokens.comcpanel.mygeotokens.comcpcalendars.mygeotokens.comcpcontacts.mygeotokens.commail.mygeotokens.commygeotokens.commygeotokens.mindyourown.lifewebdisk.mygeotokens.comwebmail.mygeotokens.comwww.mygeotokens.comwww.mygeotokens.mindyourown.life
androidrobotmusic.comautodiscover.androidrobotmusic.comautodiscover.independentmusicproduction.comcpanel.androidrobotmusic.comcpanel.independentmusicproduction.comcpcalendars.androidrobotmusic.comcpcalendars.independentmusicproduction.comcpcontacts.androidrobotmusic.comcpcontacts.independentmusicproduction.comindependentmusicproduction.androidrobotproductions.comindependentmusicproduction.commail.androidrobotmusic.commail.independentmusicproduction.comwebdisk.androidrobotmusic.comwebdisk.independentmusicproduction.comwebmail.androidrobotmusic.comwebmail.independentmusicproduction.comwww.androidrobotmusic.comwww.independentmusicproduction.androidrobotproductions.comwww.independentmusicproduction.com
autodiscover.brandonolin.combrandonolin.comcpanel.brandonolin.comcpcalendars.brandonolin.comcpcontacts.brandonolin.commail.brandonolin.comwebdisk.brandonolin.comwebmail.brandonolin.comwww.brandonolin.com
autodiscover.henryjoseph.comcpanel.henryjoseph.comcpcalendars.henryjoseph.comcpcontacts.henryjoseph.comhenryjoseph.comhenryjoseph.spokespersonagency.commail.henryjoseph.comwebdisk.henryjoseph.comwebmail.henryjoseph.comwww.henryjoseph.comwww.henryjoseph.spokespersonagency.com
autodiscover.bayesinvest.combayesinvest.comcpanel.bayesinvest.comcpcalendars.bayesinvest.comcpcontacts.bayesinvest.commail.bayesinvest.comwebdisk.bayesinvest.comwebmail.bayesinvest.comwww.bayesinvest.com
autodiscover.littlemermaidglassbottomboat.comcpanel.littlemermaidglassbottomboat.comcpcalendars.littlemermaidglassbottomboat.comcpcontacts.littlemermaidglassbottomboat.comlittlemermaidglassbottomboat.commail.littlemermaidglassbottomboat.comwebdisk.littlemermaidglassbottomboat.comwebmail.littlemermaidglassbottomboat.comwww.littlemermaidglassbottomboat.com
autodiscover.socialjones.comcpanel.socialjones.comcpcalendars.socialjones.comcpcontacts.socialjones.commail.mythmagick.commail.socialjones.comsocialjones.comwebdisk.socialjones.comwebmail.socialjones.com
autodiscover.gnsenterprises.com.pkautodiscover.xlr.kdb.mybluehost.mecpanel.gnsenterprises.com.pkcpanel.xlr.kdb.mybluehost.mecpcalendars.gnsenterprises.com.pkcpcalendars.xlr.kdb.mybluehost.mecpcontacts.gnsenterprises.com.pkcpcontacts.xlr.kdb.mybluehost.megnsenterprises.com.pkmail.gnsenterprises.com.pkmail.vfktogether.orgmail.xlr.kdb.mybluehost.mevfktogether.orgwebdisk.gnsenterprises.com.pkwebdisk.xlr.kdb.mybluehost.mewebmail.gnsenterprises.com.pkwebmail.xlr.kdb.mybluehost.mewebsite-4d30039e.xlr.kdb.mybluehost.mewww.gnsenterprises.com.pkwww.vfktogether.orgwww.website-4d30039e.xlr.kdb.mybluehost.mewww.xlr.kdb.mybluehost.mexlr.kdb.mybluehost.me
autodiscover.hmbll.comcpanel.hmbll.comcpcalendars.hmbll.comcpcontacts.hmbll.comhmbll.commail.hmbll.comwebdisk.hmbll.comwebmail.hmbll.comwebsite-00475774.ane.pzr.mybluehost.mewww.hmbll.comwww.website-00475774.ane.pzr.mybluehost.me
arizonareliablemoving.comarizonareliablemoving.vrv.vjk.mybluehost.meautodiscover.arizonareliablemoving.comcpanel.arizonareliablemoving.comcpcalendars.arizonareliablemoving.comcpcontacts.arizonareliablemoving.commail.arizonareliablemoving.comoffer.arizonareliablemoving.comwebdisk.arizonareliablemoving.comwebmail.arizonareliablemoving.comwww.arizonareliablemoving.comwww.arizonareliablemoving.vrv.vjk.mybluehost.mewww.offer.arizonareliablemoving.com
autodiscover.gagereviews.comcpanel.gagereviews.comcpcalendars.gagereviews.comcpcontacts.gagereviews.comgagereviews.commail.gagereviews.comwebdisk.gagereviews.comwebmail.gagereviews.comwww.gagereviews.com
autodiscover.sweetbakingadventures.comcpanel.sweetbakingadventures.comcpcalendars.sweetbakingadventures.comcpcontacts.sweetbakingadventures.commail.pvh.qjv.mybluehost.memail.sweetbakingadventures.compvh.qjv.mybluehost.mesweetbakingadventures.comwebdisk.sweetbakingadventures.comwebmail.sweetbakingadventures.comwww.pvh.qjv.mybluehost.mewww.sweetbakingadventures.com
abe.oqk.mybluehost.meautodiscover.abe.oqk.mybluehost.mecpanel.abe.oqk.mybluehost.mecpcalendars.abe.oqk.mybluehost.mecpcontacts.abe.oqk.mybluehost.mecurlyhairproducts.commail.abe.oqk.mybluehost.mewebdisk.abe.oqk.mybluehost.mewebmail.abe.oqk.mybluehost.mewww.abe.oqk.mybluehost.mewww.curlyhairproducts.com
autodiscover.leadcometdigital.comcpanel.leadcometdigital.comcpcalendars.leadcometdigital.comcpcontacts.leadcometdigital.comlead-comet.comleadcometdigital.commail.lead-comet.commail.leadcometdigital.comwebdisk.leadcometdigital.comwebmail.leadcometdigital.comwww.lead-comet.comwww.leadcometdigital.com
autodiscover.lenale.spacecpanel.lenale.spacecpcalendars.lenale.spacecpcontacts.lenale.spacelenale.spacemail.lenale.spacemail.zdj.lnl.mybluehost.mewebdisk.lenale.spacewebmail.lenale.spacewww.lenale.spacewww.zdj.lnl.mybluehost.mezdj.lnl.mybluehost.me
autodiscover.avisofitness.comautodiscover.schnoodledesign.comavisofitness.booktipper.comavisofitness.comcpanel.avisofitness.comcpanel.schnoodledesign.comcpcalendars.avisofitness.comcpcalendars.schnoodledesign.comcpcontacts.avisofitness.comcpcontacts.schnoodledesign.commail.avisofitness.commail.schnoodledesign.comschnoodledesign.booktipper.comschnoodledesign.comwebdisk.avisofitness.comwebdisk.schnoodledesign.comwebmail.avisofitness.comwebmail.schnoodledesign.comwww.avisofitness.booktipper.comwww.avisofitness.comwww.schnoodledesign.booktipper.comwww.schnoodledesign.comwww.your-fitness-guru.booktipper.comyour-fitness-guru.booktipper.com
cpanel.nurturedsoulrd.comcpcalendars.nurturedsoulrd.comcpcontacts.nurturedsoulrd.commail.nurturedsoulrd.comnurturedsoulrd.comwebdisk.nurturedsoulrd.comwebmail.nurturedsoulrd.comwww.nurturedsoulrd.com
autodiscover.hobib.caautodiscover.mindyourownbirth.cacpanel.hobib.cacpanel.mindyourownbirth.cacpcalendars.hobib.cacpcalendars.mindyourownbirth.cacpcontacts.hobib.cacpcontacts.mindyourownbirth.cahobib-ca.mindyourown.lifehobib.camail.hobib.camail.mindyourownbirth.camindyourownbirth-ca.mindyourown.lifemindyourownbirth.cawebdisk.hobib.cawebdisk.mindyourownbirth.cawebmail.hobib.cawebmail.mindyourownbirth.cawww.hobib-ca.mindyourown.lifewww.hobib.cawww.mindyourownbirth-ca.mindyourown.lifewww.mindyourownbirth.ca
autodiscover.suncoastbaptistchurch.infocpanel.suncoastbaptistchurch.infocpcalendars.suncoastbaptistchurch.infocpcontacts.suncoastbaptistchurch.infomail.suncoastbaptistchurch.infosuncoastbaptistchurch.infowebdisk.suncoastbaptistchurch.infowebmail.suncoastbaptistchurch.infowww.suncoastbaptistchurch.info
autodiscover.lougheedband.comautodiscover.walkabouthills.comcpanel.lougheedband.comcpanel.walkabouthills.comcpcalendars.lougheedband.comcpcalendars.walkabouthills.comcpcontacts.lougheedband.comcpcontacts.walkabouthills.comlougheedband.comlougheedband.paintedwolfmedia.commail.lougheedband.commail.walkabouthills.comwalkabouthills.comwalkabouthills.paintedwolfmedia.comwebdisk.lougheedband.comwebdisk.walkabouthills.comwebmail.lougheedband.comwebmail.walkabouthills.comwww.lougheedband.comwww.lougheedband.paintedwolfmedia.comwww.walkabouthills.comwww.walkabouthills.paintedwolfmedia.com
autodiscover.lanikaiyatomi.comcpanel.lanikaiyatomi.comcpcalendars.lanikaiyatomi.comcpcontacts.lanikaiyatomi.comlanikaiyatomi.commail.lanikaiyatomi.comwebdisk.lanikaiyatomi.comwebmail.lanikaiyatomi.comwww.lanikaiyatomi.com
autodiscover.georgiaparis.netcpanel.georgiaparis.netcpcalendars.georgiaparis.netcpcontacts.georgiaparis.netgeorgiaparis.netmail.georgiaparis.netwebdisk.georgiaparis.netwebmail.georgiaparis.netwebsite-6079b47d.wqb.fgc.mybluehost.mewww.georgiaparis.netwww.website-6079b47d.wqb.fgc.mybluehost.me
animefreesite.comanimefreesite.sunmulgift.comautodiscover.animefreesite.comcpanel.animefreesite.comcpcalendars.animefreesite.comcpcontacts.animefreesite.commail.animefreesite.comwebdisk.animefreesite.comwebmail.animefreesite.comwww.animefreesite.comwww.animefreesite.sunmulgift.com
autodiscover.generalcontractorcapemay.comautodiscover.southjerseyhomeadditions.comcpanel.generalcontractorcapemay.comcpanel.southjerseyhomeadditions.comcpcalendars.generalcontractorcapemay.comcpcalendars.southjerseyhomeadditions.comcpcontacts.generalcontractorcapemay.comcpcontacts.southjerseyhomeadditions.comgeneralcontractorcapemay.commail.generalcontractorcapemay.commail.southjerseyhomeadditions.comsouthjerseyhomeadditions.comwebdisk.generalcontractorcapemay.comwebdisk.southjerseyhomeadditions.comwebmail.generalcontractorcapemay.comwebmail.southjerseyhomeadditions.comwebsite-9fc6149c.ygo.bsd.mybluehost.mewebsite-e8fb4000.ygo.bsd.mybluehost.mewww.generalcontractorcapemay.comwww.southjerseyhomeadditions.comwww.website-9fc6149c.ygo.bsd.mybluehost.mewww.website-e8fb4000.ygo.bsd.mybluehost.me
autodiscover.odd-1.comcpanel.odd-1.comcpcalendars.odd-1.comcpcontacts.odd-1.commail.odd-1.comodd-1.comwebdisk.odd-1.comwebmail.odd-1.comwww.odd-1.com
autodiscover.effectualwaves.comcpanel.effectualwaves.comcpcalendars.effectualwaves.comcpcontacts.effectualwaves.comeffectualwaves.commail.effectualwaves.comwebdisk.effectualwaves.comwebmail.effectualwaves.comwww.effectualwaves.com
autodiscover.ncn.ihj.mybluehost.mecpanel.ncn.ihj.mybluehost.mecpcalendars.ncn.ihj.mybluehost.mecpcontacts.ncn.ihj.mybluehost.memail.ncn.ihj.mybluehost.mencn.ihj.mybluehost.mewebdisk.ncn.ihj.mybluehost.mewebmail.ncn.ihj.mybluehost.mewww.ncn.ihj.mybluehost.me
cpanel.espsigns.comcpcalendars.espsigns.comcpcontacts.espsigns.comespsigns.commail.espsigns.comwebdisk.espsigns.comwebmail.espsigns.comwww.espsigns.com
medicareplansrx.blueandgrayfinancial.comwww.medicareplansrx.blueandgrayfinancial.com
autodiscover.copyrightok.krautodiscover.dietsupplementsranking.comcopyrightok-kr.sunmulgift.comcopyrightok.krcpanel.copyrightok.krcpanel.dietsupplementsranking.comcpcalendars.copyrightok.krcpcalendars.dietsupplementsranking.comcpcontacts.copyrightok.krcpcontacts.dietsupplementsranking.comdietsupplementsranking-com.sunmulgift.comdietsupplementsranking.commail.copyrightok.krmail.dietsupplementsranking.comwebdisk.copyrightok.krwebdisk.dietsupplementsranking.comwebmail.copyrightok.krwebmail.dietsupplementsranking.comwww.copyrightok-kr.sunmulgift.comwww.copyrightok.krwww.dietsupplementsranking-com.sunmulgift.comwww.dietsupplementsranking.com
autodiscover.qdc.vhl.mybluehost.mecpanel.qdc.vhl.mybluehost.mecpcalendars.qdc.vhl.mybluehost.mecpcontacts.qdc.vhl.mybluehost.memail.qdc.vhl.mybluehost.meqdc.vhl.mybluehost.mewebdisk.qdc.vhl.mybluehost.mewebmail.qdc.vhl.mybluehost.mewww.qdc.vhl.mybluehost.me
autodiscover.weightlossmasterzone.comcin4m-com.sunmulgift.comcpanel.weightlossmasterzone.comcpcalendars.weightlossmasterzone.comcpcontacts.weightlossmasterzone.commail.weightlossmasterzone.comwebdisk.weightlossmasterzone.comwebmail.weightlossmasterzone.comweightlossmasterzone.comweightlossmasterzone.sunmulgift.comwww.cin4m-com.sunmulgift.comwww.weightlossmasterzone.comwww.weightlossmasterzone.sunmulgift.com
itpro-consultants.comwww.itpro-consultants.com
autodiscover.hkr.vcj.mybluehost.mecpanel.hkr.vcj.mybluehost.mecpcalendars.hkr.vcj.mybluehost.mecpcontacts.hkr.vcj.mybluehost.mehkr.vcj.mybluehost.memail.hkr.vcj.mybluehost.memail.preachfromthehousetops.compreachfromthehousetops.comwebdisk.hkr.vcj.mybluehost.mewebmail.hkr.vcj.mybluehost.mewww.hkr.vcj.mybluehost.mewww.preachfromthehousetops.com
kelpark.orgwww.kelpark.org
autodiscover.thegaldamezlandscaping.comcpanel.thegaldamezlandscaping.comcpcalendars.thegaldamezlandscaping.comcpcontacts.thegaldamezlandscaping.commail.thegaldamezlandscaping.comthegaldamezlandscaping.comwebdisk.thegaldamezlandscaping.comwebmail.thegaldamezlandscaping.comwww.thegaldamezlandscaping.com
autodiscover.sammysexports.comcpanel.sammysexports.comcpcalendars.sammysexports.comcpcontacts.sammysexports.commail.sammysexports.comsammysexports.comsammysexports.juniorscourt.comwebdisk.sammysexports.comwebmail.sammysexports.comwww.sammysexports.comwww.sammysexports.juniorscourt.com
altaseadsconservancy.orgautodiscover.altaseadsconservancy.orgcpanel.altaseadsconservancy.orgcpcalendars.altaseadsconservancy.orgcpcontacts.altaseadsconservancy.orgcqg.pgm.mybluehost.mekelp-ark.orgmail.cqg.pgm.mybluehost.memail.kelp-ark.orgwebdisk.altaseadsconservancy.orgwebmail.altaseadsconservancy.orgwebsite-bc2f9a8b.altaseadsconservancy.orgwww.altaseadsconservancy.orgwww.cqg.pgm.mybluehost.mewww.kelp-ark.orgwww.website-bc2f9a8b.altaseadsconservancy.org
autodiscover.charlotteandscottadopt.comcharlotteandscottadopt.comcpanel.charlotteandscottadopt.comcpcalendars.charlotteandscottadopt.comcpcontacts.charlotteandscottadopt.commail.charlotteandscottadopt.comwebdisk.charlotteandscottadopt.comwebmail.charlotteandscottadopt.comwww.charlotteandscottadopt.com
springerpublications.zbo.pfi.mybluehost.mewww.springerpublications.zbo.pfi.mybluehost.me
autodiscover.rxn.kdf.mybluehost.mecpanel.rxn.kdf.mybluehost.mecpcalendars.rxn.kdf.mybluehost.mecpcontacts.rxn.kdf.mybluehost.memail.rxn.kdf.mybluehost.merxn.kdf.mybluehost.mewebdisk.rxn.kdf.mybluehost.mewebmail.rxn.kdf.mybluehost.mewww.rxn.kdf.mybluehost.me
autodiscover.michaeljcordell.comcpanel.michaeljcordell.comcpcalendars.michaeljcordell.comcpcontacts.michaeljcordell.commail.michaeljcordell.commichaeljcordell.comwebdisk.michaeljcordell.comwebmail.michaeljcordell.comwww.michaeljcordell.com
autodiscover.tcbuilderli.comcpanel.tcbuilderli.comcpcalendars.tcbuilderli.comcpcontacts.tcbuilderli.commail.tcbuilderli.comtcbuilderli.comwebdisk.tcbuilderli.comwebmail.tcbuilderli.comwww.tcbuilderli.com
autodiscover.ehfs.healthcpanel.ehfs.healthcpcalendars.ehfs.healthcpcontacts.ehfs.healthehfs.healthmail.ehfs.healthwebdisk.ehfs.healthwebmail.ehfs.healthwww.ehfs.health
autodiscover.hammocktravelers.comcpanel.hammocktravelers.comcpcalendars.hammocktravelers.comcpcontacts.hammocktravelers.comhammocktravelers.comhammocktravelers.hza.chb.mybluehost.memail.hammocktravelers.comwebdisk.hammocktravelers.comwebmail.hammocktravelers.comwww.hammocktravelers.comwww.hammocktravelers.hza.chb.mybluehost.me
website-d0df5eca.marksolomon.netwww.website-d0df5eca.marksolomon.net
autodiscover.swt.nuh.mybluehost.mecpanel.swt.nuh.mybluehost.mecpcalendars.swt.nuh.mybluehost.mecpcontacts.swt.nuh.mybluehost.memail.saddleabout.commail.swt.nuh.mybluehost.mesaddleabout.comswt.nuh.mybluehost.mewebdisk.swt.nuh.mybluehost.mewebmail.swt.nuh.mybluehost.mewww.saddleabout.comwww.swt.nuh.mybluehost.me
autodiscover.bludesigns.cabludesigns.cacpanel.bludesigns.cacpcalendars.bludesigns.cacpcontacts.bludesigns.cafjh.srl.mybluehost.memail.bludesigns.camail.fjh.srl.mybluehost.mewebdisk.bludesigns.cawebmail.bludesigns.cawebsite-05baae61.bludesigns.cawww.bludesigns.cawww.fjh.srl.mybluehost.mewww.website-05baae61.bludesigns.ca
888lockuup.comautodiscover.888lockuup.comcpanel.888lockuup.comcpcalendars.888lockuup.comcpcontacts.888lockuup.commail.888lockuup.comwebdisk.888lockuup.comwebmail.888lockuup.comwww.888lockuup.com
autodiscover.erinnkdaniel.comcpanel.erinnkdaniel.comcpcalendars.erinnkdaniel.comcpcontacts.erinnkdaniel.comerinnkdaniel.comerinnkdaniel.vmr.arb.mybluehost.memail.erinnkdaniel.comwebdisk.erinnkdaniel.comwebmail.erinnkdaniel.comwww.erinnkdaniel.comwww.erinnkdaniel.vmr.arb.mybluehost.me
autodiscover.fqy.bsv.mybluehost.mecpanel.fqy.bsv.mybluehost.mecpcalendars.fqy.bsv.mybluehost.mecpcontacts.fqy.bsv.mybluehost.mefoundartfactory-net.fqy.bsv.mybluehost.mefoundartfactory.netfqy.bsv.mybluehost.memail.foundartfactory.netmail.fqy.bsv.mybluehost.mewebdisk.fqy.bsv.mybluehost.mewebmail.fqy.bsv.mybluehost.mewww.foundartfactory-net.fqy.bsv.mybluehost.mewww.foundartfactory.netwww.fqy.bsv.mybluehost.me
autodiscover.thecoopers.designcpanel.thecoopers.designcpcalendars.thecoopers.designcpcontacts.thecoopers.designmail.thecoopers.designthecoopers-design.mindyourown.lifethecoopers.designwebdisk.thecoopers.designwebmail.thecoopers.designwww.thecoopers-design.mindyourown.lifewww.thecoopers.design
ane.pzr.mybluehost.meautodiscover.ane.pzr.mybluehost.mecpanel.ane.pzr.mybluehost.mecpcalendars.ane.pzr.mybluehost.mecpcontacts.ane.pzr.mybluehost.memail.ane.pzr.mybluehost.mewebdisk.ane.pzr.mybluehost.mewebmail.ane.pzr.mybluehost.mewww.ane.pzr.mybluehost.me
ardsoftsolutions.comautodiscover.bzn.nst.mybluehost.mebzn.nst.mybluehost.mecpanel.bzn.nst.mybluehost.mecpcalendars.bzn.nst.mybluehost.mecpcontacts.bzn.nst.mybluehost.memail.bzn.nst.mybluehost.mewebdisk.bzn.nst.mybluehost.mewebmail.bzn.nst.mybluehost.mewww.ardsoftsolutions.comwww.bzn.nst.mybluehost.me
website-6ed183b1.geckographix.cawww.website-6ed183b1.geckographix.ca
autodiscover.shrmehdi.comchangeskills.comchangeskills.thementoringprogram.comcpanel.changeskills.comcpanel.shrmehdi.comcpcalendars.changeskills.comcpcalendars.shrmehdi.comcpcontacts.changeskills.comcpcontacts.shrmehdi.commail.shrmehdi.comshrmehdi.comshrmehdi.thementoringprogram.comwebdisk.changeskills.comwebdisk.shrmehdi.comwebmail.changeskills.comwebmail.shrmehdi.comwww.changeskills.comwww.changeskills.thementoringprogram.comwww.shrmehdi.comwww.shrmehdi.thementoringprogram.com
autodiscover.gsb.ekr.mybluehost.mecpanel.gsb.ekr.mybluehost.mecpcalendars.gsb.ekr.mybluehost.mecpcontacts.gsb.ekr.mybluehost.mefloridagirltravels.comgsb.ekr.mybluehost.memail.floridagirltravels.commail.gsb.ekr.mybluehost.mewebdisk.gsb.ekr.mybluehost.mewebmail.gsb.ekr.mybluehost.mewww.floridagirltravels.comwww.gsb.ekr.mybluehost.me
autodiscover.tinitiatives.comcpanel.tinitiatives.comcpcalendars.tinitiatives.comcpcontacts.tinitiatives.commail.tinitiatives.comtinitiatives.comwebdisk.tinitiatives.comwebmail.tinitiatives.comwebsite-1a89461e.ane.pzr.mybluehost.mewww.tinitiatives.comwww.website-1a89461e.ane.pzr.mybluehost.me
autodiscover.yxo.gqj.mybluehost.mecpanel.yxo.gqj.mybluehost.mecpcalendars.yxo.gqj.mybluehost.mecpcontacts.yxo.gqj.mybluehost.memail.yxo.gqj.mybluehost.mewebdisk.yxo.gqj.mybluehost.mewebmail.yxo.gqj.mybluehost.mewww.yxo.gqj.mybluehost.meyxo.gqj.mybluehost.me
autodiscover.krlinvestors.comcpanel.krlinvestors.comcpcalendars.krlinvestors.comcpcontacts.krlinvestors.comkrlinvestors.commail.krlinvestors.comwebdisk.krlinvestors.comwebmail.krlinvestors.comwww.krlinvestors.com
website-c04e6967.anc.xfn.mybluehost.mewww.website-c04e6967.anc.xfn.mybluehost.me
ascendingarrows.comautodiscover.vjv.mjh.mybluehost.mecpanel.vjv.mjh.mybluehost.mecpcalendars.vjv.mjh.mybluehost.mecpcontacts.vjv.mjh.mybluehost.memail.ascendingarrows.commail.vjv.mjh.mybluehost.mevjv.mjh.mybluehost.mewebdisk.vjv.mjh.mybluehost.mewebmail.vjv.mjh.mybluehost.mewww.ascendingarrows.comwww.vjv.mjh.mybluehost.me
autodiscover.coronaregime.comcoronaregime.comcpanel.coronaregime.comcpcalendars.coronaregime.comcpcontacts.coronaregime.commail.coronaregime.comwebdisk.coronaregime.comwebmail.coronaregime.comwww.coronaregime.com
autodiscover.villanayalmar.comcpanel.villanayalmar.comcpcalendars.villanayalmar.comcpcontacts.villanayalmar.commail.villanayalmar.comvillanayalmar.comwebdisk.villanayalmar.comwebmail.villanayalmar.comwww.villanayalmar.com
autodiscover.qcs.mwd.mybluehost.mecpanel.qcs.mwd.mybluehost.mecpcalendars.qcs.mwd.mybluehost.mecpcontacts.qcs.mwd.mybluehost.memail.qcs.mwd.mybluehost.meoftenplusneverminus.comqcs.mwd.mybluehost.mewebdisk.qcs.mwd.mybluehost.mewebmail.qcs.mwd.mybluehost.mewww.qcs.mwd.mybluehost.me
autodiscover.qrn.ajs.mybluehost.mecpanel.qrn.ajs.mybluehost.mecpcalendars.qrn.ajs.mybluehost.mecpcontacts.qrn.ajs.mybluehost.memail.qrn.ajs.mybluehost.meqrn.ajs.mybluehost.mewebdisk.qrn.ajs.mybluehost.mewebmail.qrn.ajs.mybluehost.mewww.qrn.ajs.mybluehost.me
autodiscover.kco.oxd.mybluehost.mecpanel.kco.oxd.mybluehost.mecpcalendars.kco.oxd.mybluehost.mecpcontacts.kco.oxd.mybluehost.mekco.oxd.mybluehost.memail.kco.oxd.mybluehost.mewebdisk.kco.oxd.mybluehost.mewebmail.kco.oxd.mybluehost.mewww.kco.oxd.mybluehost.me
autodiscover.ottawallpaper.comcpanel.ottawallpaper.comcpcalendars.ottawallpaper.comcpcontacts.ottawallpaper.commail.ottawallpaper.comottawallpaper.comwebdisk.ottawallpaper.comwebmail.ottawallpaper.comwww.ottawallpaper.com
autodiscover.restorativerainbowalliance.orgcpanel.restorativerainbowalliance.orgcpcalendars.restorativerainbowalliance.orgcpcontacts.restorativerainbowalliance.orgmail.restorativerainbowalliance.orgrestorativerainbowalliance.orgwebdisk.restorativerainbowalliance.orgwebmail.restorativerainbowalliance.orgwww.restorativerainbowalliance.org
aironbroadway.comautodiscover.glj.lgu.mybluehost.mecpanel.glj.lgu.mybluehost.mecpcalendars.glj.lgu.mybluehost.mecpcontacts.glj.lgu.mybluehost.meglj.lgu.mybluehost.memail.glj.lgu.mybluehost.mewebdisk.glj.lgu.mybluehost.mewebmail.glj.lgu.mybluehost.mewww.aironbroadway.comwww.glj.lgu.mybluehost.me
cpanel.crz.nmb.mybluehost.mecrz.nmb.mybluehost.memail.crz.nmb.mybluehost.mewebmail.crz.nmb.mybluehost.mewww.crz.nmb.mybluehost.me
cpcalendars.fcitoday.comcpcontacts.fcitoday.comfcitoday.commail.fcitoday.comwebdisk.fcitoday.com
autodiscover.ceb.xfn.mybluehost.meceb.xfn.mybluehost.mecpanel.ceb.xfn.mybluehost.mecpcalendars.ceb.xfn.mybluehost.mecpcontacts.ceb.xfn.mybluehost.memail.ceb.xfn.mybluehost.memail.yesforgreeneview.comwebdisk.ceb.xfn.mybluehost.mewebmail.ceb.xfn.mybluehost.mewww.ceb.xfn.mybluehost.mewww.yesforgreeneview.comyesforgreeneview.com
centralvalleyliftpros.comcpanel.centralvalleyliftpros.comcpcalendars.centralvalleyliftpros.comcpcontacts.centralvalleyliftpros.commail.centralvalleyliftpros.comwebdisk.centralvalleyliftpros.comwebmail.centralvalleyliftpros.comwww.centralvalleyliftpros.com
cpanel.pcproblems.comcpcalendars.pcproblems.comcpcontacts.pcproblems.commail.pcproblems.commail.ryw.etw.mybluehost.mepcproblems.comryw.etw.mybluehost.mewebdisk.pcproblems.comwebmail.pcproblems.comwww.pcproblems.comwww.ryw.etw.mybluehost.me
autodiscover.pzq.kei.mybluehost.mecpanel.pzq.kei.mybluehost.mecpcalendars.pzq.kei.mybluehost.mecpcontacts.pzq.kei.mybluehost.memail.pzq.kei.mybluehost.mepzq.kei.mybluehost.mewebdisk.pzq.kei.mybluehost.mewebmail.pzq.kei.mybluehost.mewww.pzq.kei.mybluehost.me
autodiscover.qfp.ths.mybluehost.mecpanel.qfp.ths.mybluehost.mecpcalendars.qfp.ths.mybluehost.mecpcontacts.qfp.ths.mybluehost.memail.qfp.ths.mybluehost.meqfp.ths.mybluehost.mewebdisk.qfp.ths.mybluehost.mewebmail.qfp.ths.mybluehost.mewww.qfp.ths.mybluehost.me
227media.netautodiscover.227media.netcpanel.227media.netcpcalendars.227media.netcpcontacts.227media.netmail.227media.netwebdisk.227media.netwebmail.227media.netwww.227media.net
autodiscover.recipesandplaces.comcpanel.recipesandplaces.comcpcalendars.recipesandplaces.comcpcontacts.recipesandplaces.commail.recipesandplaces.comrecipesandplaces.comwebdisk.recipesandplaces.comwebmail.recipesandplaces.comwww.recipesandplaces.com
autodiscover.sui.noo.mybluehost.mecpanel.sui.noo.mybluehost.mecpcalendars.sui.noo.mybluehost.mecpcontacts.sui.noo.mybluehost.memail.sui.noo.mybluehost.mesui.noo.mybluehost.mewebdisk.sui.noo.mybluehost.mewebmail.sui.noo.mybluehost.mewww.sui.noo.mybluehost.me
autodiscover.themompoweredhome.comcpanel.themompoweredhome.comcpcalendars.themompoweredhome.comcpcontacts.themompoweredhome.commail.themompoweredhome.comthemompoweredhome.comwebdisk.themompoweredhome.comwebmail.themompoweredhome.comwww.themompoweredhome.com
autodiscover.bestboutiquebooks.combestboutiquebooks.comcpanel.bestboutiquebooks.comcpcalendars.bestboutiquebooks.comcpcontacts.bestboutiquebooks.commail.bestboutiquebooks.comwebdisk.bestboutiquebooks.comwebmail.bestboutiquebooks.comwww.bestboutiquebooks.com
perspectivesireland.perspectivesireland.ietraining.perspectivesireland.iewww.perspectivesireland.perspectivesireland.iewww.training.perspectivesireland.ie
autodiscover.plugovoyhistory.comcpanel.plugovoyhistory.comcpcalendars.plugovoyhistory.comcpcontacts.plugovoyhistory.commail.plugovoyhistory.complugovoyhistory.comwebdisk.plugovoyhistory.comwebmail.plugovoyhistory.comwww.plugovoyhistory.com
lbo.lnl.mybluehost.memail.lbo.lnl.mybluehost.mewww.lbo.lnl.mybluehost.me
agriexotic.comautodiscover.vip.sfg.mybluehost.mecpanel.vip.sfg.mybluehost.mecpcalendars.vip.sfg.mybluehost.mecpcontacts.vip.sfg.mybluehost.memail.vip.sfg.mybluehost.mevip.sfg.mybluehost.mewebdisk.vip.sfg.mybluehost.mewebmail.vip.sfg.mybluehost.mewww.agriexotic.comwww.vip.sfg.mybluehost.me
autodiscover.maideaz.netcpanel.maideaz.netcpcalendars.maideaz.netcpcontacts.maideaz.netmaideaz.netmail.maideaz.netwebdisk.maideaz.netwebmail.maideaz.netwebsite-15891645.lyy.wev.mybluehost.mewww.maideaz.netwww.website-15891645.lyy.wev.mybluehost.me
autodiscover.rbgbank.comcpanel.rbgbank.comcpcalendars.rbgbank.comcpcontacts.rbgbank.commail.rbgbank.comrbgbank.comwebdisk.rbgbank.comwebmail.rbgbank.comwww.rbgbank.com
autodiscover.fvb.bof.mybluehost.mecpanel.fvb.bof.mybluehost.mecpcalendars.fvb.bof.mybluehost.mecpcontacts.fvb.bof.mybluehost.mefvb.bof.mybluehost.memail.fvb.bof.mybluehost.mewebdisk.fvb.bof.mybluehost.mewebmail.fvb.bof.mybluehost.mewww.fvb.bof.mybluehost.me
autodiscover.kidsdeal.uscpanel.kidsdeal.uscpcalendars.kidsdeal.uscpcontacts.kidsdeal.uskidsdeal.usmail.kidsdeal.uswebdisk.kidsdeal.uswebmail.kidsdeal.uswww.kidsdeal.us
autodiscover.jeancarlosartist.comcpanel.jeancarlosartist.comcpcalendars.jeancarlosartist.comcpcontacts.jeancarlosartist.comjeancarlosartist.commail.jeancarlosartist.comwebdisk.jeancarlosartist.comwebmail.jeancarlosartist.comwww.jeancarlosartist.com
autodiscover.greaterpropertysolutions.comcpanel.greaterpropertysolutions.comcpcalendars.greaterpropertysolutions.comcpcontacts.greaterpropertysolutions.comgreaterpropertysolutions.commail.greaterpropertysolutions.comwebdisk.greaterpropertysolutions.comwebmail.greaterpropertysolutions.comwww.greaterpropertysolutions.com
autodiscover.donaldsairpark7nc.comautodiscover.donaldsflyingservice.comcpanel.donaldsairpark7nc.comcpanel.donaldsflyingservice.comcpcalendars.donaldsairpark7nc.comcpcalendars.donaldsflyingservice.comcpcontacts.donaldsairpark7nc.comcpcontacts.donaldsflyingservice.comdonaldsairpark7nc.comdonaldsairpark7nc.donaldsflyingservice.comdonaldsflyingservice.commail.donaldsairpark7nc.commail.donaldsflyingservice.comwebdisk.donaldsairpark7nc.comwebdisk.donaldsflyingservice.comwebmail.donaldsairpark7nc.comwebmail.donaldsflyingservice.comwww.donaldsairpark7nc.comwww.donaldsairpark7nc.donaldsflyingservice.comwww.donaldsflyingservice.com
autodiscover.makeonlinepaise.comautodiscover.track.projectsmind.comcpanel.makeonlinepaise.comcpanel.track.projectsmind.comcpcalendars.makeonlinepaise.comcpcalendars.track.projectsmind.comcpcontacts.makeonlinepaise.comcpcontacts.track.projectsmind.commail.makeonlinepaise.commail.track.projectsmind.commakeonlinepaise.commakeonlinepaise.projectsmind.comtrack.projectsmind.comwebdisk.makeonlinepaise.comwebdisk.track.projectsmind.comwebmail.makeonlinepaise.comwebmail.track.projectsmind.comwebsite-a4347e21.projectsmind.comwww.makeonlinepaise.comwww.makeonlinepaise.projectsmind.comwww.track.projectsmind.comwww.website-a4347e21.projectsmind.com
autodiscover.mtn.xem.mybluehost.mecpanel.mtn.xem.mybluehost.mecpcalendars.mtn.xem.mybluehost.mecpcontacts.mtn.xem.mybluehost.memail.mtn.xem.mybluehost.memail.nateharrison.commtn.xem.mybluehost.menateharrison.comwebdisk.mtn.xem.mybluehost.mewebmail.mtn.xem.mybluehost.mewww.mtn.xem.mybluehost.mewww.nateharrison.com
autodiscover.norm-macdonald.comcpanel.norm-macdonald.comcpcalendars.norm-macdonald.comcpcontacts.norm-macdonald.commail.norm-macdonald.comnorm-macdonald.comwebdisk.norm-macdonald.comwebmail.norm-macdonald.comwebsite-d736f01b.azh.jzw.mybluehost.mewww.norm-macdonald.comwww.website-d736f01b.azh.jzw.mybluehost.me
autodiscover.tny.vtl.mybluehost.mecpanel.tny.vtl.mybluehost.mecpcalendars.tny.vtl.mybluehost.mecpcontacts.tny.vtl.mybluehost.memail.tny.vtl.mybluehost.metny.vtl.mybluehost.mewebdisk.tny.vtl.mybluehost.mewebmail.tny.vtl.mybluehost.mewww.tny.vtl.mybluehost.me
autodiscover.internationalhealinggroup.comcpanel.internationalhealinggroup.comcpcalendars.internationalhealinggroup.comcpcontacts.internationalhealinggroup.cominternationalhealinggroup.commail.internationalhealinggroup.comwebdisk.internationalhealinggroup.comwebmail.internationalhealinggroup.comwww.internationalhealinggroup.com
autodiscover.themodevents.comcpanel.themodevents.comcpcalendars.themodevents.comcpcontacts.themodevents.commail.themodevents.comthemodevents.comthemodevents.iib.jso.mybluehost.mewebdisk.themodevents.comwebmail.themodevents.comwww.themodevents.comwww.themodevents.iib.jso.mybluehost.me
atlaspressurewashingllc.comautodiscover.atlaspressurewashingllc.comcpanel.atlaspressurewashingllc.comcpcalendars.atlaspressurewashingllc.comcpcontacts.atlaspressurewashingllc.commail.atlaspressurewashingllc.comwebdisk.atlaspressurewashingllc.comwebmail.atlaspressurewashingllc.comwebsite-3ee2ac1b.andersenlandscaping.comwww.atlaspressurewashingllc.comwww.website-3ee2ac1b.andersenlandscaping.com
offer.spacemanmoving.comwww.offer.spacemanmoving.com
autodiscover.znu.sgg.mybluehost.mecpanel.znu.sgg.mybluehost.mecpcalendars.znu.sgg.mybluehost.mecpcontacts.znu.sgg.mybluehost.memail.metstudies.commail.znu.sgg.mybluehost.memetstudies.comwebdisk.znu.sgg.mybluehost.mewebmail.znu.sgg.mybluehost.mewww.metstudies.comwww.znu.sgg.mybluehost.meznu.sgg.mybluehost.me
autodiscover.inspireintegrativehealth.comcpanel.inspireintegrativehealth.comcpcalendars.inspireintegrativehealth.comcpcontacts.inspireintegrativehealth.cominspireintegrativehealth.commail.inspireintegrativehealth.comwebdisk.inspireintegrativehealth.comwebmail.inspireintegrativehealth.comwebsite-fde254bc.harmonywithtruenature.comwww.inspireintegrativehealth.comwww.website-fde254bc.harmonywithtruenature.com
autodiscover.lfn.uel.mybluehost.mecpanel.lfn.uel.mybluehost.mecpcalendars.lfn.uel.mybluehost.mecpcontacts.lfn.uel.mybluehost.mekevinflynnmusic.comlfn.uel.mybluehost.memail.kevinflynnmusic.commail.lfn.uel.mybluehost.mewebdisk.lfn.uel.mybluehost.mewebmail.lfn.uel.mybluehost.mewww.kevinflynnmusic.comwww.lfn.uel.mybluehost.me
a2hdesignstudio-ca.tzr.dhy.mybluehost.mea2hdesignstudio.caautodiscover.a2hdesignstudio.cacpanel.a2hdesignstudio.cacpcalendars.a2hdesignstudio.cacpcontacts.a2hdesignstudio.camail.a2hdesignstudio.cawebdisk.a2hdesignstudio.cawebmail.a2hdesignstudio.cawww.a2hdesignstudio-ca.tzr.dhy.mybluehost.mewww.a2hdesignstudio.ca
autodiscover.harmonywithtruenature.comcpanel.harmonywithtruenature.comcpcalendars.harmonywithtruenature.comcpcontacts.harmonywithtruenature.comharmonywithtruenature.commail.harmonywithtruenature.comwebdisk.harmonywithtruenature.comwebmail.harmonywithtruenature.comwww.harmonywithtruenature.com
autodiscover.irbf.co.ukcpanel.irbf.co.ukcpcalendars.irbf.co.ukcpcontacts.irbf.co.ukirbf.co.ukmail.irbf.co.ukwebdisk.irbf.co.ukwebmail.irbf.co.ukwww.irbf.co.uk
autodiscover.dhc.tvd.mybluehost.mecpanel.dhc.tvd.mybluehost.mecpcalendars.dhc.tvd.mybluehost.mecpcontacts.dhc.tvd.mybluehost.medhc.tvd.mybluehost.memail.dhc.tvd.mybluehost.memail.smileanddialconsulting.comsmileanddialconsulting.comwebdisk.dhc.tvd.mybluehost.mewebmail.dhc.tvd.mybluehost.mewww.dhc.tvd.mybluehost.mewww.smileanddialconsulting.com
autodiscover.stocktobias.comcpanel.stocktobias.comcpcalendars.stocktobias.comcpcontacts.stocktobias.commail.stocktobias.comstocktobias.comwebdisk.stocktobias.comwebmail.stocktobias.comwww.stocktobias.com
autodiscover.ett.nce.mybluehost.mecpanel.ett.nce.mybluehost.mecpcalendars.ett.nce.mybluehost.mecpcontacts.ett.nce.mybluehost.meett.nce.mybluehost.memail.ett.nce.mybluehost.mewebdisk.ett.nce.mybluehost.mewebmail.ett.nce.mybluehost.mewww.ett.nce.mybluehost.me
autodiscover.cine4m.comcine4m-com.sunmulgift.comcine4m.comcpanel.cine4m.comcpcalendars.cine4m.comcpcontacts.cine4m.commail.cine4m.comwebdisk.cine4m.comwebmail.cine4m.comwww.cine4m-com.sunmulgift.comwww.cine4m.com
website-d83edc8d.dhw.goc.mybluehost.mewww.website-d83edc8d.dhw.goc.mybluehost.me
autodiscover.gebuilds.comcpanel.gebuilds.comcpcalendars.gebuilds.comcpcontacts.gebuilds.comgebuilds.commail.gebuilds.commail.shitibuilt.comshitibuilt.comwebdisk.gebuilds.comwebmail.gebuilds.comwww.gebuilds.comwww.shitibuilt.com
autodiscover.vmr.arb.mybluehost.meautodiscover.wildlyfaithfulwomen.comcpanel.vmr.arb.mybluehost.mecpanel.wildlyfaithfulwomen.comcpcalendars.vmr.arb.mybluehost.mecpcalendars.wildlyfaithfulwomen.comcpcontacts.vmr.arb.mybluehost.mecpcontacts.wildlyfaithfulwomen.commail.vmr.arb.mybluehost.memail.wildlyfaithfulwomen.comvmr.arb.mybluehost.mewebdisk.vmr.arb.mybluehost.mewebdisk.wildlyfaithfulwomen.comwebmail.vmr.arb.mybluehost.mewebmail.wildlyfaithfulwomen.comwildlyfaithfulwomen.comwildlyfaithfulwomen.vmr.arb.mybluehost.mewww.vmr.arb.mybluehost.mewww.wildlyfaithfulwomen.comwww.wildlyfaithfulwomen.vmr.arb.mybluehost.me
autodiscover.peo.rew.mybluehost.mecpanel.peo.rew.mybluehost.mecpcalendars.peo.rew.mybluehost.mecpcontacts.peo.rew.mybluehost.megirlglowing.commail.girlglowing.commail.peo.rew.mybluehost.mepeo.rew.mybluehost.mewebdisk.peo.rew.mybluehost.mewebmail.peo.rew.mybluehost.mewww.girlglowing.comwww.peo.rew.mybluehost.me
autodiscover.kloetzerarms.comcpanel.kloetzerarms.comcpcalendars.kloetzerarms.comcpcontacts.kloetzerarms.comkloetzerarms.commail.kloetzerarms.comwebdisk.kloetzerarms.comwebmail.kloetzerarms.comwww.kloetzerarms.com
autodiscover.insobeau.comcpanel.insobeau.comcpcalendars.insobeau.comcpcontacts.insobeau.cominsobeau-com.sunmulgift.cominsobeau.commail.insobeau.comwebdisk.insobeau.comwebmail.insobeau.comwww.insobeau-com.sunmulgift.comwww.insobeau.com
autodiscover.stowe-trails.comcpanel.stowe-trails.comcpcalendars.stowe-trails.comcpcontacts.stowe-trails.commail.stowe-trails.comstowemountainbike.stowe-trails.comwebdisk.stowe-trails.comwebmail.stowe-trails.comwww.stowemountainbike.stowe-trails.com
autodiscover.thefestiveco.comcpanel.thefestiveco.comcpcalendars.thefestiveco.comcpcontacts.thefestiveco.commail.thefestiveco.comthefestiveco.comwebdisk.thefestiveco.comwebmail.thefestiveco.comwww.thefestiveco.com
wiredss.aewww.wiredss.ae
autodiscover.mql.ghe.mybluehost.mecpanel.mql.ghe.mybluehost.mecpcalendars.mql.ghe.mybluehost.mecpcontacts.mql.ghe.mybluehost.mekudenservice200.commail.kudenservice200.commail.mql.ghe.mybluehost.memql.ghe.mybluehost.mewebdisk.mql.ghe.mybluehost.mewebmail.mql.ghe.mybluehost.mewww.kudenservice200.comwww.mql.ghe.mybluehost.me
autodiscover.fgc.qjv.mybluehost.mecpanel.fgc.qjv.mybluehost.mecpcalendars.fgc.qjv.mybluehost.mecpcontacts.fgc.qjv.mybluehost.mefgc.qjv.mybluehost.memail.fgc.qjv.mybluehost.memail.mindful2happy.commindful2happy.comwebdisk.fgc.qjv.mybluehost.mewebmail.fgc.qjv.mybluehost.mewww.fgc.qjv.mybluehost.mewww.mindful2happy.com
autodiscover.gik.dhy.mybluehost.mecpanel.gik.dhy.mybluehost.mecpcalendars.gik.dhy.mybluehost.mecpcontacts.gik.dhy.mybluehost.megik.dhy.mybluehost.memail.gik.dhy.mybluehost.memail.writeesasyeails.comwebdisk.gik.dhy.mybluehost.mewebmail.gik.dhy.mybluehost.mewriteesasyeails.comwww.gik.dhy.mybluehost.mewww.writeesasyeails.com
autodiscover.neverhadaboss.comcpanel.neverhadaboss.comcpcalendars.neverhadaboss.comcpcontacts.neverhadaboss.commail.neverhadaboss.comneverhadaboss.comwebdisk.neverhadaboss.comwebmail.neverhadaboss.comwww.neverhadaboss.com
autodiscover.thelightingofafire.comcpanel.thelightingofafire.comcpcalendars.thelightingofafire.comcpcontacts.thelightingofafire.commail.thelightingofafire.comthelightingofafire.comwebdisk.thelightingofafire.comwebmail.thelightingofafire.comwww.thelightingofafire.com
autodiscover.tredemapping.comcpanel.tredemapping.comcpcalendars.tredemapping.comcpcontacts.tredemapping.commail.tredemapping.comtredemapping.comwebdisk.tredemapping.comwebmail.tredemapping.comwww.tredemapping.com
autodiscover.catskillsdoublewedding.comcatskillsdoublewedding.comcpanel.catskillsdoublewedding.comcpcalendars.catskillsdoublewedding.comcpcontacts.catskillsdoublewedding.commail.catskillsdoublewedding.comwebdisk.catskillsdoublewedding.comwebmail.catskillsdoublewedding.comwww.catskillsdoublewedding.com
autodiscover.lyy.wev.mybluehost.mecpanel.lyy.wev.mybluehost.mecpcalendars.lyy.wev.mybluehost.mecpcontacts.lyy.wev.mybluehost.melyy.wev.mybluehost.memail.lyy.wev.mybluehost.memail.trendzforlesslb.comtrendzforlesslb.comwebdisk.lyy.wev.mybluehost.mewebmail.lyy.wev.mybluehost.mewww.lyy.wev.mybluehost.mewww.trendzforlesslb.com
website-c7d6b3cd.ttr.bqv.mybluehost.mewebsite-ce70fdbf.ttr.bqv.mybluehost.mewww.website-c7d6b3cd.ttr.bqv.mybluehost.mewww.website-ce70fdbf.ttr.bqv.mybluehost.me
autodiscover.jen.jdq.mybluehost.mecpanel.jen.jdq.mybluehost.mecpcalendars.jen.jdq.mybluehost.mecpcontacts.jen.jdq.mybluehost.mejen.jdq.mybluehost.memail.jen.jdq.mybluehost.memail.trevormusgrove.comtrevormusgrove.comwebdisk.jen.jdq.mybluehost.mewebmail.jen.jdq.mybluehost.mewww.jen.jdq.mybluehost.mewww.trevormusgrove.com
autodiscover.okl.nmy.mybluehost.mecpanel.okl.nmy.mybluehost.mecpcalendars.okl.nmy.mybluehost.mecpcontacts.okl.nmy.mybluehost.memail.okl.nmy.mybluehost.meokl.nmy.mybluehost.mewebdisk.okl.nmy.mybluehost.mewebmail.okl.nmy.mybluehost.mewww.okl.nmy.mybluehost.me
alvinwayneweiss.comautodiscover.alvinwayneweiss.comcpanel.alvinwayneweiss.comcpcalendars.alvinwayneweiss.comcpcontacts.alvinwayneweiss.commail.alvinwayneweiss.comwebdisk.alvinwayneweiss.comwebmail.alvinwayneweiss.comwww.alvinwayneweiss.com
autodiscover.wwr.rbb.mybluehost.mecpanel.wwr.rbb.mybluehost.mecpcalendars.wwr.rbb.mybluehost.mecpcontacts.wwr.rbb.mybluehost.megainthedifference.commail.gainthedifference.commail.wwr.rbb.mybluehost.mewebdisk.wwr.rbb.mybluehost.mewebmail.wwr.rbb.mybluehost.mewwr.rbb.mybluehost.mewww.gainthedifference.comwww.wwr.rbb.mybluehost.me
autodiscover.fie.dei.mybluehost.mecpanel.fie.dei.mybluehost.mecpcalendars.fie.dei.mybluehost.mecpcontacts.fie.dei.mybluehost.mefie.dei.mybluehost.memail.fie.dei.mybluehost.memail.texasdfwrealtor.comtexasdfwrealtor.comwebdisk.fie.dei.mybluehost.mewebmail.fie.dei.mybluehost.mewww.fie.dei.mybluehost.mewww.texasdfwrealtor.com
autodiscover.mlu.koc.mybluehost.mecpanel.mlu.koc.mybluehost.mecpcalendars.mlu.koc.mybluehost.mecpcontacts.mlu.koc.mybluehost.mefitsumberhe.commail.fitsumberhe.commail.mlu.koc.mybluehost.memlu.koc.mybluehost.mewebdisk.mlu.koc.mybluehost.mewebmail.mlu.koc.mybluehost.mewww.fitsumberhe.comwww.mlu.koc.mybluehost.me
autodiscover.innovations.zonecpanel.innovations.zonecpcalendars.innovations.zonecpcontacts.innovations.zoneinnovations.zonemail.innovations.zonemail.rsc.keb.mybluehost.mersc.keb.mybluehost.mewebdisk.innovations.zonewebmail.innovations.zonewww.innovations.zonewww.rsc.keb.mybluehost.me
autodiscover.vbk.wxk.mybluehost.mecpanel.vbk.wxk.mybluehost.mecpcalendars.vbk.wxk.mybluehost.mecpcontacts.vbk.wxk.mybluehost.memail.vbk.wxk.mybluehost.mevbk.wxk.mybluehost.mewebdisk.vbk.wxk.mybluehost.mewebmail.vbk.wxk.mybluehost.mewww.vbk.wxk.mybluehost.me
autodiscover.ebq.rdx.mybluehost.mecpanel.ebq.rdx.mybluehost.mecpcalendars.ebq.rdx.mybluehost.mecpcontacts.ebq.rdx.mybluehost.meebq.rdx.mybluehost.memail.ebq.rdx.mybluehost.memail.yeseveryoneeats.comwebdisk.ebq.rdx.mybluehost.mewebmail.ebq.rdx.mybluehost.mewww.ebq.rdx.mybluehost.mewww.yeseveryoneeats.comyeseveryoneeats.com
efsmi.comwww.efsmi.com
autodiscover.kristianireland.comcpanel.kristianireland.comcpcalendars.kristianireland.comcpcontacts.kristianireland.comkristianireland.commail.kristianireland.comwebdisk.kristianireland.comwebmail.kristianireland.comwww.kristianireland.com
autodiscover.happysoulwhotravels.comautodiscover.wewalkwithyou.comcpanel.happysoulwhotravels.comcpanel.wewalkwithyou.comcpcalendars.happysoulwhotravels.comcpcalendars.wewalkwithyou.comcpcontacts.happysoulwhotravels.comcpcontacts.wewalkwithyou.comhappysoulwhotravels.comhappysoulwhotravels.wewalkwithyou.commail.happysoulwhotravels.comwebdisk.happysoulwhotravels.comwebdisk.wewalkwithyou.comwebmail.happysoulwhotravels.comwebmail.wewalkwithyou.comwewalkwithyou.comwww.happysoulwhotravels.wewalkwithyou.comwww.wewalkwithyou.com
autodiscover.rat.lnr.mybluehost.mecpanel.rat.lnr.mybluehost.mecpcalendars.rat.lnr.mybluehost.mecpcontacts.rat.lnr.mybluehost.memail.moonreliks.commail.rat.lnr.mybluehost.memoonreliks.comrat.lnr.mybluehost.mewebdisk.rat.lnr.mybluehost.mewebmail.rat.lnr.mybluehost.mewww.moonreliks.comwww.rat.lnr.mybluehost.me
alisonarcher.com.auautodiscover.alisonarcher.com.aucpanel.alisonarcher.com.aucpcalendars.alisonarcher.com.aucpcontacts.alisonarcher.com.aumail.alisonarcher.com.auwebdisk.alisonarcher.com.auwebmail.alisonarcher.com.auwebsite-287d5d33.naa.ixy.mybluehost.mewww.alisonarcher.com.auwww.website-287d5d33.naa.ixy.mybluehost.me
autodiscover.sovereigncapitalnyc.comcpanel.sovereigncapitalnyc.comcpcalendars.sovereigncapitalnyc.comcpcontacts.sovereigncapitalnyc.commail.sovereigncapitalnyc.comsovereigncapitalnyc.comwebdisk.sovereigncapitalnyc.comwebmail.sovereigncapitalnyc.comwww.sovereigncapitalnyc.com
autodiscover.somewhatfair.comcpanel.somewhatfair.comcpcalendars.somewhatfair.comcpcontacts.somewhatfair.commail.somewhatfair.comsomewhatfair.comwebdisk.somewhatfair.comwebmail.somewhatfair.comwww.somewhatfair.com
autodiscover.eyesightfoundation.orgcpanel.eyesightfoundation.orgcpcalendars.eyesightfoundation.orgcpcontacts.eyesightfoundation.orgeyesightfoundation-org.sponteconsulting.comeyesightfoundation.orgmail.eyesightfoundation.orgwebdisk.eyesightfoundation.orgwebmail.eyesightfoundation.orgwww.eyesightfoundation-org.sponteconsulting.comwww.eyesightfoundation.org
autodiscover.jtt.okl.mybluehost.mecpanel.jtt.okl.mybluehost.mecpcalendars.jtt.okl.mybluehost.mecpcontacts.jtt.okl.mybluehost.mejtt.okl.mybluehost.memail.jtt.okl.mybluehost.memail.motherhoodlaborandlove.commotherhoodlaborandlove.comwebdisk.jtt.okl.mybluehost.mewebmail.jtt.okl.mybluehost.mewww.jtt.okl.mybluehost.mewww.motherhoodlaborandlove.com
autodiscover.lexonenterprises.comcpanel.lexonenterprises.comcpcalendars.lexonenterprises.comcpcontacts.lexonenterprises.comlexonenterprises.comlexonenterprises.lxx.lny.mybluehost.memail.lexonenterprises.comwebdisk.lexonenterprises.comwebmail.lexonenterprises.comwww.lexonenterprises.comwww.lexonenterprises.lxx.lny.mybluehost.me
catstealers.comcpanel.catstealers.comcpcalendars.catstealers.comcpcontacts.catstealers.commail.catstealers.comwebdisk.catstealers.comwebmail.catstealers.comwww.catstealers.com
autodiscover.ibfafoundation.comcpanel.ibfafoundation.comcpcalendars.ibfafoundation.comcpcontacts.ibfafoundation.comibfafoundation.commail.ibfafoundation.comwebdisk.ibfafoundation.comwebmail.ibfafoundation.comwww.ibfafoundation.com
aquarellegranite.comcpanel.aquarellegranite.comcpcalendars.aquarellegranite.comcpcontacts.aquarellegranite.commail.aquarellegranite.comwebdisk.aquarellegranite.comwebmail.aquarellegranite.comwww.aquarellegranite.com
autodiscover.wikiactivism.comcpanel.wikiactivism.comcpcalendars.wikiactivism.comcpcontacts.wikiactivism.commail.riseupabove.commail.wikiactivism.comriseupabove.comwebdisk.wikiactivism.comwebmail.wikiactivism.comwikiactivism.comwww.riseupabove.comwww.wikiactivism.com
autodiscover.tribewoman.comcpanel.tribewoman.comcpcalendars.tribewoman.comcpcontacts.tribewoman.commail.tribewoman.comtribewoman.comwebdisk.tribewoman.comwebmail.tribewoman.comwww.tribewoman.com
autodiscover.wgb.oha.mybluehost.mecpanel.wgb.oha.mybluehost.mecpcalendars.wgb.oha.mybluehost.mecpcontacts.wgb.oha.mybluehost.memail.wgb.oha.mybluehost.mewebdisk.wgb.oha.mybluehost.mewebmail.wgb.oha.mybluehost.mewgb.oha.mybluehost.mewww.wgb.oha.mybluehost.me
autodiscover.marksolomon.netcpanel.marksolomon.netcpcalendars.marksolomon.netcpcontacts.marksolomon.netmail.yiy.rfl.mybluehost.memarksolomon.netwebdisk.marksolomon.netwebmail.marksolomon.netwww.marksolomon.netwww.yiy.rfl.mybluehost.meyiy.rfl.mybluehost.me
autodiscover.orchardhillschristianacademy.comcpanel.orchardhillschristianacademy.comcpcalendars.orchardhillschristianacademy.comcpcontacts.orchardhillschristianacademy.commail.orchardhillschristianacademy.comorchardhillschristianacademy.comwebdisk.orchardhillschristianacademy.comwebmail.orchardhillschristianacademy.comwww.orchardhillschristianacademy.com
autodiscover.opandc.comcpanel.opandc.comcpcalendars.opandc.comcpcontacts.opandc.commail.opandc.comopandc.comwebdisk.opandc.comwebmail.opandc.comwww.opandc.com
autodiscover.mhv.rbb.mybluehost.mecpanel.mhv.rbb.mybluehost.mecpcalendars.mhv.rbb.mybluehost.mecpcontacts.mhv.rbb.mybluehost.memail.mhv.rbb.mybluehost.memail.studiobelardo.techmhv.rbb.mybluehost.mestudiobelardo.techwebdisk.mhv.rbb.mybluehost.mewebmail.mhv.rbb.mybluehost.mewww.mhv.rbb.mybluehost.mewww.studiobelardo.tech
autodiscover.rofaendurance.comcpanel.rofaendurance.comcpcalendars.rofaendurance.comcpcontacts.rofaendurance.commail.rofaendurance.comrofaendurance.comrofaendurance.td2travelsandadventures.comwebdisk.rofaendurance.comwebmail.rofaendurance.comwww.rofaendurance.comwww.rofaendurance.td2travelsandadventures.com
autodiscover.rhextranslations.comcpanel.rhextranslations.comcpcalendars.rhextranslations.comcpcontacts.rhextranslations.commail.rhextranslations.comrhextranslations.comwebdisk.rhextranslations.comwebmail.rhextranslations.comwww.rhextranslations.com
alicethomsen.comautodiscover.alicethomsen.comcpanel.alicethomsen.comcpcalendars.alicethomsen.comcpcontacts.alicethomsen.commail.alicethomsen.comwebdisk.alicethomsen.comwebmail.alicethomsen.comwww.alicethomsen.com
autodiscover.new.adw.mybluehost.meblueforceoptics.comcpanel.new.adw.mybluehost.mecpcalendars.new.adw.mybluehost.mecpcontacts.new.adw.mybluehost.memail.blueforceoptics.commail.new.adw.mybluehost.menew.adw.mybluehost.mewebdisk.new.adw.mybluehost.mewebmail.new.adw.mybluehost.mewww.blueforceoptics.comwww.new.adw.mybluehost.me
autodiscover.kismetmind.comcpanel.kismetmind.comcpcalendars.kismetmind.comcpcontacts.kismetmind.comkismetmind.comkismetmind.keyawagroup.commail.kismetmind.comwebdisk.kismetmind.comwebmail.kismetmind.comwww.kismetmind.comwww.kismetmind.keyawagroup.com
website-0509403a.ccl-us.orgwww.website-0509403a.ccl-us.org
clarivatepublications.zbo.pfi.mybluehost.meclarivatepublicationsus.zbo.pfi.mybluehost.medissertationsden-co-uk.zbo.pfi.mybluehost.mewww.clarivatepublications.zbo.pfi.mybluehost.mewww.clarivatepublicationsus.zbo.pfi.mybluehost.mewww.dissertationsden-co-uk.zbo.pfi.mybluehost.me
cpanel.mobiushome.commail.mobiushome.commobiushome.comwebmail.mobiushome.comwww.mobiushome.com
autodiscover.strengthmekaniks.comcpanel.mindyourown.lifecpanel.strengthmekaniks.comcpcalendars.mindyourown.lifecpcalendars.strengthmekaniks.comcpcontacts.mindyourown.lifecpcontacts.strengthmekaniks.commail.npv.lil.mybluehost.memail.strengthmekaniks.commindyourown.lifenpv.lil.mybluehost.mestrengthmekaniks.comwebdisk.mindyourown.lifewebdisk.strengthmekaniks.comwebmail.mindyourown.lifewebmail.strengthmekaniks.comwebsite-08c54e5e.mindyourown.lifewww.mindyourown.lifewww.npv.lil.mybluehost.mewww.strengthmekaniks.comwww.website-08c54e5e.mindyourown.life
adventureandeat.comautodiscover.adventureandeat.comcpanel.adventureandeat.comcpcalendars.adventureandeat.comcpcontacts.adventureandeat.commail.adventureandeat.comwebdisk.adventureandeat.comwebmail.adventureandeat.comwww.adventureandeat.com
autodiscover.omm.sfg.mybluehost.mecpanel.omm.sfg.mybluehost.mecpcalendars.omm.sfg.mybluehost.mecpcontacts.omm.sfg.mybluehost.meeurohairprosalon.commail.eurohairprosalon.commail.omm.sfg.mybluehost.meomm.sfg.mybluehost.mewebdisk.omm.sfg.mybluehost.mewebmail.omm.sfg.mybluehost.mewww.eurohairprosalon.comwww.omm.sfg.mybluehost.me
blueboxsoftware.netcpanel.blueboxsoftware.netcpcalendars.blueboxsoftware.netcpcontacts.blueboxsoftware.netmail.blueboxsoftware.netwebdisk.blueboxsoftware.netwebmail.blueboxsoftware.netwww.blueboxsoftware.net
bartbattista.comcliffsideengineering.comcpanel.cliffsideengineering.comcpcalendars.cliffsideengineering.comcpcontacts.cliffsideengineering.commail.bartbattista.commail.cliffsideengineering.comwebdisk.cliffsideengineering.comwebmail.cliffsideengineering.comwww.bartbattista.comwww.cliffsideengineering.com
jff.lnl.mybluehost.memail.jff.lnl.mybluehost.mewww.inmyteam.comwww.jff.lnl.mybluehost.me
aiw.chh.mybluehost.meautodiscover.bf4wardfitness.comautodiscover.bfftestprep.combf4wardfitness.combfftestprep.comcpanel.bf4wardfitness.comcpanel.bfftestprep.comcpcalendars.bf4wardfitness.comcpcalendars.bfftestprep.comcpcontacts.bf4wardfitness.comcpcontacts.bfftestprep.commail.aiw.chh.mybluehost.memail.bf4wardfitness.commail.bfftestprep.comwebdisk.bf4wardfitness.comwebdisk.bfftestprep.comwebmail.bf4wardfitness.comwebmail.bfftestprep.comwebsite-1edacc48.bfftestprep.comwww.aiw.chh.mybluehost.mewww.bf4wardfitness.comwww.bfftestprep.comwww.website-1edacc48.bfftestprep.com
autodiscover.reliablessinc.comcpanel.reliablessinc.comcpcalendars.reliablessinc.comcpcontacts.reliablessinc.commail.reliablessinc.comreliablessinc.comwebdisk.reliablessinc.comwebmail.reliablessinc.comwww.reliablessinc.com
akn907.comautodiscover.akn907.comcpanel.akn907.comcpcalendars.akn907.comcpcontacts.akn907.commail.akn907.comwebdisk.akn907.comwebmail.akn907.comwebsite-7a584425.partnersdigitalmarketing.comwww.akn907.comwww.website-7a584425.partnersdigitalmarketing.com
autodiscover.lesliesbookcase.comcpanel.lesliesbookcase.comcpcalendars.lesliesbookcase.comcpcontacts.lesliesbookcase.comlesliesbookcase.commail.lesliesbookcase.comwebdisk.lesliesbookcase.comwebmail.lesliesbookcase.comwww.lesliesbookcase.com
cpanel.kma-spotlight.comcpcalendars.kma-spotlight.comcpcontacts.kma-spotlight.comkma-spotlight.commail.kma-spotlight.comwebdisk.kma-spotlight.comwebmail.kma-spotlight.comwww.kma-spotlight.com
autodiscover.kianaturally.comcpanel.kianaturally.comcpcalendars.kianaturally.comcpcontacts.kianaturally.comkianaturally.comwebdisk.kianaturally.comwebmail.kianaturally.comwww.kianaturally.com
autodiscover.loapioneers.comcpanel.loapioneers.comcpcalendars.loapioneers.comcpcontacts.loapioneers.comloapioneers.comloapioneers.romkay.commail.loapioneers.comwebdisk.loapioneers.comwebmail.loapioneers.comwww.loapioneers.comwww.loapioneers.romkay.com
autodiscover.ujimacultureproject.comcpanel.ujimacultureproject.comcpcalendars.ujimacultureproject.comcpcontacts.ujimacultureproject.commail.ujimacultureproject.comujimacultureproject.comwebdisk.ujimacultureproject.comwebmail.ujimacultureproject.comwww.ujimacultureproject.com
cpanel.doxentrics.comcpcalendars.doxentrics.comcpcontacts.doxentrics.comdoxentrics.commail.doxentrics.comwebdisk.doxentrics.comwebmail.doxentrics.comwww.doxentrics.com
autodiscover.thecaptainjerry.comcpanel.thecaptainjerry.comcpcalendars.thecaptainjerry.comcpcontacts.thecaptainjerry.comthecaptainjerry.comwebdisk.thecaptainjerry.comwebmail.thecaptainjerry.comwww.thecaptainjerry.com
autodiscover.theohlab.comcpanel.theohlab.comcpcalendars.theohlab.comcpcontacts.theohlab.commail.theohlab.comtheohlab.comwebdisk.theohlab.comwebmail.theohlab.comwww.theohlab.com
boudman.boudman.comwww.boudman.boudman.com
autodiscover.intuitivehealthma.comcpanel.intuitivehealthma.comcpcalendars.intuitivehealthma.comcpcontacts.intuitivehealthma.comintuitivehealthma.commail.intuitivehealthma.comwebdisk.intuitivehealthma.comwebmail.intuitivehealthma.comwww.intuitivehealthma.com
autodiscover.efectoresponsable.pecpanel.efectoresponsable.pecpcalendars.efectoresponsable.pecpcontacts.efectoresponsable.peefectoresponsable.pemail.efectoresponsable.pewebdisk.efectoresponsable.pewebmail.efectoresponsable.pewww.efectoresponsable.pe
offer.partnersdigitalmarketing.comwww.offer.partnersdigitalmarketing.com
autodiscover.uuq.xxm.mybluehost.mecpanel.uuq.xxm.mybluehost.mecpcalendars.uuq.xxm.mybluehost.mecpcontacts.uuq.xxm.mybluehost.memail.uuq.xxm.mybluehost.meuuq.xxm.mybluehost.mewebdisk.uuq.xxm.mybluehost.mewebmail.uuq.xxm.mybluehost.mewww.uuq.xxm.mybluehost.me
Domain summary
www.ehfs.health 16 mail.ehfs.health 17 ehfs.health 16 www.edu.alarshif.com 10 edu.alarshif.com 9 mail.stowetrails.org 8 stowetrails-org.stowe-trails.com 7 stowetrails.org 7 www.stowetrails.org 7 www.stowemountainbike.stowe-trails.com 6 stowemountainbike.stowe-trails.com 6 www.stowetrails-org.stowe-trails.com 6 www.stowetrails.stowe-trails.com 6 stowetrails.com 6 www.stowetrails.com 5 stowetrails.stowe-trails.com 5 mail.stowetrails.com 5 mail.wat2d.com 4 wat2d.com 4 www.wat2d.com 4 www.allnaturalrepellent.com 3 mail.fresaj.com 4 wat2d.alarshif.com 3 fresaj.com 3 allnaturalrepellent.com 3 admin.41bc.net 3 www.admin.41bc.net 3 mail.journalpublisher.co.uk 3 www.journalpublisher.co.uk 3 mail.francesdubreuil.com 3 www.fresaj.com 3 www.journalpublisher-co-uk.zbo.pfi.mybluehost.me 3 www.wat2d.alarshif.com 3 www.charbonneaugreenshoa.org 2 shopuvskinz.com 2 www.francesdubreuil.com 2 www.todayisthedaylifestyle.com 2 anisumakenya.co.ke 2 andyrobinetmusic.androidrobotproductions.com 2 danwiley.com 2 www.danwiley.com 2 mail.todayisthedaylifestyle.com 2 todayisthedaylifestyle.com 2 www.jetsetloves.com 2 www.revpatriciahart.net 2 revpatriciahart.net 2 mail.revpatriciahart.net 2 mail.leonardmcelveen.com 2 www.leonardmcelveen.com 2 leonardmcelveen.com 2 jetsetloves.com 2 mail.allnaturalrepellent.com 2 mail.jetsetloves.com 2 www.agua.cordilleracentral.cl 2 agua.cordilleracentral.cl 2 www.tuukkablab.com 2 www.andyrobinetguitar.androidrobotproductions.com 3 mail.anisumakenya.co.ke 2 mail.churchannouncementsolutions.com 2 andyrobinetguitar.androidrobotproductions.com 2 www.clarivatepublications.co.uk 2 www.api-epaper.parichoy.com 2 api-epaper.parichoy.com 2 mail.andyrobinetmusic.com 2 androidrobotproductions.com 2 mail.danwiley.com 2 www.marksolomon.net 2 mail.charbonneaugreenshoa.org 2 nontribaleconomics.com 2 mail.orchardhillschristianacademy.com 2 mail.ukhec.co.uk 2 sundayafternoonblog.com 2 www.androidrobotproductions.com 2 www.ukhec.co.uk 2 www.shopuvskinz.com 2 mail.tuukkablab.com 2 portugalexperience.com 2 mail.nontribaleconomics.com 2 mail.andyrobinetguitar.com 2 ukhec.co.uk 2 www.charbonneaugreenhoa.org 2 www.sundayafternoonblog.com 2 mail.sundayafternoonblog.com 2 mail.androidrobotproductions.com 2 andyrobinetmusic.com 2 charbonneaugreenhoa.org 2 www.ukhec-co-uk.zbo.pfi.mybluehost.me 2 francesdubreuil.com 2 www.churchannouncementsolutions.com 2 marksolomon.net 2 mail.shopuvskinz.com 2 www.andyrobinetmusic.androidrobotproductions.com 2 www.andyrobinetmusic.com 2 andyrobinetguitar.com 2 mail.portugalexperience.com 2 www.anisumakenya.co.ke 2 mail.achronicentrepreneur.com 2 www.orchardhillschristianacademy.com 2 www.andyrobinetguitar.com 2 www.nontribaleconomics.com 2 tuukkablab.com 2 mail.charbonneaugreenhoa.org 2 www.clarivatepublications-co-uk.zbo.pfi.mybluehost.me 2 www.clarivate.zbo.pfi.mybluehost.me 2 www.portugalexperience.com 2 orchardhillschristianacademy.com 2 churchannouncementsolutions.com 2 ukhec-co-uk.zbo.pfi.mybluehost.me 2 vbp.pmc.mybluehost.me 1 mail.tyd.skj.mybluehost.me 1 www.vbp.pmc.mybluehost.me 1 mail.eliece.com 1 charbonneaugreenshoa.org 1 wpr.bwk.mybluehost.me 1 www.dissertationshark-co-uk.zbo.pfi.mybluehost.me 1 www.clarivatepublicationsus.zbo.pfi.mybluehost.me 1 eliece.com 1 tyd.skj.mybluehost.me 1 mail.ibfafoundation.com 1 clarivate.zbo.pfi.mybluehost.me 1 www.premics.com 1 www.tyd.skj.mybluehost.me 1 www.clarivatepublicationsusus.zbo.pfi.mybluehost.me 1 qru.jgb.mybluehost.me 1 www.scimagopublications-co-uk.zbo.pfi.mybluehost.me 1 mail.wpr.bwk.mybluehost.me 1 mail.yiy.rfl.mybluehost.me 1 mail.qru.jgb.mybluehost.me 1 www.clarivatepublicationsuss.zbo.pfi.mybluehost.me 1 www.springerspublications-co-uk.zbo.pfi.mybluehost.me 1 www.danqart.com 1 www.wpr.bwk.mybluehost.me 1 www.dissertationshark.co.uk 1 yiy.rfl.mybluehost.me 1 www.scimagopublications.co.uk 1 www.ibfafoundation.com 1 www.clarivatepublications.com 1 www.clarivatepublications.zbo.pfi.mybluehost.me 1 www.badgesoffraud.com 1 mail.premics.com 1 www.yiy.rfl.mybluehost.me 1 ibfafoundation.com 1 www.ecom.journalpublisher.co.uk 1 www.teals.journalpublisher.co.uk 1 childrensfrenchbookcorner.com 1 premics.com 1 www.springerspublications.co.uk 1 www.eliece.com 2 danqart.com 1 www.qru.jgb.mybluehost.me 2 www.springerpublications.zbo.pfi.mybluehost.me 1 mail.badgesoffraud.com 1 www.springerpublications.com 1 badgesoffraud.com 1 www.childrensfrenchbookcorner.com 2 journalpublisher.co.uk 1 mail.vbp.pmc.mybluehost.me 1 journalpublisher-co-uk.zbo.pfi.mybluehost.me 1 cqg.pgm.mybluehost.me 0 wildlyfaithfulwomen.vmr.arb.mybluehost.me 0 mail.magneticminstrel.net 0 www.umh.sgg.mybluehost.me 0 www.bsv.kdq.mybluehost.me 0 hollytoscanini.com 0 www.website-7d613f40.geckographix.ca 0 supermartt.xlr.kdb.mybluehost.me 0 www.vsj.tdd.mybluehost.me 0 mail.newhopecounselingonline.com 0 christinesstylingbags.com 0 www.dietarycafe.sunmulgift.com 0 www.way.tdd.mybluehost.me 0 easybillingrcm.xlr.kdb.mybluehost.me 0 zdk.sco.mybluehost.me 0 wekickitup.com 0 mail.vhk.hal.mybluehost.me 0 www.ru.sunpringextruder.com 0 www.website-486dc152.thinkdigitalmatter.com 0 wamlblog.net 0 www.website-97cb9c6b.yrj.ela.mybluehost.me 0 www.wealthygen.com 0 iamdrcole.com 0 eqv.ojq.mybluehost.me 0 mse.ihh.mybluehost.me 0 gapscience.forensicpocketguide.com 0 mail.mxv.rew.mybluehost.me 0 oan.logical-insanity.com 0 www.magneticminstrel.net 0 www.drrussyaconnor.com.au 0 mail.willow.ae 0 vipseniorbenefits.com 0 www.ecg.abf.mybluehost.me 0 internationalkenpokobudohakutsuruassociation.com 0 licenselogicsolutions.com 0 latincouncilavl-org.iib.jso.mybluehost.me 0 mail.issavalli.com 0 aevotechna.com 0 www.yrj.ela.mybluehost.me 0 mail.simbaonlinestore.com 0 www.pediatricsupportandintervention.com 0 www.texassigningservices.com 0 timswritingpeace.org 0 www.thesatiricalhousewife.com 0 mail.abatementsolutionslacrosse.com 0 mail.wcag.grettabevis.com 0 hstex.com.tw 0 www.sallysfault.com 0 fords-ip.com 0 mail.bentplyword.com 0 mail.yrj.ela.mybluehost.me 0 mail.kqv.zzt.mybluehost.me 0 bentplyword.com 0 mail.josefinarecruitment.com 0 mail.coopstrat.com 0 www.urbanheropoodles.veterinarybootcampce.com 0 kbcreative-org.churchannouncementsolutions.com 0 www.qmd.bzx.mybluehost.me 0 mail.castellonfloreslaw.com 0 whooi.com 0 www.ennvisionn.createwebsiteseasily.com 0 artaffairs.gallery 0 kqv.zzt.mybluehost.me 0 mail.justallgxxd.com 0 www.zul.uqp.mybluehost.me 0 website-4305e3a8.forensicpocketguide.com 0 renewyou.alvinwayneweiss.com 0 penprojects.com 0 classwings.net 0 yrj.ela.mybluehost.me 0 www.wealthywallets.org 0 mail.dunestrailers.com 0 yke.cup.mybluehost.me 0 mail.katiagupta.com 0 kreativeways.com.au 0 mail.vjo.hgs.mybluehost.me 0 newhurleychurch.org 0 mail.fjh.dwa.mybluehost.me 0 www.androidrobotstudios.com 0 mail.sof.frl.mybluehost.me 0 mail.alwehdaclub.sa 0 mail.formydiet.com 0 mail.patrickcheatham.com 0 xfv.peu.mybluehost.me 0 www.paintedwolfhealingarts.paintedwolfmedia.com 0 www.qqu.lnr.mybluehost.me 0 trading.kismetmind.com 0 mail.yke.cup.mybluehost.me 0 mail.perspectivesireland.com 0 www.canada-shogi.com 0 www.xdg.fsx.mybluehost.me 0 www.xwk.lnl.mybluehost.me 0 www.hra.uzz.mybluehost.me 0 website-add0827e.xlr.kdb.mybluehost.me 0 mail.thelatenotes.com 0 www.wiq.jru.mybluehost.me 0 blucapinvest.com 0 nln.pvh.mybluehost.me 0 mail.galenetherapy.com 0 www.freedomafter50club.com 0 www.strategicmathsolutions.com 0 www.robertdryer.com 0 smalimousine.com 0 mail.ond.emu.mybluehost.me 0 www.kfarringtondesigns.com 0 mail.drwendylevy.com 0 www.balancedvirtually.iib.jso.mybluehost.me 0 mail.zzj.etw.mybluehost.me 0 www.sunpringextruder.com 0 www.svc.uzz.mybluehost.me 0 forensicpocketguide.com 0 mail.kkcf-gmi.org 0 mygeotokens.com 0 www.androidrobotmusic.com 0 www.brandonolin.com 0 henryjoseph.spokespersonagency.com 0 alwehdaclub.sa 0 mail.bayesinvest.com 0 mail.littlemermaidglassbottomboat.com 0 mail.socialjones.com 0 patrickcheatham.com 0 www.website-4d30039e.xlr.kdb.mybluehost.me 0 hmbll.com 0 www.wmi.cra.mybluehost.me 0 www.arizonareliablemoving.vrv.vjk.mybluehost.me 0 www.whooi.com 0 mail.gagereviews.com 0 www.sweetbakingadventures.com 0 mail.abe.oqk.mybluehost.me 0 mail.leadcometdigital.com 0 www.zdj.lnl.mybluehost.me 0 www.your-fitness-guru.booktipper.com 0 mail.nurturedsoulrd.com 0 mindyourownbirth-ca.mindyourown.life 0 suncoastbaptistchurch.info 0 mail.walkabouthills.com 0 mail.zain-alemaar.com 0 mail.lanikaiyatomi.com 0 www.website-6079b47d.wqb.fgc.mybluehost.me 0 www.gnsenterprises.com.pk 0 animefreesite.com 0 www.website-9fc6149c.ygo.bsd.mybluehost.me 0 mail.odd-1.com 0 effectualwaves.com 0 www.mossbayhall.com 0 ghealthfood-com.sunmulgift.com 0 ncn.ihj.mybluehost.me 0 mail.forensicpocketguide.com 0 www.espsigns.com 0 medicareplansrx.blueandgrayfinancial.com 0 www.vhk.hal.mybluehost.me 0 www.copyrightok.kr 0 qdc.vhl.mybluehost.me 0 www.weightlossmasterzone.sunmulgift.com 0 mail.kjj.bxm.mybluehost.me 0 www.preachfromthehousetops.com 0 www.hkr.vcj.mybluehost.me 0 www.yke.cup.mybluehost.me 0 kelpark.org 0 thegaldamezlandscaping.com 0 mail.canada-shogi.com 0 www.latincouncilavl.org 0 mail.sammysexports.com 0 kelp-ark.org 0 kkcf-gmi.org 0 abundantlovechildrenshome.com 0 charlotteandscottadopt.com 0 mail.ttr.bqv.mybluehost.me 0 mail.rxn.kdf.mybluehost.me 0 michaeljcordell.com 0 mail.tcbuilderli.com 0 mail.charlotteandscottadopt.com 0 mail.forlogancounty.com 0 dynamicsmachines.com 0 hammocktravelers.com 0 www.paintedwolfhealingarts.com 0 website-d0df5eca.marksolomon.net 0 mail.tks.duj.mybluehost.me 0 mail.prx.doq.mybluehost.me 0 www.vjo.hgs.mybluehost.me 0 mail.swt.nuh.mybluehost.me 0 mail.fjh.srl.mybluehost.me 0 mail.888lockuup.com 0 www.aps.fts.mybluehost.me 0 erinnkdaniel.vmr.arb.mybluehost.me 0 www.foundartfactory.net 0 www.curlyhairproducts.com 0 thecoopers.design 0 mail.ane.pzr.mybluehost.me 0 www.bzn.nst.mybluehost.me 0 www.kidzcomics.com 0 www.abatementsolutionslacrosse.com 0 website-6ed183b1.geckographix.ca 0 mail.try.ebq.mybluehost.me 0 mail.shrmehdi.com 0 www.gsb.ekr.mybluehost.me 0 website-1a89461e.ane.pzr.mybluehost.me 0 www.yxo.gqj.mybluehost.me 0 alisongifford.yourstudydoctor.com 0 mail.krlinvestors.com 0 hillts.com 0 website-c04e6967.anc.xfn.mybluehost.me 0 mail.ftj.rdx.mybluehost.me 0 mail.vjv.mjh.mybluehost.me 0 coronaregime.com 0 villanayalmar.com 0 mail.oftenplusneverminus.com 0 www.sallysfault.logical-insanity.com 0 www.qrn.ajs.mybluehost.me 0 quicksignaturenotary.com 0 mail.ottawallpaper.com 0 restorativerainbowalliance.org 0 www.aironbroadway.com 0 mail.themarketingaigency.com 0 mail.neighboravenue.com 0 crz.nmb.mybluehost.me 0 mail.fcitoday.com 0 yesforgreeneview.com 0 www.qdc.vhl.mybluehost.me 0 www.cin4m-com.sunmulgift.com 0 centralvalleyliftpros.com 0 mail.ryw.etw.mybluehost.me 0 pzq.kei.mybluehost.me 0 avisofitness.com 0 mail.thinkdigitalmatter.com 0 mail.qfp.ths.mybluehost.me 0 website-e95c4881.ane.pzr.mybluehost.me 0 227media.net 0 www.recipesandplaces.com 0 alcyonespace.com 0 sui.noo.mybluehost.me 0 mail.lenale.space 0 www.themompoweredhome.com 0 bestboutiquebooks.com 0 perspectivesireland.perspectivesireland.ie 0 mail.plugovoyhistory.com 0 www.yorktownday.com 0 lbo.lnl.mybluehost.me 0 www.vip.sfg.mybluehost.me 0 www.website-15891645.lyy.wev.mybluehost.me 0 mail.rbgbank.com 0 www.fvb.bof.mybluehost.me 0 mail.kidsdeal.us 0 www.jeancarlosartist.com 0 texassigningservices.com 0 greaterpropertysolutions.com 0 www.rxn.kdf.mybluehost.me 0 www.julietafumberg.iib.jso.mybluehost.me 0 www.donaldsflyingservice.com 0 website-a4347e21.projectsmind.com 0 mail.mtn.xem.mybluehost.me 0 www.website-d736f01b.azh.jzw.mybluehost.me 0 tny.vtl.mybluehost.me 0 www.internationalhealinggroup.com 0 mail.themodevents.com 0 mail.atlaspressurewashingllc.com 0 www.atlaspressurewashingllc.com 0 www.offer.spacemanmoving.com 0 www.greenlightservices.us 0 www.xut.pyw.mybluehost.me 0 www.website-00475774.ane.pzr.mybluehost.me 0 mail.metstudies.com 0 latincouncilavl.org 0 website-fde254bc.harmonywithtruenature.com 0 www.latincouncilavl-org.iib.jso.mybluehost.me 0 kevinflynnmusic.com 0 mail.a2hdesignstudio.ca 0 www.harmonywithtruenature.com 0 www.irbf.co.uk 0 dhc.tvd.mybluehost.me 0 badgirlgoodfighter.com 0 mail.jeancarlosartist.com 0 mail.stocktobias.com 0 kishafreed.com 0 website-3ee2ac1b.andersenlandscaping.com 0 mail.wmi.cra.mybluehost.me 0 www.ett.nce.mybluehost.me 0 www.cine4m.com 0 www.greaterpropertysolutions.com 0 www.website-d83edc8d.dhw.goc.mybluehost.me 0 www.shitibuilt.com 0 dgk.rts.mybluehost.me 0 www.wildlyfaithfulwomen.com 0 urbanheropoodles.com 0 vmr.arb.mybluehost.me 0 www.girlglowing.com 0 mail.kloetzerarms.com 0 www.kloetzerarms.com 0 www.insobeau-com.sunmulgift.com 0 mail.wamlblog.net 0 thefestiveco.com 0 mail.partnersdigitalmarketing.com 0 www.thefestiveco.com 0 www.lusty-store.keyawagroup.com 0 wiredss.ae 0 mail.yxp.plo.mybluehost.me 0 mail.mql.ghe.mybluehost.me 0 olivetreetales.com 0 www.mindful2happy.com 0 forlogancounty.churchannouncementsolutions.com 0 www.gik.dhy.mybluehost.me 0 www.neverhadaboss.com 0 www.thelightingofafire.com 0 pixelscott.com 0 mail.donaldsflyingservice.com 0 dynamic-rr.com 0 www.tredemapping.com 0 catskillsdoublewedding.com 0 www.pzq.kei.mybluehost.me 0 mail.lyy.wev.mybluehost.me 0 website-c7d6b3cd.ttr.bqv.mybluehost.me 0 lumie.site 0 website-00475774.ane.pzr.mybluehost.me 0 mail.jen.jdq.mybluehost.me 0 www.okl.nmy.mybluehost.me 0 www.alvinwayneweiss.com 0 mail.zachcomputerservices.com 0 www.lyy.wev.mybluehost.me 0 mail.gainthedifference.com 0 walkabouthills.paintedwolfmedia.com 0 mail.texasdfwrealtor.com 0 new.adw.mybluehost.me 1 mail.mlu.koc.mybluehost.me 0 mail.theirsilentscreams.com 0 www.rsc.keb.mybluehost.me 0 mail.vbk.wxk.mybluehost.me 0 mail.ebq.rdx.mybluehost.me 0 www.efsmi.com 0 vip.sfg.mybluehost.me 0 gnsenterprises.com.pk 0 www.kristianireland.com 0 happysoulwhotravels.com 0 website-63d89594.sunmulgift.com 0 mail.rat.lnr.mybluehost.me 0 www.perspectivesireland.perspectivesireland.ie 0 www.alisonarcher.com.au 0 hkr.vcj.mybluehost.me 0 www.nateharrison.com 0 www.uhm.zca.mybluehost.me 0 www.sovereigncapitalnyc.com 0 mail.somewhatfair.com 0 eyesightfoundation-org.sponteconsulting.com 0 mail.jtt.okl.mybluehost.me 0 www.lexonenterprises.com 0 catstealers.com 0 www.lbo.lnl.mybluehost.me 0 www.website-c7d6b3cd.ttr.bqv.mybluehost.me 0 cookingwithkittycat.com 0 mail.okl.nmy.mybluehost.me 0 aquarellegranite.com 0 healingwithmary.net 0 www.wikiactivism.com 0 tribewoman.com 0 mtn.xem.mybluehost.me 0 mail.rln.bur.mybluehost.me 0 wgb.oha.mybluehost.me 0 vhk.hal.mybluehost.me 0 www.suncoastbaptistchurch.info 0 lereveluxury.com 0 website-287d5d33.naa.ixy.mybluehost.me 0 mail.bingefreeathlete.com 0 mail.opandc.com 0 mhv.rbb.mybluehost.me 0 website-f0ddad42.ppd.ssy.mybluehost.me 0 rofaendurance.td2travelsandadventures.com 0 www.avisofitness.com 0 olivetreetales.mindyourown.life 0 www.rhextranslations.com 0 www.alicethomsen.com 0 www.independentmusicproduction.com 0 kismetmind.com 0 website-0509403a.ccl-us.org 0 frk-machine.com 0 website-6079b47d.wqb.fgc.mybluehost.me 0 www.mobiushome.com 0 mail.tny.vtl.mybluehost.me 0 hbc.mlg.mybluehost.me 0 npv.lil.mybluehost.me 0 mail.salishseadiatoms.com 0 www.erinnkdaniel.vmr.arb.mybluehost.me 0 gagereviews.com 0 mail.sai.sbv.mybluehost.me 0 www.adventureandeat.com 0 adventureandeat.com 0 mail.eurohairprosalon.com 0 www.wundexperte-koeln-de.krankenpflegemiller.com 0 mail.blueboxsoftware.net 0 cliffsideengineering.com 0 www.medicareplansrx.blueandgrayfinancial.com 0 josefinarecruitment.com 0 www.mygeotokens.com 0 www.inmyteam.com 0 zzj.etw.mybluehost.me 0 www.jff.lnl.mybluehost.me 0 www.abundantlovechildrenshome.com 0 jff.lnl.mybluehost.me 0 www.kpb.goj.mybluehost.me 0 bfftestprep.com 0 writeesasyeails.com 0 reliablessinc.com 0 www.ascendingarrows.com 0 website-d736f01b.azh.jzw.mybluehost.me 0 www.adroitlivingtp.com 0 www.website-7a584425.partnersdigitalmarketing.com 0 lesliesbookcase.com 0 www.kma-spotlight.com 0 kianaturally.com 0 www.loapioneers.com 0 www.justingolding.com 0 mail.rachana.io 0 indispensabilitypro.com 0 www.ujimacultureproject.com 0 www.perspectivesireland.com 0 mail.doxentrics.com 0 www.ennvisionn.com 0 www.thecaptainjerry.com 0 www.theohlab.com 0 plugovoyhistory.com 0 www.changeskills.thementoringprogram.com 0 www.agriexotic.com 0 mygeotokens.mindyourown.life 0 www.boudman.boudman.com 0 ane.pzr.mybluehost.me 0 mail.preachfromthehousetops.com 0 www.wildlyfaithfulwomen.vmr.arb.mybluehost.me 0 sunpring.sunpringextruder.com 0 www.cotapult.wewalkwithyou.com 0 www.intuitivehealthma.com 0 www.efectoresponsable-pe.karlosperu.com 0 www.offer.partnersdigitalmarketing.com 0 www.littleocean.dynamicsmachines.com 0 uuq.xxm.mybluehost.me 0 mail.qcs.mwd.mybluehost.me 0 intuitivehealthma.com 0 mail.buttnerreisdias.com 0 mail.freewebtoonsite.com 0 kidzcomics.com 0 kgq.wyy.mybluehost.me 0 mail.qrz.pbv.mybluehost.me 0 www.website-a93fb326.aps.fts.mybluehost.me 0 mail.dynamicsmachines.com 0 mail.alexcriddle.com 0 www.msmassagesandacupunctures.com 0 mail.nrk.hsk.mybluehost.me 0 mail.yis.oco.mybluehost.me 0 www.dnp.tqp.mybluehost.me 0 www.website-84d10498.qmd.bzx.mybluehost.me 0 www.jcmagazine.com 0 eidegames.eoj.xmy.mybluehost.me 0 www.website-d20a7248.sunpringextruder.com 0 www.zain-alemaar.com 0 mail.lzv.xem.mybluehost.me 0 balancebusinesssolution.net 0 www.lumie.site 0 www.smalimousine.com 0 mail.islandaircontrol.com 0 website-cab72c0c.ygo.bsd.mybluehost.me 0 www.ooa.pvh.mybluehost.me 0 waterpurifierrental.com 0 www.gti.etu.mybluehost.me 0 mail.texassigningservices.com 0 www.martinispickleball.com 0 xvb.fts.mybluehost.me 0 old.foodmarketgypsy.com 0 wordxpressllc.kishafreed.com 0 www.gustordonez.keyawagroup.com 0 www.mxx.xng.mybluehost.me 0 www.trading.kismetmind.com 0 slk.bgd.mybluehost.me 0 mail.olivetreetales.com 0 www.ftj.rdx.mybluehost.me 0 www.asilverliningcounseling.org 0 www.yrh.nmb.mybluehost.me 0 mail.wiq.jru.mybluehost.me 0 mail.melissarevels.com 0 mail.vsj.tdd.mybluehost.me 0 www.neighboravenue.com 0 mail.jennayoungconsulting.com 0 www.mr-quackersartistry.com 0 justingolding.com 0 www.thinkdigitalmatter.com 0 mail.catheryngrivna.com 0 mail.theaboutsports.com 0 www.theirsilentscreams.alvinwayneweiss.com 0 mail.alcyonespace.com 0 www.dynamic-rr.com 0 phoenixdpi.com 0 www.cascadesignaturephotography.com 0 mail.rokaymedia.ca 0 lawnrangermi.com 0 gwl.oqp.mybluehost.me 0 sizzlesalsyoutube.com 0 mail.williammazza.com 0 www.zhane.space 0 kmi.aqd.mybluehost.me 0 mail.plansformoms.com 0 www.happy-houseplants.com 0 www.mavila.pe 0 businessclub.dynamicsmachines.com 0 www.mgp.zyv.mybluehost.me 0 merakimortgage.com 0 www.bowlinefinancial.com 0 www.thesilvergym.booktipper.com 0 www.primepaintingco.com 0 xut.pyw.mybluehost.me 0 pon.lgu.mybluehost.me 0 www.themarketingaigency.mindyourown.life 0 aps.fts.mybluehost.me 0 www.willow.ae 0 heaveninordinary.com 0 mail.globaltravelescapades.com 0 www.ttw.nqg.mybluehost.me 0 mayaelchuco.com 0 mail.silverpoint-development.com 0 tct.jwp.mybluehost.me 0 frkplant-net.sunpringextruder.com 0 rln.bur.mybluehost.me 0 mail.zhane.space 0 www.website-0e80c00c.sju.aef.mybluehost.me 0 bqh.vtl.mybluehost.me 0 mail.lawnrangermi.com 0 www.whooi.mwz.rrh.mybluehost.me 0 edn.lef.mybluehost.me 0 www.vipseniorbenefits.myutahmedicareplans.com 0 mail.brusselsbeachhouse.com 0 printec.sg 0 www.greenlightservices-us.aeroventuresllc.com 0 mail.ien.klr.mybluehost.me 0 mail.doulosapologetics.com 0 mail.wundexperte-koeln.de 0 cotapult.com 0 uppercrustvegan.com 0 www.partnersdigitalmarketing.com 0 www.lkk.shn.mybluehost.me 0 mail.kpb.goj.mybluehost.me 0 66days.co 0 www.afaqhomeschool.dynamicsmachines.com 0 website-69d89cfd.vmr.arb.mybluehost.me 0 www.website-e95c4881.ane.pzr.mybluehost.me 0 tlk.rfl.mybluehost.me 0 mail.nutu.at 0 mail.mavila.pe 0 lusty-store.keyawagroup.com 0 www.cstalks.org 0 mail.perspectivesireland.ie 0 mail.hollybrunelle.com 0 www.ksnartistry.com 0 www.sunmul-gift.sunmulgift.com 0 www.kimberlysdesignstudio.com 0 mail.onwhatwings.com 0 www.alisongifford.yourstudydoctor.com 0 mail.harryvourtsis.com 0 www.thewholepetdiet.jkcornett.com 0 www.lightsoutbbq.com 0 www.politics.nnhsclubs.com 0 neighboravenue.com 0 mail.zul.uqp.mybluehost.me 1 www.galenetherapy.com 0 website-2e15c7d2.yourstudydoctor.com 0 www.salishseadiatoms.com 0 website-8380379f.hjy.jyk.mybluehost.me 0