Host 162.241.226.40
United States
Software information
Apache
tcp/443 tcp/80
nginx 1.21.6
tcp/443 tcp/80
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.wpr.bwk.mybluehost.me
Port: 443
URL: https://www.wpr.bwk.mybluehost.meFirst seen 2024-05-14 07:55
Last seen 2024-09-16 23:07
Open for 125 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 23:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.tyd.skj.mybluehost.me
Port: 443
URL: https://mail.tyd.skj.mybluehost.meFirst seen 2024-03-10 21:35
Last seen 2024-09-16 22:59
Open for 190 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 22:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenshoa.org
Port: 443
URL: https://mail.charbonneaugreenshoa.orgFirst seen 2022-12-09 19:05
Last seen 2024-09-16 22:56
Open for 647 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:56
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.scimagopublications-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.scimagopublications-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-06-04 18:12
Last seen 2024-09-16 22:55
Open for 470 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652236b4a59e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/scimagopublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 22:55239 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-09 19:05
Last seen 2024-09-16 22:55
Open for 647 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:34
Last seen 2024-09-16 22:48
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2024-09-16 22:44
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-09-16 22:34
Open for 314 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-09-16 22:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-09-16 22:30
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.portugalexperience.com
Port: 443
URL: https://mail.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2024-09-16 22:21
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:21
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublications-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-01-22 19:18
Last seen 2024-09-16 22:14
Open for 603 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 22:14241 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652210381cd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk-old.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-01-22 19:18303 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.portugalexperience.com
Port: 443
URL: https://www.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2024-09-16 22:04
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 22:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-03-10 21:26
Last seen 2024-09-16 22:02
Open for 190 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 22:02
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.teals.journalpublisher.co.uk
Port: 443
URL: https://www.teals.journalpublisher.co.ukFirst seen 2024-07-08 18:21
Last seen 2024-09-16 21:51
Open for 70 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522252736dc[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/ecommonkscurrent.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 21:51294 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 17:54
Last seen 2024-09-16 21:37
Open for 729 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 21:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-09-16 21:34
Open for 314 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-09-16 21:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.tyd.skj.mybluehost.me
Port: 443
URL: https://www.tyd.skj.mybluehost.meFirst seen 2024-03-10 21:35
Last seen 2024-09-16 21:19
Open for 189 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 21:19
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.journalpublisher.co.uk
Port: 443
URL: https://www.journalpublisher.co.ukFirst seen 2023-09-19 18:58
Last seen 2024-09-16 21:18
Open for 363 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c2aeec2[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 21:18293 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224352633e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [pull] rebase = false
Found on 2024-01-07 12:13320 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-12-11 12:32235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-09-16 21:18
Open for 314 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-09-16 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2024-09-16 21:18
Open for 669 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2024-09-16 21:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9defc5466cefc5466cefc5466cefc5466cFound 1 files trough .DS_Store spidering: /blog
Found on 2024-09-02 05:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowetrails.stowe-trails.com
Port: 443
URL: https://stowetrails.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-09-16 21:17
Open for 424 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 21:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-09 00:25 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-01 11:47 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-30 14:25
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.andyrobinetmusic.com
Port: 443
URL: https://mail.andyrobinetmusic.comFirst seen 2022-11-16 19:30
Last seen 2024-09-16 20:58
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 20:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetmusic.androidrobotproductions.com
Port: 443
URL: https://andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-09-16 20:48
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 20:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowemountainbike.stowe-trails.com
Port: 443
URL: https://stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13
Last seen 2024-09-16 20:31
Open for 398 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 20:31 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 15:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-08 18:48 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-30 19:09 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-02 17:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetmusic.androidrobotproductions.com
Port: 80
URL: http://www.andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-09-16 20:24
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 20:24
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-09-16 20:22
Open for 806 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 20:22302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-09-16 20:22
Open for 684 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-09-16 20:22 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-09-16 18:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-09-14 11:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-09-10 22:53 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-08-28 20:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-08-20 21:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.androidrobotproductions.com
Port: 443
URL: https://mail.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-09-16 20:17
Open for 670 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-09-16 20:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:29
Last seen 2024-09-16 20:13
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: orchardhillschristianacademy.com
Port: 443
URL: https://orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2024-09-16 19:35
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:35
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.wpr.bwk.mybluehost.me
Port: 443
URL: https://mail.wpr.bwk.mybluehost.meFirst seen 2024-05-14 07:55
Last seen 2024-09-16 19:31
Open for 125 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 19:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenshoa.org
Port: 443
URL: https://www.charbonneaugreenshoa.orgFirst seen 2023-02-08 18:55
Last seen 2024-09-16 19:25
Open for 586 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:25
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-05-14 07:45
Last seen 2024-09-16 19:22
Open for 125 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 19:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2024-09-16 19:20
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-16 19:18
Open for 322 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-09-16 19:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-14 19:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-09-11 03:57 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-08-24 03:13 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-08-20 13:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.vbp.pmc.mybluehost.me
Port: 443
URL: https://www.vbp.pmc.mybluehost.meFirst seen 2024-06-07 09:57
Last seen 2024-09-16 19:17
Open for 101 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowetrails-org.stowe-trails.com
Port: 443
URL: https://www.stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-09-16 19:15
Open for 424 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 19:15 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-12 13:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-06 17:49 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-24 15:53
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:29
Last seen 2024-09-16 19:15
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-08-07 18:10
Last seen 2024-09-16 19:10
Open for 40 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetguitar.com
Port: 443
URL: https://www.andyrobinetguitar.comFirst seen 2023-01-16 19:10
Last seen 2024-09-16 19:03
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetmusic.androidrobotproductions.com
Port: 443
URL: https://www.andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-09-16 19:00
Open for 669 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 19:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.qru.jgb.mybluehost.me
Port: 443
URL: https://www.qru.jgb.mybluehost.meFirst seen 2023-11-07 21:03
Last seen 2024-09-16 18:54
Open for 313 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-09-16 18:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2024-09-16 18:51
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-09-16 18:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-09-16 18:42
Open for 669 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 18:42
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowetrails-org.stowe-trails.com
Port: 443
URL: https://stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-09-16 18:33
Open for 423 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 18:33 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 12:53 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-08 04:58 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-02 12:39 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e46303911e2c8bb738f82ed3dd91fcc41Found 20 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-18 10:12 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-05-25 14:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:29
Last seen 2024-09-16 18:20
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 18:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-16 19:09
Last seen 2024-09-16 18:19
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 18:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-09-16 18:09
Open for 683 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-09-16 18:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-09-16 02:14 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-09-16 02:14 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-09-08 11:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-08-26 17:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead62b5dcaabFound 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-08-26 17:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-08-22 18:22
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-09-16 18:09
Open for 806 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 18:09302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd08e645819ddf7fd15b8dbfb5b08bcd1896246f4c744b9a8204HTTP/1.1 200 OK Date: Fri, 05 May 2023 17:54:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ehfs.health/wp-json/>; rel="https://api.w.org/", <https://ehfs.health/wp-json/wp/v2/pages/1556>; rel="alternate"; type="application/json", <https://ehfs.health/>; rel=shortlink Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: EHFS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/masterFound on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-16 18:08
Open for 322 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-16 18:08 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-09-14 14:40 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-06 20:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-03-08 09:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-09-16 18:05
Open for 423 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 18:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-12 22:32 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-26 01:04 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-16 02:40
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerspublications.co.uk
Port: 443
URL: https://www.springerspublications.co.ukFirst seen 2023-08-08 18:20
Last seen 2024-09-16 18:02
Open for 404 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522bcde40e1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/springerpublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 18:02242 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-09-16 18:00
Open for 683 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-09-16 18:00 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-09-16 03:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-09-11 00:38 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-09-08 18:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-09-01 19:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247255468757e4d7abc1ac48f5e34fcb64df8Found 9 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-08-12 23:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-07-30 18:25 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead62b5dcaabFound 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-06-18 13:27
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-09-16 18:00
Open for 806 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 18:00302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenhoa.org
Port: 443
URL: https://www.charbonneaugreenhoa.orgFirst seen 2023-02-08 18:55
Last seen 2024-09-16 17:57
Open for 585 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 17:57
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.scimagopublications.co.uk
Port: 443
URL: https://www.scimagopublications.co.ukFirst seen 2023-06-04 18:12
Last seen 2024-09-16 17:55
Open for 469 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652236b4a59e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/scimagopublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 17:55239 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2024-09-16 17:50
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2024-09-16 17:50
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-09-16 17:47
Open for 663 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 17:47225 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:41
Last seen 2024-09-16 17:44
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 17:44
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublicationsusus.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublicationsusus.zbo.pfi.mybluehost.meFirst seen 2023-06-04 18:12
Last seen 2024-09-16 17:30
Open for 469 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 17:30241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.orchardhillschristianacademy.com
Port: 443
URL: https://mail.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2024-09-16 17:29
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 17:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.qru.jgb.mybluehost.me
Port: 443
URL: https://mail.qru.jgb.mybluehost.meFirst seen 2023-11-07 21:03
Last seen 2024-09-16 17:09
Open for 313 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-09-16 17:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2024-09-16 16:56
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 16:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 17:55
Last seen 2024-09-16 16:35
Open for 728 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 16:35
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivate.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivate.zbo.pfi.mybluehost.meFirst seen 2023-01-24 19:20
Last seen 2024-09-16 16:08
Open for 600 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 16:08241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-09-16 15:59
Open for 423 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 15:59 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 10:51 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-04 22:27 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-03 00:57 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aaa80b4585e32b52d7ad4371490c4b380fFound 33 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-18 11:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetguitar.androidrobotproductions.com
Port: 443
URL: https://andyrobinetguitar.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-09-16 15:55
Open for 669 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 15:55
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-09-16 15:55
Open for 663 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 15:55225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.ecom.journalpublisher.co.uk
Port: 443
URL: https://www.ecom.journalpublisher.co.ukFirst seen 2024-07-29 18:22
Last seen 2024-09-16 15:19
Open for 48 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522252736dc[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/ecommonkscurrent.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 15:19294 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublications.zbo.pfi.mybluehost.meFirst seen 2023-04-03 18:20
Last seen 2024-09-16 15:17
Open for 531 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 15:17241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-09-16 15:15
Open for 423 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 15:15 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 12:18 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-10 23:47 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-06 17:39 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-10 11:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2024-01-08 21:13
Last seen 2024-09-16 15:05
Open for 251 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-09-16 15:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-09-16 15:04
Open for 669 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 15:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2024-09-16 15:02
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 15:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.nontribaleconomics.com
Port: 443
URL: https://www.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2024-09-16 15:00
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 15:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.vbp.pmc.mybluehost.me
Port: 443
URL: https://mail.vbp.pmc.mybluehost.meFirst seen 2024-06-07 11:47
Last seen 2024-09-16 14:55
Open for 101 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 14:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-11-07 21:03
Last seen 2024-09-16 14:02
Open for 313 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814ed245ab94d72efec422805998d51e93d9Found 6 files trough .DS_Store spidering: /academic /assets /diplomado /neuroped /nim /premics.com
Found on 2024-09-16 14:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.achronicentrepreneur.com
Port: 443
URL: https://mail.achronicentrepreneur.comFirst seen 2022-10-13 18:10
Last seen 2024-09-16 14:02
Open for 703 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 14:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2024-09-16 13:59
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-09-16 13:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: childrensfrenchbookcorner.com
Port: 443
URL: https://childrensfrenchbookcorner.comFirst seen 2022-09-15 17:53
Last seen 2024-09-16 13:53
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 13:53
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerspublications-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.springerspublications-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-08-08 18:20
Last seen 2024-09-16 13:48
Open for 404 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522bcde40e1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/tealsbrands/springerpublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 13:48242 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-16 13:47
Open for 321 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-16 13:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-09-14 09:23 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-09-06 19:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-07-16 11:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-04-28 21:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-10-30 17:47
Last seen 2024-09-16 13:45
Open for 321 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-09-16 13:45 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1acf60067e2434994b37208a65bb46f3cFound 34 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme /qa-theme/Candy /qa-theme/Classic /qa-theme/Snow /qa-theme/SnowFlat
Found on 2024-09-06 11:41 -
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-08-22 07:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2024-08-18 07:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e457552bb2b44cb69f036fc2eb28dcf2bd8Found 30 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/wysiwyg-editor/ckeditor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2024-08-08 20:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: androidrobotproductions.com
Port: 443
URL: https://androidrobotproductions.comFirst seen 2023-01-16 19:09
Last seen 2024-09-16 13:39
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-09-16 13:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-16 19:09
Last seen 2024-09-16 13:04
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 13:04
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications.com
Port: 443
URL: https://www.clarivatepublications.comFirst seen 2023-06-04 18:12
Last seen 2024-09-16 12:51
Open for 469 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 12:51241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2024-09-16 12:49
Open for 669 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 12:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.churchannouncementsolutions.com
Port: 443
URL: https://mail.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2024-09-16 12:38
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 12:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetmusic.androidrobotproductions.com
Port: 80
URL: http://andyrobinetmusic.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2024-09-16 12:37
Open for 669 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 12:37
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublicationsus.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublicationsus.zbo.pfi.mybluehost.meFirst seen 2023-04-03 18:20
Last seen 2024-09-16 12:15
Open for 531 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 12:15241 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublicationsuss.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.clarivatepublicationsuss.zbo.pfi.mybluehost.meFirst seen 2023-04-03 18:20
Last seen 2024-09-16 12:11
Open for 531 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 12:11241 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetguitar.androidrobotproductions.com
Port: 443
URL: https://www.andyrobinetguitar.androidrobotproductions.comFirst seen 2023-01-16 19:10
Last seen 2024-09-16 12:07
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 12:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-18 17:55
Last seen 2024-09-16 12:07
Open for 728 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d1ad1b6281ad1b6281ad1b6281ad1b628Found 1 files trough .DS_Store spidering: /plugins
Found on 2024-09-16 12:07
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerpublications.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.springerpublications.zbo.pfi.mybluehost.meFirst seen 2023-03-08 19:20
Last seen 2024-09-16 11:28
Open for 557 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222bfb54be[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ebookpublisher/springerpublications-as-dradamconsultancy.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 11:28260 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2024-09-16 11:21
Open for 668 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2024-09-16 11:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9defc5466cefc5466cefc5466cefc5466cFound 1 files trough .DS_Store spidering: /blog
Found on 2024-09-04 16:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-09-16 11:20
Open for 423 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 11:20 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-12 11:51 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-10 15:46 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-20 17:08 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-14 03:56 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c8c9af8b78c9af8b79ca15ebcc657e14adaa42238c06d573aFound 128 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/blocks/archives /wp-includes/blocks/audio /wp-includes/blocks/avatar /wp-includes/blocks/block /wp-includes/blocks/button /wp-includes/blocks/buttons /wp-includes/blocks/calendar /wp-includes/blocks/categories /wp-includes/blocks/code /wp-includes/blocks/column /wp-includes/blocks/columns /wp-includes/blocks/comment-author-name /wp-includes/blocks/comment-content /wp-includes/blocks/comment-date /wp-includes/blocks/comment-edit-link /wp-includes/blocks/comment-reply-link /wp-includes/blocks/comment-template /wp-includes/blocks/comments /wp-includes/blocks/comments-pagination /wp-includes/blocks/comments-pagination-next /wp-includes/blocks/comments-pagination-numbers /wp-includes/blocks/comments-pagination-previous /wp-includes/blocks/comments-title /wp-includes/blocks/cover /wp-includes/blocks/embed /wp-includes/blocks/file /wp-includes/blocks/freeform /wp-includes/blocks/gallery /wp-includes/blocks/group /wp-includes/blocks/heading /wp-includes/blocks/home-link /wp-includes/blocks/html /wp-includes/blocks/image /wp-includes/blocks/latest-comments /wp-includes/blocks/latest-posts /wp-includes/blocks/legacy-widget /wp-includes/blocks/list /wp-includes/blocks/list-item /wp-includes/blocks/loginout /wp-includes/blocks/media-text /wp-includes/blocks/missing /wp-includes/blocks/more /wp-includes/blocks/navigation /wp-includes/blocks/navigation-link /wp-includes/blocks/navigation-submenu /wp-includes/blocks/nextpage /wp-includes/blocks/page-list /wp-includes/blocks/paragraph /wp-includes/blocks/pattern /wp-includes/blocks/post-author /wp-includes/blocks/post-author-biography /wp-includes/blocks/post-comments-form /wp-includes/blocks/post-content /wp-includes/blocks/post-date /wp-includes/blocks/post-excerpt /wp-includes/blocks/post-featured-image /wp-includes/blocks/post-navigation-link /wp-includes/blocks/post-template /wp-includes/blocks/post-terms /wp-includes/blocks/post-title /wp-includes/blocks/preformatted /wp-includes/blocks/pullquote /wp-includes/blocks/query /wp-includes/blocks/query-no-results /wp-includes/blocks/query-pagination /wp-includes/blocks/query-pagination-next /wp-includes/blocks/query-pagination-numbers /wp-includes/blocks/query-pagination-previous /wp-includes/blocks/query-title /wp-includes/blocks/quote /wp-includes/blocks/read-more /wp-includes/blocks/rss /wp-includes/blocks/search /wp-includes/blocks/separator /wp-includes/blocks/shortcode /wp-includes/blocks/site-logo /wp-includes/blocks/site-tagline /wp-includes/blocks/site-title /wp-includes/blocks/social-link /wp-includes/blocks/social-links /wp-includes/blocks/spacer /wp-includes/blocks/table /wp-includes/blocks/tag-cloud /wp-includes/blocks/template-part /wp-includes/blocks/term-description /wp-includes/blocks/text-columns /wp-includes/blocks/verse /wp-includes/blocks/video /wp-includes/blocks/widget-group /wp-includes/certificates /wp-includes/css /wp-includes/customize
Found on 2024-05-29 11:33
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivatepublications.co.uk
Port: 443
URL: https://www.clarivatepublications.co.ukFirst seen 2023-01-22 19:18
Last seen 2024-09-16 10:18
Open for 602 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b77af596[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-16 10:18241 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652210381cd3[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications.co.uk-old.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-01-22 19:18303 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.orchardhillschristianacademy.com
Port: 443
URL: https://www.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2024-09-16 10:16
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 10:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2024-09-16 09:26
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 09:26
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-09 19:05
Last seen 2024-09-16 09:23
Open for 646 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 09:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.andyrobinetguitar.com
Port: 443
URL: https://mail.andyrobinetguitar.comFirst seen 2023-01-16 19:10
Last seen 2024-09-16 09:18
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 09:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowetrails.stowe-trails.com
Port: 443
URL: https://www.stowetrails.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2024-09-16 08:42
Open for 423 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 08:42 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 04:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-06 02:56 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-01 19:24 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b914c2cd80228191834bcaf6796a0aecc40Found 52 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-18 20:53 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3838040e3838040e46303911e2c8bb738f82ed3dd91fcc41Found 20 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-03-08 09:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.childrensfrenchbookcorner.com
Port: 443
URL: https://www.childrensfrenchbookcorner.comFirst seen 2022-09-15 17:52
Last seen 2024-09-16 08:41
Open for 731 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 08:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.yiy.rfl.mybluehost.me
Port: 443
URL: https://mail.yiy.rfl.mybluehost.meFirst seen 2024-01-08 21:23
Last seen 2024-09-16 08:40
Open for 251 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-09-16 08:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowemountainbike.stowe-trails.com
Port: 443
URL: https://www.stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13
Last seen 2024-09-16 08:36
Open for 397 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 08:36 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-14 04:56 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-04 20:51 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-12 07:43 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-04 08:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-17 19:21
Last seen 2024-09-16 08:22
Open for 607 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 08:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-17 19:21
Last seen 2024-09-16 08:19
Open for 607 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 08:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-09-16 07:39
Open for 423 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 07:39 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-10 14:50 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-01 15:36 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-28 10:00 -
Severity: low
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6cdcd985923522afbaadcd0c57c36f36fFound 28 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-20 12:39 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-16 11:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-09-16 07:11
Open for 683 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-09-16 07:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc60548171d140977b752ca69fc447c1b3Found 4 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-includes
Found on 2024-08-20 10:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-06-24 03:10 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-06-18 12:04
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-09-16 07:11
Open for 805 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 07:11302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.yiy.rfl.mybluehost.me
Port: 443
URL: https://www.yiy.rfl.mybluehost.meFirst seen 2024-01-08 21:23
Last seen 2024-09-16 06:57
Open for 251 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2024-09-16 06:57
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2024-09-16 06:43
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2024-09-16 06:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.nontribaleconomics.com
Port: 443
URL: https://mail.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2024-09-16 06:13
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 06:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.churchannouncementsolutions.com
Port: 443
URL: https://www.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2024-09-16 06:13
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 06:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2024-09-16 05:43
Open for 668 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2024-09-16 05:43 -
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9defc5466cefc5466cefc5466cefc5466cFound 1 files trough .DS_Store spidering: /blog
Found on 2024-09-06 10:26
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-09-16 05:34
Open for 805 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-16 05:34302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-09-16 05:34
Open for 683 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-09-16 05:34 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-08-25 23:21 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-06-01 21:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-05-13 01:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2023-09-14 04:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2024-09-16 05:20
Open for 423 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-16 05:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b914c2cd80228191834bcaf6796a0aecc40Found 52 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-09-02 07:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-28 16:22 -
Severity: low
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6cdcd985923522afbaadcd0c57c36f36fFound 28 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-26 14:00 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-16 13:38 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4e6a01bc36e7ecaa94c236f0fe7991fa1Found 40 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-08-14 11:47 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c2f72f5fb2f72f5fb2e6a0a08ef9a6cb64d1ca69c4882ead2Found 65 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/themes/astra /wp-content/themes/stowetrails /wp-content/themes/twentytwentyone /wp-content/themes/twentytwentythree /wp-content/themes/twentytwentytwo /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-includes/assets /wp-includes/block-patterns /wp-includes/block-supports /wp-includes/blocks /wp-includes/certificates /wp-includes/css /wp-includes/customize /wp-includes/fonts /wp-includes/ID3 /wp-includes/images /wp-includes/IXR /wp-includes/js /wp-includes/php-compat /wp-includes/PHPMailer /wp-includes/pomo /wp-includes/random_compat /wp-includes/Requests /wp-includes/rest-api /wp-includes/SimplePie /wp-includes/sitemaps /wp-includes/sodium_compat /wp-includes/style-engine /wp-includes/Text /wp-includes/theme-compat /wp-includes/widgets /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-06-24 10:49
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.journalpublisher-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.journalpublisher-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-09-19 18:58
Last seen 2024-09-16 04:25
Open for 362 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c2aeec2[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-09-16 04:25293 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224352633e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [pull] rebase = false
Found on 2024-01-07 05:24320 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-12-11 13:22235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-17 19:21
Last seen 2024-09-16 04:14
Open for 607 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 04:14
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: churchannouncementsolutions.com
Port: 443
URL: https://churchannouncementsolutions.comFirst seen 2022-09-16 18:17
Last seen 2024-09-16 03:01
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 03:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.androidrobotproductions.com
Port: 443
URL: https://www.androidrobotproductions.comFirst seen 2023-01-16 19:09
Last seen 2024-09-16 01:44
Open for 608 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2024-09-16 01:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2024-09-16 01:41
Open for 730 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2024-09-16 01:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenhoa.org
Port: 443
URL: https://mail.charbonneaugreenhoa.orgFirst seen 2023-02-08 18:55
Last seen 2024-09-16 01:20
Open for 585 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-09-16 01:20
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:21
Last seen 2024-09-16 00:28
Open for 668 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2024-09-16 00:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-02 18:15
Last seen 2024-09-14 09:23
Open for 681 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544751bf49c06145ebfc7a6152c26c68b343Found 18 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/themes/r9/assets /wp-content/themes/r9/functions /wp-content/themes/r9/styles /wp-content/themes/r9/template-parts /wp-content/uploads /wp-includes
Found on 2024-09-14 09:23 -
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9dd4fa7cee136740cb6dead625524a54Found 14 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/build/assets /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-06-30 04:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772677f2617404f0a09b10abbf13e9f3dfaFound 11 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-06-18 11:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392ab959c1a4c63e5d1708292faa64a84c8b7Found 7 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/themes /wp-content/uploads /wp-includes
Found on 2024-06-18 09:44 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0904d808df2f6950f77b0c6130b1ef52fFound 13 files trough .DS_Store spidering: /.git /wp-admin /wp-content /wp-content/plugins /wp-content/plugins/advanced-custom-fields /wp-content/plugins/loginizer /wp-content/plugins/sitepress-multilingual-cms /wp-content/plugins/wps-hide-login /wp-content/themes /wp-content/themes/build /wp-content/themes/r9 /wp-content/uploads /wp-includes
Found on 2024-05-13 03:07
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-03 17:54
Last seen 2024-09-14 09:23
Open for 803 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222434cd4d[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-09-14 09:23302 Bytes -
Severity: high
Fingerprint: 2580fa947e78dd084a208bff17cd8cf1dcb0788aef33dfe841b56514ae319439HTTP/1.1 301 Moved Permanently Date: Fri, 05 May 2023 17:54:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ Cache-Control: max-age=7200 Expires: Fri, 05 May 2023 19:54:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS [core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://karim_khamiss@bitbucket.org/road9media-dev/ehfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2023-05-05 17:54302 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 80
URL: http://www.ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-09-02 03:59
Open for 649 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-02 03:59225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: ukhec-co-uk.zbo.pfi.mybluehost.me
Port: 80
URL: http://ukhec-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 19:09
Last seen 2024-09-01 07:51
Open for 648 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2024-09-01 07:51225 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.allnaturalrepellent.com
Port: 443
URL: https://www.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2024-08-24 05:37
Open for 707 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2024-08-24 05:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772eda0e53922d85fe97e12963a565b8f61Found 11 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.allnaturalrepellent.com
Port: 443
URL: https://mail.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2024-08-22 16:07
Open for 705 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2024-08-22 16:07
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:52
Last seen 2024-08-22 14:15
Open for 705 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2024-08-22 14:15 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772eda0e53922d85fe97e12963a565b8f61Found 11 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /Layered_highres /old html files /prelim imagery /proof
Found on 2024-03-08 06:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2024-06-28 08:45
Open for 588 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-28 08:45
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2024-06-28 01:28
Open for 588 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-28 01:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2024-06-26 11:43
Open for 586 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-26 11:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2024-06-06 10:43
Open for 627 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-06 10:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2024-06-06 09:16
Open for 627 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-06 09:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2024-06-06 07:13
Open for 627 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-06-06 07:13
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57
Last seen 2024-02-22 18:56
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb90233cd2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Florencio-Jose-Cau/41bc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-02-22 18:56305 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-01-07 11:03301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57
Last seen 2024-02-22 18:56
Open for 122 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb90233cd2[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Florencio-Jose-Cau/41bc.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-02-22 18:56305 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-01-07 02:42301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: mail.journalpublisher.co.uk
Port: 443
URL: https://mail.journalpublisher.co.ukFirst seen 2023-11-19 20:45
Last seen 2024-02-02 02:27
Open for 74 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c2aeec2[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-02-02 02:27293 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224352633e[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [pull] rebase = false
Found on 2024-01-07 12:13320 Bytes -
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-12-11 12:32235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2024-01-31 19:11
Open for 502 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2024-01-31 19:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2024-01-31 19:11
Open for 502 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2024-01-31 19:11
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-11-19 20:45-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-11-19 20:45235 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: journalpublisher-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://journalpublisher-co-uk.zbo.pfi.mybluehost.meFirst seen 2023-11-19 20:45-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c325e931[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/journalpublishers.com.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-11-19 20:45235 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-17 02:16
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb36a7c9661ae6599a6a9d608645455283dFound 29 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-plugin/basic-adsense /qa-plugin/event-logger /qa-plugin/example-page /qa-plugin/facebook-login /qa-plugin/mouseover-layer /qa-plugin/opensearch-support /qa-plugin/recaptcha-captcha /qa-plugin/tag-cloud-widget /qa-plugin/wysiwyg-editor /qa-plugin/xml-sitemap /qa-src /qa-tests /qa-theme
Found on 2023-11-17 02:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-06 05:45 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 23:36
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 23:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-06 04:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 23:01
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 23:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-06 03:36 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 22:52
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 22:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa544742e20b55b6396f722a1f9c00749da581Found 18 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-10-30 17:47 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03
Last seen 2023-11-16 22:52
Open for 324 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cdc57c57adc57c57a67a4eee648173f936b91e689dd4bb8e3Found 19 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-include/ajax /qa-include/app /qa-include/db /qa-include/lang /qa-include/pages /qa-include/pages/admin /qa-include/plugins /qa-include/Q2A /qa-include/util /qa-include/vendor /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2023-11-16 22:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-10-23 17:57301 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2023-10-23 17:57-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbde365e16[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/edymatimbe/fortyone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2023-10-23 17:57301 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.churchannouncementsolutions.com
Port: 80
URL: http://mail.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2023-09-20 17:53
Open for 368 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 18:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: churchannouncementsolutions.com
Port: 80
URL: http://churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2023-09-20 17:53
Open for 368 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 18:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.churchannouncementsolutions.com
Port: 80
URL: http://www.churchannouncementsolutions.comFirst seen 2022-09-16 18:16
Last seen 2023-09-20 17:53
Open for 368 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 18:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f737ea2efc7860108ac8f65f789e0bc70dFound 32 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-09-19 18:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowetrails-org.stowe-trails.com
Port: 80
URL: http://stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44
Last seen 2023-09-19 18:46
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: stowemountainbike.stowe-trails.com
Port: 80
URL: http://stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-08-15 18:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowemountainbike.stowe-trails.com
Port: 80
URL: http://www.stowemountainbike.stowe-trails.comFirst seen 2023-08-15 18:13-
Severity: medium
Fingerprint: 5f32cf5d6962f09cd4047824d404782492dbb213b30c9ff93bd08a1f624e98c9Found 35 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-content/backups-dup-lite /wp-content/plugins /wp-content/plugins/akismet /wp-content/plugins/duplicator /wp-content/plugins/sticky-menu-or-anything-on-scroll /wp-content/themes /wp-content/upgrade /wp-content/uploads /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-08-15 18:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-07-21 18:04
Open for 245 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-07-21 18:04
Open for 245 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-07-21 18:04
Open for 245 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2023-03-21 18:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.stowetrails-org.stowe-trails.com
Port: 80
URL: http://www.stowetrails-org.stowe-trails.comFirst seen 2023-07-20 18:44-
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d49ba2646275dedb8b0a841c23808dd54Found 27 files trough .DS_Store spidering: /index.php /license.txt /readme.html /wp-activate.php /wp-admin /wp-admin/css /wp-admin/images /wp-admin/includes /wp-admin/js /wp-admin/maint /wp-admin/network /wp-admin/user /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-07-20 18:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.todayisthedaylifestyle.com
Port: 443
URL: https://www.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2023-03-20 19:31
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.todayisthedaylifestyle.com
Port: 443
URL: https://mail.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2023-03-20 19:31
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: todayisthedaylifestyle.com
Port: 443
URL: https://todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2023-03-20 19:31
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2023-03-20 18:23
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2023-03-20 18:23
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2023-03-20 18:23
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.agua.cordilleracentral.cl
Port: 443
URL: https://www.agua.cordilleracentral.clFirst seen 2022-09-16 18:19
Last seen 2023-03-19 18:08
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: agua.cordilleracentral.cl
Port: 443
URL: https://agua.cordilleracentral.clFirst seen 2022-09-16 18:18
Last seen 2023-03-19 18:08
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.andyrobinetguitar.com
Port: 80
URL: http://mail.andyrobinetguitar.comFirst seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: andyrobinetguitar.androidrobotproductions.com
Port: 80
URL: http://andyrobinetguitar.androidrobotproductions.comFirst seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.andyrobinetguitar.androidrobotproductions.com
Port: 80
URL: http://www.andyrobinetguitar.androidrobotproductions.comFirst seen 2023-01-16 19:10
Last seen 2023-03-19 17:53
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2023-01-16 19:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-16 19:30
Last seen 2023-03-19 17:53
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-16 19:30
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.springerpublications.com
Port: 443
URL: https://www.springerpublications.comFirst seen 2023-03-08 19:20-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222bfb54be[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/ebookpublisher/springerpublications-as-dradamconsultancy.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2023-03-08 19:20260 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.achronicentrepreneur.com
Port: 80
URL: http://mail.achronicentrepreneur.comFirst seen 2022-10-13 18:10
Last seen 2023-02-12 18:48
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-13 18:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 19:02
Last seen 2023-01-30 20:21
Open for 10 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9db7f4c636b7f4c636b7f4c636b7f4c636Found 1 files trough .DS_Store spidering: /images
Found on 2023-01-20 19:02
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-11-22 19:09
Last seen 2023-01-22 19:18
Open for 61 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c9a8e18[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/ukhec.co.uk.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 19:09225 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-01-20 19:20
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-01-20 19:20
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30
Last seen 2023-01-20 19:20
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf1764238b8d3f91e83c7061e83c7061e83c706Found 2 files trough .DS_Store spidering: /blog /blog/wp-content
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2023-01-20 19:03
Open for 126 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23
Last seen 2023-01-20 19:03
Open for 126 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-01-20 19:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9db7f4c636b7f4c636b7f4c636b7f4c636Found 1 files trough .DS_Store spidering: /images
Found on 2023-01-20 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2023-01-18 19:25
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2023-01-18 19:25
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2023-01-17 19:52
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2023-01-17 19:52
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-17 18:15
Last seen 2023-01-17 19:52
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-17 18:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:41
Last seen 2023-01-17 19:48
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.portugalexperience.com
Port: 80
URL: http://www.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2023-01-17 19:48
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.portugalexperience.com
Port: 80
URL: http://mail.portugalexperience.comFirst seen 2022-09-16 19:41
Last seen 2023-01-17 19:48
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.orchardhillschristianacademy.com
Port: 80
URL: http://www.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2023-01-17 19:45
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: orchardhillschristianacademy.com
Port: 80
URL: http://orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2023-01-17 19:45
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.orchardhillschristianacademy.com
Port: 80
URL: http://mail.orchardhillschristianacademy.comFirst seen 2022-09-16 19:36
Last seen 2023-01-17 19:45
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.nontribaleconomics.com
Port: 80
URL: http://www.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2023-01-17 19:44
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.nontribaleconomics.com
Port: 80
URL: http://mail.nontribaleconomics.comFirst seen 2022-09-16 19:34
Last seen 2023-01-17 19:44
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:34
Last seen 2023-01-17 19:44
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 19:34
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2023-01-17 19:38
Open for 123 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2022-09-16 19:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2023-01-17 19:34
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-17 19:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2023-01-17 19:34
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-17 19:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:50
Last seen 2023-01-17 19:34
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-11-17 19:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.agua.cordilleracentral.cl
Port: 80
URL: http://www.agua.cordilleracentral.clFirst seen 2022-09-16 18:19
Last seen 2023-01-16 19:16
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:19
Last seen 2023-01-16 19:16
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-16 18:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-27 19:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247251ab6ac8b506cef506716a412985766fdFound 9 files trough .DS_Store spidering: /qa-cache /qa-content /qa-external-example /qa-include /qa-lang /qa-plugin /qa-src /qa-tests /qa-theme
Found on 2022-12-27 19:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenhoa.org
Port: 80
URL: http://www.charbonneaugreenhoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenhoa.org
Port: 80
URL: http://mail.charbonneaugreenhoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.charbonneaugreenshoa.org
Port: 80
URL: http://mail.charbonneaugreenshoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.charbonneaugreenshoa.org
Port: 80
URL: http://www.charbonneaugreenshoa.orgFirst seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-09 19:05-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-12-09 19:05
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.clarivate.zbo.pfi.mybluehost.me
Port: 80
URL: http://www.clarivate.zbo.pfi.mybluehost.meFirst seen 2022-11-24 19:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652230364a84[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications-as-papertrue.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-24 19:35248 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: clarivate.zbo.pfi.mybluehost.me
Port: 80
URL: http://clarivate.zbo.pfi.mybluehost.meFirst seen 2022-11-24 19:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652230364a84[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/clarivatepublications-as-papertrue.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-24 19:35248 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.dissertationshark.co.uk
Port: 443
URL: https://www.dissertationshark.co.ukFirst seen 2022-11-22 17:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652237e467b1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/dissertationshark-as-researchwriting.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 17:35250 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.dissertationshark-co-uk.zbo.pfi.mybluehost.me
Port: 443
URL: https://www.dissertationshark-co-uk.zbo.pfi.mybluehost.meFirst seen 2022-11-22 17:35-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652237e467b1[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/RspBrands/dissertationshark-as-researchwriting.git fetch = +refs/heads/*:refs/remotes/origin/*
Found on 2022-11-22 17:35250 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.todayisthedaylifestyle.com
Port: 80
URL: http://www.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2022-11-17 20:19
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: todayisthedaylifestyle.com
Port: 80
URL: http://todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2022-11-17 20:19
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.todayisthedaylifestyle.com
Port: 80
URL: http://mail.todayisthedaylifestyle.comFirst seen 2022-09-16 20:13
Last seen 2022-11-17 20:19
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:16
Last seen 2022-11-17 20:18
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-16 20:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:22
Last seen 2022-11-17 19:53
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392aba8d6d48f813ef4af97be02e266842e9dFound 7 files trough .DS_Store spidering: /files /page /page-2 /page-3 /page-4 /resources /rw_common
Found on 2022-09-16 19:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2022-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2022-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:17
Last seen 2022-11-17 19:51
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642145e535ce218da36e218da36e218da36Found 2 files trough .DS_Store spidering: /javascript /style
Found on 2022-09-16 19:17
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2022-11-17 19:43
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2022-11-17 19:43
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 19:02
Last seen 2022-11-17 19:43
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 19:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-17 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-11-17 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2022-11-17 19:21
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54
Last seen 2022-11-17 19:21
Open for 62 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 17:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.androidrobotproductions.com
Port: 80
URL: http://www.androidrobotproductions.comFirst seen 2022-11-16 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: androidrobotproductions.com
Port: 80
URL: http://androidrobotproductions.comFirst seen 2022-11-16 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.androidrobotproductions.com
Port: 80
URL: http://mail.androidrobotproductions.comFirst seen 2022-11-16 19:30-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642b4ffba1ceb9b7e93eb9b7e93eb9b7e93Found 2 files trough .DS_Store spidering: /wp-content /wp-content/plugins
Found on 2022-11-16 19:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.allnaturalrepellent.com
Port: 80
URL: http://www.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2022-11-16 19:27
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:52
Last seen 2022-11-16 19:27
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.allnaturalrepellent.com
Port: 80
URL: http://mail.allnaturalrepellent.comFirst seen 2022-09-16 17:51
Last seen 2022-11-16 19:27
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0044993e7a4f4120fdd6673c8bb686826Found 13 files trough .DS_Store spidering: /comingsoon /css /images /images/icons /images/IE-only /images/images-for-demo-site /images/retail /images/retail/300x300 /images/retail/300x300/Untitled-1.png /Layered_highres /old html files /prelim imagery /proof
Found on 2022-09-16 17:51
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.sundayafternoonblog.com
Port: 443
URL: https://mail.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: mail.sundayafternoonblog.com
Port: 80
URL: http://mail.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.sundayafternoonblog.com
Port: 80
URL: http://www.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.226.40
Domain: www.sundayafternoonblog.com
Port: 443
URL: https://www.sundayafternoonblog.comFirst seen 2022-09-16 20:03-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a34a3589b34a3589bFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/mojo-marketplace-wp-plugin
Found on 2022-09-16 20:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:24-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:24
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 18:23-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe690bf78aef46ea0a9153ff9a9153ff9Found 3 files trough .DS_Store spidering: /_notes /Danqart /Danqart/images
Found on 2022-09-16 18:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-09-16 17:54-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d80af1e5580af1e5580af1e5580af1e55Found 1 files trough .DS_Store spidering: /wp-content
Found on 2022-09-16 17:54
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.api-epaper.parichoy.com
Port: 80
URL: http://www.api-epaper.parichoy.comFirst seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.226.40
Domain: www.api-epaper.parichoy.com
Port: 443
URL: https://www.api-epaper.parichoy.comFirst seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-07-30 10:43-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb12bbef1d[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/aistiak/e-paper-backend fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "img-op"] remote = origin merge = refs/heads/img-op
Found on 2022-07-30 10:43363 Bytes
-
-
Open service 162.241.226.40:80 · mail.allergypacific.com
2024-09-16 09:58
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:58:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Strict-Transport-Security: max-age=31536000; includeSubDomains; preload Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://allergypacific.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=0083e9e4a55456fec40e2b6ecd75ad21; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · byd.wyz.mybluehost.me
2024-09-16 09:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:58:14 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:58:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://andromedaswish.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://andromedaswish.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://andromedaswish.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · breakupglowupfight.com
2024-09-16 09:58
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:58:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://beccathesun.com/xmlrpc.php X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://beccathesun.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:58:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · trevormusgrove.com
2024-09-16 09:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:57:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 SG-F-Cache: BYPASS Link: <https://trevormusgrove.com/wp-json/>; rel="https://api.w.org/", <https://trevormusgrove.com/wp-json/wp/v2/pages/8>; rel="alternate"; title="JSON"; type="application/json", <https://trevormusgrove.com/>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Vary: Accept-Encoding Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.philipalves.com
2024-09-16 09:57
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:57:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://philipalves.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:57:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.recipesandplaces.com
2024-09-16 09:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:56:26 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Mon, 16 Sep 2024 03:41:47 GMT Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:56:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · thelatenotesband.com.au
2024-09-16 09:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:55:23 GMT Server: Apache Link: <https://thelatenotes.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:55:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.paracleteministriesinternational-org.duyanebeauty.com
2024-09-16 09:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:53:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://paracleteministriesinternational.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · onyxeventsdesign.com
2024-09-16 09:52
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:52:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://onyxeventsdesign.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:52:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.a3dp.com.au
2024-09-16 09:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:51:43 GMT Server: Apache Location: https://www.a3dp.com.au/cgi-sys/suspendedpage.cgi Content-Length: 233 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.a3dp.com.au/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · insobeau-com.sunmulgift.com
2024-09-16 09:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:51:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.insobeau.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:51:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jjv.ocl.mybluehost.me
2024-09-16 09:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:51:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mannmadetech.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:51:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.holistichealthbalancebycathey.com
2024-09-16 09:51
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.a3dp.com.au
2024-09-16 09:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:50:13 GMT Server: Apache Location: https://mail.a3dp.com.au/cgi-sys/suspendedpage.cgi Content-Length: 234 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.a3dp.com.au/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · bsv.kdq.mybluehost.me
2024-09-16 09:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:50:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mossbayhall.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hamiltonplumbingsc.com.au
2024-09-16 09:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:49:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:49:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Hamilton Plumbing and Gas Fitting — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Hamilton Plumbing and Gas Fitting — Coming Soon</title> <script src="https://hamiltonplumbingsc.com.au/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hamiltonplumbingsc.com.au/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hamiltonplumbingsc.com.au/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wrc.kdq.mybluehost.me
2024-09-16 09:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:48:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wrc.kdq.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:48:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.brsmarthomeltd.co.uk
2024-09-16 09:47
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.alwehdaclub.sa
2024-09-16 09:47
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:47:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://alwehdaclub.sa/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.natesonlinemarketing.com
2024-09-16 09:47
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:47:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 246 Location: http://mail.natesonlinemarketing.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.natesonlinemarketing.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ljk.qzx.mybluehost.me
2024-09-16 09:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:46:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://buoyancies.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:46:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.gallosbarbershop.com
2024-09-16 09:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:46:01 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:46:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://gallosbarbershop.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://gallosbarbershop.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://gallosbarbershop.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wilmahollis.com
2024-09-16 09:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:45:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://wilmahollis.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:50:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwilmahollis.com%2F; expires=Mon, 14 Oct 2024 09:45:13 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · modernaexteriors.com
2024-09-16 09:44
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:44:32 GMT Server: Apache Location: http://modernaexteriors.com/cgi-sys/suspendedpage.cgi Content-Length: 237 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://modernaexteriors.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.nfi.qni.mybluehost.me
2024-09-16 09:44
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:44:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.nfi.qni.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.nfi.qni.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mse.ihh.mybluehost.me
2024-09-16 09:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:44:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:44:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://alcyonespace.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alcyonespace.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alcyonespace.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · erinkdaniel.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://erinkdaniel.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.dnp.tqp.mybluehost.me
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spicedock.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:43:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · sabrinamtzart.mr-quackersartistry.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://sabrinamtzart.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:48:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.viigems.duyanebeauty.com
2024-09-16 09:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:43:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://viigems.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hbh.fyd.mybluehost.me
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://eillcwa.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:42:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jen.jdq.mybluehost.me
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 SG-F-Cache: BYPASS X-Redirect-By: WordPress Location: https://trevormusgrove.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · perspectivesireland.com
2024-09-16 09:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:42:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://www.perspectivesireland.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.perspectivesireland.com%2F; expires=Mon, 14 Oct 2024 09:42:21 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: PHPSESSID=226c0b2925b15c7714e02bee6b4cd2e8; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jjohnsonpublishing.com
2024-09-16 09:42
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:42:07 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.apx.xfn.mybluehost.me
2024-09-16 09:41
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:41:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.apx.xfn.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.apx.xfn.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · website-5cfeb70c.otr.tqp.mybluehost.me
2024-09-16 09:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:41:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://legalygroup.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: et_pb_ab_view_page_11=2ceaa2841ae45ca870c58d153e3ed940; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · walkabouthills.paintedwolfmedia.com
2024-09-16 09:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:41:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://walkabouthills.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:41:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.egastar.com
2024-09-16 09:40
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:41:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 234 Location: https://mail.egastar.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.egastar.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jrj.ygs.mybluehost.me
2024-09-16 09:39
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:40:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://adelynwang.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:40:02 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wwr.rbb.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wwr.rbb.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · fie.dei.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://texasdfwrealtor.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.bengonet.com
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:34 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://bengonet.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bengonet.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bengonet.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.smileanddialconsulting.com
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://smileanddialconsulting.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qmd.bzx.mybluehost.me
2024-09-16 09:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:39:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://scottpysher.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:39:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · shop.wealthygen.com
2024-09-16 09:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:39:24 GMT Server: Apache Link: <https://shop.wealthygen.com/wp-json/>; rel="https://api.w.org/", <https://shop.wealthygen.com/wp-json/wp/v2/pages/513>; rel="alternate"; title="JSON"; type="application/json", <https://shop.wealthygen.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ooa.pvh.mybluehost.me
2024-09-16 09:38
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ffa.vhl.mybluehost.me
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:54 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ffa.vhl.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.modernaexteriors.modernafencela.com
2024-09-16 09:38
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:38:40 GMT Server: Apache Location: https://www.modernaexteriors.modernafencela.com/cgi-sys/suspendedpage.cgi Content-Length: 257 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.modernaexteriors.modernafencela.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jennayoungconsulting.com
2024-09-16 09:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:38:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://jennayoungconsulting.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:38:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fjennayoungconsulting.com%2F; expires=Mon, 14 Oct 2024 09:38:26 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.priceprova.com
2024-09-16 09:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:38:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://priceprogroup.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://priceprogroup.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://priceprogroup.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:38:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.spacemanmoving.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spacemanmoving.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.internationalkenpokobudohakutsuruassociation.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://internationalkenpokobudohakutsuruassociation.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · frk-machine.sunpringextruder.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://frk-machine.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.paintedwolfmedia.com
2024-09-16 09:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:37:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://paintedwolfmedia.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.prx.doq.mybluehost.me
2024-09-16 09:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:37:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://simbaonlinestore.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.erinnkdaniel.com
2024-09-16 09:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:37:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://erinnkdaniel.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.texasdfwrealtor.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://texasdfwrealtor.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.musicjazzg.com
2024-09-16 09:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:37:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://musicjazzg.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:37:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.goodentllc.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://goodentllc.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · rxn.kdf.mybluehost.me
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: My Gardening Passion — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>My Gardening Passion — Coming Soon</title> <script src="https://rxn.kdf.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rxn.kdf.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rxn.kdf.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.blubakery.ca
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://blubakery.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wilmahollis.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://wilmahollis.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:41:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwilmahollis.com%2F; expires=Mon, 14 Oct 2024 09:36:29 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.spicedock.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spicedock.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cine4m-com.sunmulgift.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.cine4m.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.uni.jvd.mybluehost.me
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ksnartistry.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · trading.kismetmind.com
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://trading.kismetmind.com/wp-json/>; rel="https://api.w.org/", <https://trading.kismetmind.com/wp-json/wp/v2/pages/302>; rel="alternate"; title="JSON"; type="application/json", <https://trading.kismetmind.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Ftrading.kismetmind.com%2F; expires=Mon, 14 Oct 2024 09:36:16 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.animefreesite.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://animefreesite.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.riseupabove.com
2024-09-16 09:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:36:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block Link: <https://wikiactivism.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:36:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.ardsoftsolutions.com
2024-09-16 09:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:36:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://ardsoftsolutions.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:36:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.dbh.csv.mybluehost.me
2024-09-16 09:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:35:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:35:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 09:35:18 GMT; Max-Age=315360000; path=/ Set-Cookie: wcpay_currency=USD_1; expires=Mon, 16 Sep 2024 10:35:19 GMT; Max-Age=3600; path=/ Transfer-Encoding: chunked Page title: Prestige Luxury Transportation — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Prestige Luxury Transportation — Coming Soon</title> <script src="https://prestigeluxurytransportationfl.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://prestigeluxurytransportationfl.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://prestigeluxurytransportationfl.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · vegas-x-tech.modernafencela.com
2024-09-16 09:34
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:34:57 GMT Server: Apache Location: http://vegas-x-tech.modernafencela.com/cgi-sys/suspendedpage.cgi Content-Length: 248 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://vegas-x-tech.modernafencela.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yda.xrd.mybluehost.me
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fcmta.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.elbds.com
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://elbds.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lougheedband.paintedwolfmedia.com
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://lougheedband.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.optimizevaservicesllc.com
2024-09-16 09:34
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:34:32 GMT Server: Apache Location: https://www.optimizevaservicesllc.com/cgi-sys/suspendedpage.cgi Content-Length: 247 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.optimizevaservicesllc.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.soil-engineering.com
2024-09-16 09:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:34:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://soil-engineering.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:39:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · martinispickleball.com
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Martini’s Indoor Pickleball & Athletic Club — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Martini’s Indoor Pickleball & Athletic Club — Coming Soon</title> <script src="https://martinispickleball.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://martinispickleball.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://martinispickleball.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-1a89461e.ane.pzr.mybluehost.me
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:34:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title> — Coming Soon</title> <script src="https://tinitiatives.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tinitiatives.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tinitiatives.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.thebuildabetterman.com
2024-09-16 09:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:34:04 GMT Server: Apache Link: <https://www.thebuildabetterman.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: My great WordPress blog | Just another WordPress site <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <title>My great WordPress blog | Just another WordPress site</title> <link rel="profile" href="https://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.thebuildabetterman.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.thebuildabetterman.com/wp-content/themes/twentyfourteen/js/html5.js?ver=3.7.0"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//www.thebuildabetterman.com' /> <link rel="alternate" type="application/rss+xml" title="My great Wordpress blog » Feed" href="https://www.thebuildabetterman.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="My great Wordpress blog » Comments Feed" href="https://www.thebuildabetterman.com/?feed=comments-rss2" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.thebuildabetterman.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).theFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yap.ref.mybluehost.me
2024-09-16 09:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:33:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://yap.ref.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://yap.ref.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · zlunasalon.com
2024-09-16 09:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:33:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://zlunasalon.com/wp-json/>; rel="https://api.w.org/", <https://zlunasalon.com/wp-json/wp/v2/pages/12>; rel="alternate"; title="JSON"; type="application/json", <https://zlunasalon.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:38:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.vegas-x-tech.modernafencela.com
2024-09-16 09:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:33:45 GMT Server: Apache Location: http://www.vegas-x-tech.modernafencela.com/cgi-sys/suspendedpage.cgi Content-Length: 252 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.vegas-x-tech.modernafencela.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wvw.ifs.mybluehost.me
2024-09-16 09:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:33:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.wvw.ifs.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.wvw.ifs.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · vegas-x-tech.modernafencela.com
2024-09-16 09:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:33:26 GMT Server: Apache Location: https://vegas-x-tech.modernafencela.com/cgi-sys/suspendedpage.cgi Content-Length: 249 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://vegas-x-tech.modernafencela.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.forensicsupervisorsuccess.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://forensicsupervisorsuccess.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:33:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jennayoungconsulting.com
2024-09-16 09:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://jennayoungconsulting.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:33:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fjennayoungconsulting.com%2F; expires=Mon, 14 Oct 2024 09:33:15 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kps.dei.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:58 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kps.dei.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-d8fc586a.hollytoscanini.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://howtolosethewait.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mathesisml.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:33:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.mathesisml.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.icm.ano.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:52 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://icm.ano.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.alicexinliu.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.alicexinliu.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:37:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.tredemapping.com
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://tredemapping.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · rodolfistasdecorazon.usi.jso.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://rodolfistasdecorazon.com/xmlrpc.php X-Redirect-By: WordPress Location: https://rodolfistasdecorazon.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-ff8c04c5.ond.emu.mybluehost.me
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://toptrippicks.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:32:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.asilverliningcounseling.org
2024-09-16 09:32
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:32:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://asilverliningcounseling.org/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:37:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.allergypacific.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Strict-Transport-Security: max-age=31536000; includeSubDomains; preload Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://allergypacific.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=75704d6717fd1db056906b95cbc50da7; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.penprojects.com
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: miss Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: accept,content-type,Accept-Encoding Link: <https://karenjadams.net/wp-json/>; rel="https://api.w.org/" host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=23e35801d82ccd6b11e0c44120651b28; path=/ Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.cpapostolichub.org
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://cpapostolichub.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.barnesmailftw.com
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:32 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://barnesmailftw.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://barnesmailftw.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://barnesmailftw.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.badgesoffraud.com
2024-09-16 09:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:31:21 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://badgesoffraud.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.badgesoffraud.com
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:20 GMT Server: Apache Link: <https://badgesoffraud.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://badgesoffraud.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://badgesoffraud.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.supermarket2amigosgmail.com
2024-09-16 09:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:31:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:31:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://supermarket2amigosgmail.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://supermarket2amigosgmail.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://supermarket2amigosgmail.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · temitrismarketinghelp.com
2024-09-16 09:30
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:30:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://temitrismarketinghelp.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://temitrismarketinghelp.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · qhs.kdq.mybluehost.me
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://theax.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.curlyhairproducts.com
2024-09-16 09:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:30:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 10:30:44 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://curlyhairproducts.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-bd5878c6.harmonywithtruenature.com
2024-09-16 09:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:30:10 GMT Server: Apache Link: <https://harmonywithtruenature.com/.website_bd5878c6/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.walkabouthills.paintedwolfmedia.com
2024-09-16 09:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:30:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://walkabouthills.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:30:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.eagleeyewear-net.brandonolin.com
2024-09-16 09:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:29:59 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tribewoman.com
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tribewoman.com/wp-json/>; rel="https://api.w.org/", <https://tribewoman.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://tribewoman.com/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.codeflex.co
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:38 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://codeflex.co/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.georgiaparis.net
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://georgiaparis.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ngt.mje.mybluehost.me
2024-09-16 09:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:29:17 GMT Server: Apache Location: https://www.ngt.mje.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 243 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.ngt.mje.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.us-scientific.com
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:14 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://us-scientific.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cascadesignaturephotography.com
2024-09-16 09:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:29:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cascadesignaturephotography.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:29:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.laasool.com
2024-09-16 09:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:29:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 233 Location: https://www.laasool.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.laasool.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · theressomuchgood.com
2024-09-16 09:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:29:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://theressomuchgood.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/bdGnO>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:34:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ttw.nqg.mybluehost.me
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ttw.nqg.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · andyrobinetmusic.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:55 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mindyourownbirth-ca.mindyourown.life
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mindyourownbirth.ca/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:33:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.doulosapologetics.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://doulosapologetics.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.roamtobreathe.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://roamtobreathe.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:28:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.soullightguidance.com
2024-09-16 09:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:28:11 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sandiparkhurst.com
2024-09-16 09:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:28:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sandiparkhurst.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 17:28:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jjohnsonpublishing.com
2024-09-16 09:27
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:27:58 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wyh.ylh.mybluehost.me
2024-09-16 09:27
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:27:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://wyh.ylh.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://wyh.ylh.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://wyh.ylh.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.pezlogic.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type,accept-encoding,cookie X-Redirect-By: WordPress Location: https://pezlogic.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.sph.zca.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hindsightfilms.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.dunestrailers.com
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dunestrailers.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yrp.vhl.mybluehost.me
2024-09-16 09:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:27:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-DNS-Prefetch-Control: on X-LiteSpeed-Tag: bd4_HTTP.200,bd4_HTTP.301 X-Redirect-By: WordPress Location: https://globaltechdist.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:27:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · liketheholiday.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.liketheholiday.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bookowlebooks.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bookowlebooks.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.cdr.rgy.mybluehost.me
2024-09-16 09:26
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:26:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.cdr.rgy.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.cdr.rgy.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ecg.abf.mybluehost.me
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ecg.abf.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.anisumakenya.co.ke
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-LiteSpeed-Tag: 494_HTTP.200,494_HTTP.301 X-Redirect-By: WordPress Location: https://anisumakenya.co.ke/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.makemeupmiki.com
2024-09-16 09:26
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:26:20 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://makemeupmiki.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mgp.zyv.mybluehost.me
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://yanbenotmane.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://yanbenotmane.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://yanbenotmane.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tinitiatives.com
2024-09-16 09:26
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:26:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:26:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title> — Coming Soon</title> <script src="https://tinitiatives.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tinitiatives.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tinitiatives.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mgv.tqd.mybluehost.me
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <http://tarako-twins23.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.mgv.tqd.mybluehost.me
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <http://tarako-twins23.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.qhs.kdq.mybluehost.me
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://theax.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sbj.fih.mybluehost.me
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sassy-frugal-mom-of-3.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · scottpysher.com
2024-09-16 09:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:25:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://scottpysher.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · studiobyzantium.space
2024-09-16 09:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:25:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://studiobyzantium.space/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:25:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.silhouetteleah.com
2024-09-16 09:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:24:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://silhouetteleah.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sunmul-gift.sunmulgift.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.sunmul-gift.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · frkplant-net.sunpringextruder.com
2024-09-16 09:23
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:23:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://frkplant.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · fvb.bof.mybluehost.me
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://fvb.bof.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mhsdebatealumni.com
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:22 GMT Server: Apache Link: <https://mhsdebatealumni.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://mhsdebatealumni.com/index.php?rest_route=/wp/v2/pages/9>; rel="alternate"; title="JSON"; type="application/json", <https://mhsdebatealumni.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · gustordonez.keyawagroup.com
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:20 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:23:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Blog de Gustavo — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <title> Blog de Gustavo — Coming Soon </title> <meta name="robots" content="noindex, nofollow" /> <script src="https://gustordonez.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url("https://gustordonez.com/wp-content/plugins/bluehost-wordpress-plugin/static/images/cs-bluehost-bg.jpg"); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom: 0; left: 0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important;Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · modernaexteriors.modernafencela.com
2024-09-16 09:23
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:23:20 GMT Server: Apache Location: https://modernaexteriors.modernafencela.com/cgi-sys/suspendedpage.cgi Content-Length: 253 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://modernaexteriors.modernafencela.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · charbonneaugreenhoa.org
2024-09-16 09:23
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:22 GMT Server: Apache X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Strict-Transport-Security: max-age=31536000; includeSubDomains Referrer-Policy: strict-origin-when-cross-origin X-Frame-Options: sameorigin Link: <https://charbonneaugreenshoa.org/index.php?rest_route=/>; rel="https://api.w.org/" Set-Cookie: apbct_timestamp=1726478602; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_site_landing_ts=1726478602; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_page_hits=1; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_cookies_test=%257B%2522cookies_names%2522%253A%255B%2522apbct_timestamp%2522%252C%2522apbct_site_landing_ts%2522%252C%2522apbct_page_hits%2522%255D%252C%2522check_value%2522%253A%25229491520f7c30ff71c806648a0c5591a0%2522%257D; path=/; secure; HttpOnly; SameSite=Lax Set-Cookie: apbct_site_referer=UNKNOWN; expires=Thu, 19 Sep 2024 09:23:22 GMT; Max-Age=259200; path=/; domain=charbonneaugreenshoa.org; secure; HttpOnly; SameSite=Lax Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rgt.uqp.mybluehost.me
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:23:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://zerononsensebeauty.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://zerononsensebeauty.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://zerononsensebeauty.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.tinitiatives.com
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title> — Coming Soon</title> <script src="https://tinitiatives.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tinitiatives.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tinitiatives.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.smileanddialconsulting.com
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://smileanddialconsulting.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.akq.rfn.mybluehost.me
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://akq.rfn.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.internationalkenpokobudohakutsuruassociation.com
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://internationalkenpokobudohakutsuruassociation.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.britishseabuckthorn.com
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:26 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 58989 Last-Modified: Mon, 16 Sep 2024 01:32:04 GMT Accept-Ranges: bytes Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:27:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: Home - The British Sea Buckthorn Company <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <title>Home - The British Sea Buckthorn Company</title> <!-- All in One SEO 4.7.1.1 - aioseo.com --> <meta name="description" content="The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer." /> <meta name="robots" content="max-image-preview:large" /> <link rel="canonical" href="https://www.britishseabuckthorn.com/" /> <meta name="generator" content="All in One SEO (AIOSEO) 4.7.1.1" /> <meta property="og:locale" content="en_US" /> <meta property="og:site_name" content="The British Sea Buckthorn Company -" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Home - The British Sea Buckthorn Company" /> <meta property="og:description" content="The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer." /> <meta property="og:url" content="https://www.britishseabuckthorn.com/" /> <meta property="og:image" content="https://www.britishseabuckthorn.com/wp-content/uploads/2022/02/BSC-LOGO-1.png" /> <meta property="og:image:secure_url" content="https://www.britishseabuckthorn.com/wp-content/uploads/2022/02/BSC-LOGO-1.png" /> <meta name="twitter:card" content="summary" /> <meta name="twitter:title" content="Home - The British Sea Buckthorn Company" /> <meta name="twitter:description" content="The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer." /> <meta name="twitter:image" content="https://www.britishseabuckthorn.com/wp-content/uploads/2022/02/BSC-LOGO-1.png" /> <script type="application/ld+json" class="aioseo-schema"> {"@context":"https:\/\/schema.org","@graph":[{"@type":"BreadcrumbList","@id":"https:\/\/www.britishseabuckthorn.com\/#breadcrumblist","itemListElement":[{"@type":"ListItem","@id":"https:\/\/www.britishseabuckthorn.com\/#listItem","position":1,"name":"Home"}]},{"@type":"Organization","@id":"https:\/\/www.britishseabuckthorn.com\/#organization","name":"The British Sea Buckthorn Company","url":"https:\/\/www.britishseabuckthorn.com\/","logo":{"@type":"ImageObject","url":"https:\/\/www.britishseabuckthorn.com\/wp-content\/uploads\/2022\/02\/BSC-LOGO-1.png","@id":"https:\/\/www.britishseabuckthorn.com\/#organizationLogo","width":512,"height":512},"image":{"@id":"https:\/\/www.britishseabuckthorn.com\/#organizationLogo"}},{"@type":"WebPage","@id":"https:\/\/www.britishseabuckthorn.com\/#webpage","url":"https:\/\/www.britishseabuckthorn.com\/","name":"Home - The British Sea Buckthorn Company","description":"The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer.","inLanguage":"en-US","isPartOf":{"@id":"https:\/\/www.britishseabuckthorn.com\/#website"},"breadcrumb":{"@id":"https:\/\/www.britishseabuckthorn.com\/#breadcrumblist"},"datePublished":"2017-03-23T13:24:27+00:00","dateModified":"2024-07-31T11:37:33+00:00"},{"@type":"WebSite","@id":"https:\/\/www.britishseabuckthorn.com\/#website","url":"https:\/\/www.britishseabuckthorn.com\/","name":"The British Sea Buckthorn Company","inLanguage":"en-US","publisher":{"@id":"https:\/\/www.britishseabuckthorn.com\/#organization"},"potentialAction":{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https:\/\/www.britishseabuckthorn.com\/?s={search_term_string}"},"query-input":"required name=search_term_string"}}]} </script> <!-- All in One SEO --> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link relFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mql.ghe.mybluehost.me
2024-09-16 09:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:22:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kudenservice200.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kudenservice200.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kudenservice200.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.themodevents.iib.jso.mybluehost.me
2024-09-16 09:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:22:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://themodevents.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:22:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wordfortress.justingolding.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.wordfortress.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:26:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · nyashagonsalves.com
2024-09-16 09:21
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:21:33 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 2254 Last-Modified: Fri, 13 Oct 2023 13:49:48 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: nyashagonsalves — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>nyashagonsalves — Coming Soon</title> <script src="https://nyashagonsalves.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nyashagonsalves.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.3.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nyashagonsalves.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html> <!--Generated by Newfold Page Cache-->Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · doabatruck.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.doabatruck.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.exterior.uprcwichita.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://exterior.uprcwichita.com/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 09:21:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.prepperstool.com
2024-09-16 09:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:13 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://prepperstool.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kidzcomics.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:21:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kidzcomics.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:21:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ennvisionn.createwebsiteseasily.com
2024-09-16 09:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:20:48 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:25:48 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: ennvisionn — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>ennvisionn — Coming Soon</title> <script src="https://ennvisionn.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ennvisionn.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ennvisionn.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.badgirlgoodfighter.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://beccathesun.com/xmlrpc.php X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://beccathesun.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:20:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.henryjoseph.com
2024-09-16 09:20
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:29 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://henryjoseph.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · archenergygroup.hydrocarbonexchange.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:20:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://archenergygroup.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.phoenixdpi.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-XSS-Protection: 0 X-Content-Type-Options: nosniff Referrer-Policy: strict-origin-when-cross-origin Content-Security-Policy: upgrade-insecure-requests; Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://phoenixdpi.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kfarringtondesigns.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:39 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kfarringtondesigns.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:24:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · foundartfactory.net
2024-09-16 09:19
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://foundartfactory.net/wp-json/>; rel="https://api.w.org/", <https://foundartfactory.net/wp-json/wp/v2/pages/25>; rel="alternate"; title="JSON"; type="application/json", <https://foundartfactory.net/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.evd.zcr.mybluehost.me
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://crefemme.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:19:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cisosecsolutions.com
2024-09-16 09:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:19:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://cisosecsolutions.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:24:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wiq.jru.mybluehost.me
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:19:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wiq.jru.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:18:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · forensicpocketguide.com
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:18:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://forensicpocketguide.com/wp-json/>; rel="https://api.w.org/", <https://forensicpocketguide.com/wp-json/wp/v2/pages/12084>; rel="alternate"; title="JSON"; type="application/json", <https://forensicpocketguide.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:23:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · modernafencesolutions.modernafencela.com
2024-09-16 09:18
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:18:49 GMT Server: Apache Location: https://modernafencesolutions.modernafencela.com/cgi-sys/suspendedpage.cgi Content-Length: 258 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://modernafencesolutions.modernafencela.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.andyrobinetguitar.com
2024-09-16 09:18
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:18:38 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.btw.slw.mybluehost.me
2024-09-16 09:18
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:18:31 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Show Bible — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Show Bible — Coming Soon</title> <script src="https://btw.slw.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://btw.slw.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://btw.slw.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.wvw.ifs.mybluehost.me
2024-09-16 09:18
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:18:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://mail.wvw.ifs.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.wvw.ifs.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.generalcontractorcapemay.com
2024-09-16 09:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:17:50 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:17:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: generalcontractorcapemay — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>generalcontractorcapemay — Coming Soon</title> <script src="https://generalcontractorcapemay.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://generalcontractorcapemay.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://generalcontractorcapemay.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · btw.slw.mybluehost.me
2024-09-16 09:17
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 09:17:31 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Show Bible — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Show Bible — Coming Soon</title> <script src="https://btw.slw.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://btw.slw.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://btw.slw.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.maideaz.net
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:17:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://maideaz.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.gnsenterprises.com.pk
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:16:56 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://gnsenterprises.com.pk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ryw.etw.mybluehost.me
2024-09-16 09:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:16:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie Pragma: no-cache Expires: Mon, 16 Sep 2024 10:16:45 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://www.pcproblems.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=2d27aee073011f4b3db6b242e2196a16; path=/
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.happyhollowchildcare.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:37 GMT Server: Apache Link: <https://www.happyhollowchildcare.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Happy Hollow at Hope - Dauphin, PA 717.921.8092 <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.happyhollowchildcare.com/xmlrpc.php"> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Happy Hollow at Hope - Dauphin, PA 717.921.8092</title> <meta name="description" content="Dauphin, PA 717.921.8092" /> <link rel="canonical" href="https://www.happyhollowchildcare.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Happy Hollow at Hope" /> <meta property="og:description" content="Dauphin, PA 717.921.8092" /> <meta property="og:url" content="https://www.happyhollowchildcare.com/" /> <meta property="og:site_name" content="Happy Hollow at Hope" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"CollectionPage","@id":"https://www.happyhollowchildcare.com/","url":"https://www.happyhollowchildcare.com/","name":"Happy Hollow at Hope - Dauphin, PA 717.921.8092","isPartOf":{"@id":"https://www.happyhollowchildcare.com/#website"},"description":"Dauphin, PA 717.921.8092","breadcrumb":{"@id":"https://www.happyhollowchildcare.com/#breadcrumb"},"inLanguage":"en-US"},{"@type":"BreadcrumbList","@id":"https://www.happyhollowchildcare.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://www.happyhollowchildcare.com/#website","url":"https://www.happyhollowchildcare.com/","name":"Happy Hollow at Hope","description":"Dauphin, PA 717.921.8092","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://www.happyhollowchildcare.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Happy Hollow at Hope » Feed" href="https://www.happyhollowchildcare.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Happy Hollow at Hope » Comments Feed" href="https://www.happyhollowchildcare.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.happyhollowchildcare.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFFound 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.whooi.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:29 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sun, 15 Sep 2024 23:59:44 GMT Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:16:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · changeskills.com
2024-09-16 09:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:16:16 GMT Server: Apache X-Cache-Enabled: True Link: <https://changeskills.com/wp-json/>; rel="https://api.w.org/", <https://changeskills.com/wp-json/wp/v2/pages/39>; rel="alternate"; type="application/json", <https://changeskills.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:21:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.zelayasconstruction.com
2024-09-16 09:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:14:26 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://zelayasconstruction.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · ericaellis-co.boulderwild.co
2024-09-16 09:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:13:29 GMT Server: Apache X-Pingback: http://www.ericaellis.co/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: http://www.ericaellis.co/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.doxentrics.com
2024-09-16 09:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:13:23 GMT Server: Apache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://doxentrics.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:13:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.eidegames.com
2024-09-16 09:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:12:46 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eidegames.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:12:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.artaffairs.gallery
2024-09-16 09:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:12:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://artaffairs.gallery/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:17:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.nourishedwithlia.com
2024-09-16 09:12
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 09:12:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://mail.nourishedwithlia.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.nourishedwithlia.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mossbayhall.com
2024-09-16 09:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:12:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mossbayhall.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · xcu.qtc.mybluehost.me
2024-09-16 09:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:11:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://oproute.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:16:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:11:50 GMT; Max-Age=315360000; path=/ Connection: close
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.badge3641detroit.com
2024-09-16 09:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:11:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://badge3641detroit.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:16:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vjo.hgs.mybluehost.me
2024-09-16 09:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:09:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:09:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Coaching & Keynote Speaking — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Coaching & Keynote Speaking — Coming Soon</title> <script src="https://indispensabilitypro.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://indispensabilitypro.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://indispensabilitypro.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yorktownday.com
2024-09-16 09:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:08:03 GMT Server: Apache Link: <https://yorktownday.com/wp-json/>; rel="https://api.w.org/", <https://yorktownday.com/wp-json/wp/v2/pages/13>; rel="alternate"; title="JSON"; type="application/json", <https://yorktownday.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:08:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · soarto7.duyanebeauty.com
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:48 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: SOAR TO 7 — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>SOAR TO 7 — Coming Soon</title> <script src="https://soarto7.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://soarto7.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://soarto7.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qatv4k.com
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 293148 Vary: User-Agent,Accept-Encoding Accept-Ranges: bytes Cache-Control: max-age=0, public Expires: Mon, 16 Sep 2024 09:07:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Powered-By: WP Rocket/3.15.6 X-Server-Cache: true X-Proxy-Cache: MISS Page title: Home - QATV4K <!DOCTYPE html> <html lang="en-US"> <head><meta charset="UTF-8"><script>if(navigator.userAgent.match(/MSIE|Internet Explorer/i)||navigator.userAgent.match(/Trident\/7\..*?rv:11/i)){var href=document.location.href;if(!href.match(/[?&]nowprocket/)){if(href.indexOf("?")==-1){if(href.indexOf("#")==-1){document.location.href=href+"?nowprocket=1"}else{document.location.href=href.replace("#","?nowprocket=1#")}}else{if(href.indexOf("#")==-1){document.location.href=href+"&nowprocket=1"}else{document.location.href=href.replace("#","&nowprocket=1#")}}}}</script><script>class RocketLazyLoadScripts{constructor(){this.v="1.2.4",this.triggerEvents=["keydown","mousedown","mousemove","touchmove","touchstart","touchend","wheel"],this.userEventHandler=this._triggerListener.bind(this),this.touchStartHandler=this._onTouchStart.bind(this),this.touchMoveHandler=this._onTouchMove.bind(this),this.touchEndHandler=this._onTouchEnd.bind(this),this.clickHandler=this._onClick.bind(this),this.interceptedClicks=[],window.addEventListener("pageshow",t=>{this.persisted=t.persisted}),window.addEventListener("DOMContentLoaded",()=>{this._preconnect3rdParties()}),this.delayedScripts={normal:[],async:[],defer:[]},this.trash=[],this.allJQueries=[]}_addUserInteractionListener(t){if(document.hidden){t._triggerListener();return}this.triggerEvents.forEach(e=>window.addEventListener(e,t.userEventHandler,{passive:!0})),window.addEventListener("touchstart",t.touchStartHandler,{passive:!0}),window.addEventListener("mousedown",t.touchStartHandler),document.addEventListener("visibilitychange",t.userEventHandler)}_removeUserInteractionListener(){this.triggerEvents.forEach(t=>window.removeEventListener(t,this.userEventHandler,{passive:!0})),document.removeEventListener("visibilitychange",this.userEventHandler)}_onTouchStart(t){"HTML"!==t.target.tagName&&(window.addEventListener("touchend",this.touchEndHandler),window.addEventListener("mouseup",this.touchEndHandler),window.addEventListener("touchmove",this.touchMoveHandler,{passive:!0}),window.addEventListener("mousemove",this.touchMoveHandler),t.target.addEventListener("click",this.clickHandler),this._renameDOMAttribute(t.target,"onclick","rocket-onclick"),this._pendingClickStarted())}_onTouchMove(t){window.removeEventListener("touchend",this.touchEndHandler),window.removeEventListener("mouseup",this.touchEndHandler),window.removeEventListener("touchmove",this.touchMoveHandler,{passive:!0}),window.removeEventListener("mousemove",this.touchMoveHandler),t.target.removeEventListener("click",this.clickHandler),this._renameDOMAttribute(t.target,"rocket-onclick","onclick"),this._pendingClickFinished()}_onTouchEnd(){window.removeEventListener("touchend",this.touchEndHandler),window.removeEventListener("mouseup",this.touchEndHandler),window.removeEventListener("touchmove",this.touchMoveHandler,{passive:!0}),window.removeEventListener("mousemove",this.touchMoveHandler)}_onClick(t){t.target.removeEventListener("click",this.clickHandler),this._renameDOMAttribute(t.target,"rocket-onclick","onclick"),this.interceptedClicks.push(t),t.preventDefault(),t.stopPropagation(),t.stopImmediatePropagation(),this._pendingClickFinished()}_replayClicks(){window.removeEventListener("touchstart",this.touchStartHandler,{passive:!0}),window.removeEventListener("mousedown",this.touchStartHandler),this.interceptedClicks.forEach(t=>{t.target.dispatchEvent(new MouseEvent("click",{view:t.view,bubbles:!0,cancelable:!0}))})}_waitForPendingClicks(){return new Promise(t=>{this._isClickPending?this._pendingClickFinished=t:t()})}_pendingClickStarted(){this._isClickPending=!0}_pendingClickFinished(){this._isClickPending=!1}_renameDOMAttribute(t,e,r){t.hasAttribute&&t.hasAttribute(e)&&(event.target.setAttribute(r,event.target.getAttribute(e)),event.target.removeAttribute(e))}_triggerListener(){this._removeUserInteractionListener(this),"loading"===document.readyState?document.addEventListener("DOMContentLoaded",this._loadEverythingNow.bind(this)):this._loadEverythingNow()}_preconnect3rdParties(){let t=[];document.querySelectorAll("script[type=rocketlazyloadscript]Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-e336fcc6.uuq.xxm.mybluehost.me
2024-09-16 09:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:07:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Cache-Control: no-cache X-Redirect-By: WordPress Location: https://cpapostolichub.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · thelatenotesband.com.au
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:27 GMT Server: Apache Link: <https://thelatenotes.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.uhm.zca.mybluehost.me
2024-09-16 09:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:07:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://josefinarecruitment.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:07:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · personalconfidencecode.com
2024-09-16 09:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:06:35 GMT Server: Apache Link: <https://alisongifford.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://alisongifford.com/index.php?rest_route=/wp/v2/pages/193>; rel="alternate"; title="JSON"; type="application/json", <https://alisongifford.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · suncoastbaptistchurch.info
2024-09-16 09:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:06:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://suncoastbaptistchurch.info/wp-json/>; rel="https://api.w.org/", <https://suncoastbaptistchurch.info/wp-json/wp/v2/pages/55>; rel="alternate"; type="application/json", <https://wp.me/P7lAWA-T>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:11:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jyk.com.gt
2024-09-16 09:05
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:05:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jyk.com.gt/wp-json/>; rel="https://api.w.org/", <https://jyk.com.gt/wp-json/wp/v2/pages/27>; rel="alternate"; title="JSON"; type="application/json", <https://jyk.com.gt/>; rel=shortlink Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=c92ef68f2f40787ed0fb9f21790be836; path=/ Transfer-Encoding: chunked
Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-c04e6967.anc.xfn.mybluehost.me
2024-09-16 09:05
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:05:15 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:05:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Squeezing Nickels — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Squeezing Nickels — Coming Soon</title> <script src="https://anc.xfn.mybluehost.me/.website_c04e6967/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://anc.xfn.mybluehost.me/.website_c04e6967/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://anc.xfn.mybluehost.me/.website_c04e6967/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · reverse-globalwarming.net
2024-09-16 09:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 09:05:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:05:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: We, the people, can mitigate global warming — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>We, the people, can mitigate global warming — Coming Soon</title> <script src="https://reverse-globalwarming.net/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://reverse-globalwarming.net/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://reverse-globalwarming.net/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 16 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-3840dcb4.qdc.vhl.mybluehost.me
2024-09-16 09:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 09:00:57 GMT Server: Apache X-Content-Type-Options: nosniff X-XSS-Protection: 1; mode=block X-Redirect-By: WordPress Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 09:00:58 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://strategiessphere.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 11:00:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.pixelscott.com
2024-09-16 08:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:59:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pixelscott.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:59:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.dynamic-rr.com
2024-09-16 08:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:57:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.dynamic-rr.com/wp-json/>; rel="https://api.w.org/", <https://www.dynamic-rr.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.dynamic-rr.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 09:02:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ygo.bsd.mybluehost.me
2024-09-16 08:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:57:16 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:57:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: deckbuilderofsouthjersey — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>deckbuilderofsouthjersey — Coming Soon</title> <script src="https://deckbuilderofsouthjersey.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://deckbuilderofsouthjersey.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://deckbuilderofsouthjersey.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · makemeupmiki.com
2024-09-16 08:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:57:16 GMT Server: Apache Link: <https://makemeupmiki.com/wp-json/>; rel="https://api.w.org/", <https://makemeupmiki.com/wp-json/wp/v2/pages/268>; rel="alternate"; title="JSON"; type="application/json", <https://makemeupmiki.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.michaeljcordell.com
2024-09-16 08:57
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:57:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 09:57:05 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://michaeljcordell.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kidzcomics.com
2024-09-16 08:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:56:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://kidzcomics.com/wp-json/>; rel="https://api.w.org/", <https://kidzcomics.com/wp-json/wp/v2/pages/26>; rel="alternate"; title="JSON"; type="application/json", <https://kidzcomics.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:56:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.trendzforlesslb.com
2024-09-16 08:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:56:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trendzforlesslb.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:56:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.magneticminstrel.net
2024-09-16 08:56
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:56:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://magneticminstrel.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:56:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.thelatenotesband.com.au
2024-09-16 08:55
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:55:42 GMT Server: Apache Link: <https://thelatenotes.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:55:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ozr.duj.mybluehost.me
2024-09-16 08:53
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.maideaz.net
2024-09-16 08:53
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:53:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://maideaz.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:53:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.thegaldamezlandscaping.com
2024-09-16 08:51
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:51:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:51:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Galdamez Landscaping — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Galdamez Landscaping — Coming Soon</title> <script src="https://thegaldamezlandscaping.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thegaldamezlandscaping.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thegaldamezlandscaping.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-9fc6149c.ygo.bsd.mybluehost.me
2024-09-16 08:50
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:51:00 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:51:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: southjerseyhomeadditions — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>southjerseyhomeadditions — Coming Soon</title> <script src="https://southjerseyhomeadditions.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://southjerseyhomeadditions.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://southjerseyhomeadditions.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.888lockuup.com
2024-09-16 08:50
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:50:46 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://www.888lockuup.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/6a3IO>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.smptheatre.uk
2024-09-16 08:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:50:44 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://smptheatre.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mygeotokens.com
2024-09-16 08:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:50:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 09:50:12 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://mygeotokens.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.embassyofniger.org
2024-09-16 08:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:50:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://embassyofniger.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ekaktech.com
2024-09-16 08:50
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:50:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ekaktech.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:50:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.avaoliviaunlimited.com
2024-09-16 08:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:49:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://avaoliviaunlimited.com/ Cache-Control: max-age=14400 Expires: Mon, 16 Sep 2024 12:49:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jenamartin.net
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Jena Martin — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Jena Martin — Coming Soon</title> <script src="https://jenamartin.net/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jenamartin.net/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jenamartin.net/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.liaholden.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://liaholden.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://liaholden.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://liaholden.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · spicedock.com
2024-09-16 08:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:49:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Spice Dock — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Spice Dock — Coming Soon</title> <script src="https://spicedock.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://spicedock.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://spicedock.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · us-scientific.com
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:54 GMT Server: Apache Link: <https://us-scientific.com/wp-json/>; rel="https://api.w.org/", <https://us-scientific.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: US Scientific Distributors, LLC <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml" prefix="" lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1"/> <title>US Scientific Distributors, LLC</title> <link rel="icon" href="https://us-scientific.com/wp-content/themes/wp_991/favicon.png"> <link rel="pingback" href="https://us-scientific.com/xmlrpc.php" /> <!-- BEGIN Metadata added by the Add-Meta-Tags WordPress plugin --> <meta name="description" content="INTRO ABOUT US Scientific Distributors, LLC We are manufacturer's representatives serving US and global manufacturers in the Animal Health & Nutrition Industry. USSD represents Manufacturers who wish to sell their products in the Caribbean & Central America." /> <!-- END Metadata added by the Add-Meta-Tags WordPress plugin --> <link rel='dns-prefetch' href='//maps.google.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/2.2.1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/us-scientific.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.7.29"}}; !function(t,a,e){var r,n,i,o=a.createElement("canvas"),l=o.getContext&&o.getContext("2d");function c(t){var e=a.createElement("script");e.src=t,e.defer=e.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(e)}for(i=Array("flag","emoji4"),e.supports={everything:!0,everythingExceptFlag:!0},n=0;n<i.length;n++)e.supports[i[n]]=function(t){var e,a=String.fromCharCode;if(!l||!l.fillText)return!1;switch(l.clearRect(0,0,o.width,o.height),l.textBaseline="top",l.font="600 32px Arial",t){case"flag":return(l.fillText(a(55356,56826,55356,56819),0,0),o.toDataURL().length<3e3)?!1:(l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,65039,8205,55356,57096),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55356,57331,55356,57096),0,0),e!==o.toDataURL());case"emoji4":return l.fillText(a(55357,56425,55356,57341,8205,55357,56507),0,0),e=o.toDataURL(),l.clearRect(0,0,o.width,o.height),l.fillText(a(55357,56425,55356,57341,55357,56507),0,0),e!==o.toDataURL()}return!1}(i[n]),e.supports.everything=e.supports.everything&&e.supports[i[n]],"flag"!==i[n]&&(e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&e.supports[i[n]]);e.supports.everythingExceptFlag=e.supports.everythingExceptFlag&&!e.supports.flag,e.DOMReady=!1,e.readyCallback=function(){e.DOMReady=!0},e.supports.everything||(r=function(){e.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",r,!1),t.addEventListener("load",r,!1)):(t.attachEvent("onload",r),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&e.readyCallback()})),(r=e.source||{}).concatemoji?c(r.concatemoji):r.wpemoji&&r.twemoji&&(c(r.twemoji),c(r.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='cptch_stylesheet-css' href='https://us-scientific.com/wp-content/plugins/captcha/css/front_end_style.css?ver=4.7.29' type='text/css' media='all' /> <link rel='stylesheet' id='dashicons-css' href='https://us-scientific.com/wp-includes/css/dashicons.min.css?ver=4.7.29' type='text/css' media='all' /> <link rel='stylesheet' id='cptch_mobile_style-css' href='https://us-scientific.com/wp-content/plugins/captcha/css/mobile_style.css?ver=4.7.29' type='text/css' media='all' /> <link rel='stylesheet' id='cookie-notice-front-css' href='https://us-scientific.com/wp-content/plugins/cookie-notice/css/front.css?ver=4.7.29' type='text/css' media='all' /> <link rel='stylesheet' id='wpgmpFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.dhc.tvd.mybluehost.me
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:49:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://smileanddialconsulting.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · dynamicmarriagesolutions.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dynamicmarriagesolutions.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-0bcb091d.tks.duj.mybluehost.me
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hillts.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.capeofdreams.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://capeofdreams.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · frkextruder.sunpringextruder.com
2024-09-16 08:48
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:48:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://frkextruder.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:48:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wiredss.ae
2024-09-16 08:48
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:48:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wiredss.ae/wp-json/>; rel="https://api.w.org/", <https://wiredss.ae/wp-json/wp/v2/pages/2542>; rel="alternate"; title="JSON"; type="application/json", <https://wiredss.ae/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ffa.vhl.mybluehost.me
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:57 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ffa.vhl.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ffa.vhl.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ffa.vhl.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.projectweekley.com
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://projectweekley.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · pxq.lnl.mybluehost.me
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:52:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Mummy and Us — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Mummy and Us — Coming Soon</title> <script src="https://pxq.lnl.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://pxq.lnl.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://pxq.lnl.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · naturnorge.online
2024-09-16 08:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: NaturNorge Online — Coming Soon <!DOCTYPE html> <html lang="nb-NO"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>NaturNorge Online — Coming Soon</title> <script src="https://naturnorge.online/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://naturnorge.online/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://naturnorge.online/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · centralvalleyliftpros.com
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:47:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://centralvalleyliftpros.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:47:01 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ramenmom.com
2024-09-16 08:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:48 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.ramenmom.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.julietafumberg.com
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.julietafumberg.com/wp-json/>; rel="https://api.w.org/", <https://www.julietafumberg.com/wp-json/wp/v2/pages/6400>; rel="alternate"; title="JSON"; type="application/json", <https://www.julietafumberg.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:46:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · intgtech.com
2024-09-16 08:46
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:46:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:51:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Integrated Technology, LLC — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Integrated Technology, LLC — Coming Soon</title> <script src="https://intgtech.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://intgtech.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://intgtech.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tcbuilderli.com
2024-09-16 08:46
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:46:23 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://tcbuilderli.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thesilvergym.booktipper.com
2024-09-16 08:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:45:51 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 08:45:54 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://thesilvergym.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:50:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tlk.rfl.mybluehost.me
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:23 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://geogroupcorrections.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://geogroupcorrections.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://geogroupcorrections.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.centralvalleyliftpros.com
2024-09-16 08:45
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:45:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://centralvalleyliftpros.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:45:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.britishseabuckthorn.com
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:42 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 58989 Last-Modified: Mon, 16 Sep 2024 01:32:04 GMT Accept-Ranges: bytes Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:49:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: Home - The British Sea Buckthorn Company <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <link rel="profile" href="http://gmpg.org/xfn/11"> <title>Home - The British Sea Buckthorn Company</title> <!-- All in One SEO 4.7.1.1 - aioseo.com --> <meta name="description" content="The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer." /> <meta name="robots" content="max-image-preview:large" /> <link rel="canonical" href="https://www.britishseabuckthorn.com/" /> <meta name="generator" content="All in One SEO (AIOSEO) 4.7.1.1" /> <meta property="og:locale" content="en_US" /> <meta property="og:site_name" content="The British Sea Buckthorn Company -" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Home - The British Sea Buckthorn Company" /> <meta property="og:description" content="The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer." /> <meta property="og:url" content="https://www.britishseabuckthorn.com/" /> <meta property="og:image" content="https://www.britishseabuckthorn.com/wp-content/uploads/2022/02/BSC-LOGO-1.png" /> <meta property="og:image:secure_url" content="https://www.britishseabuckthorn.com/wp-content/uploads/2022/02/BSC-LOGO-1.png" /> <meta name="twitter:card" content="summary" /> <meta name="twitter:title" content="Home - The British Sea Buckthorn Company" /> <meta name="twitter:description" content="The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer." /> <meta name="twitter:image" content="https://www.britishseabuckthorn.com/wp-content/uploads/2022/02/BSC-LOGO-1.png" /> <script type="application/ld+json" class="aioseo-schema"> {"@context":"https:\/\/schema.org","@graph":[{"@type":"BreadcrumbList","@id":"https:\/\/www.britishseabuckthorn.com\/#breadcrumblist","itemListElement":[{"@type":"ListItem","@id":"https:\/\/www.britishseabuckthorn.com\/#listItem","position":1,"name":"Home"}]},{"@type":"Organization","@id":"https:\/\/www.britishseabuckthorn.com\/#organization","name":"The British Sea Buckthorn Company","url":"https:\/\/www.britishseabuckthorn.com\/","logo":{"@type":"ImageObject","url":"https:\/\/www.britishseabuckthorn.com\/wp-content\/uploads\/2022\/02\/BSC-LOGO-1.png","@id":"https:\/\/www.britishseabuckthorn.com\/#organizationLogo","width":512,"height":512},"image":{"@id":"https:\/\/www.britishseabuckthorn.com\/#organizationLogo"}},{"@type":"WebPage","@id":"https:\/\/www.britishseabuckthorn.com\/#webpage","url":"https:\/\/www.britishseabuckthorn.com\/","name":"Home - The British Sea Buckthorn Company","description":"The British Sea Buckthorn Company grows sea buckthorn berries on the Essex coast. We work with partners from across the world, we bring you products that will help you to stay healthy for longer.","inLanguage":"en-US","isPartOf":{"@id":"https:\/\/www.britishseabuckthorn.com\/#website"},"breadcrumb":{"@id":"https:\/\/www.britishseabuckthorn.com\/#breadcrumblist"},"datePublished":"2017-03-23T13:24:27+00:00","dateModified":"2024-07-31T11:37:33+00:00"},{"@type":"WebSite","@id":"https:\/\/www.britishseabuckthorn.com\/#website","url":"https:\/\/www.britishseabuckthorn.com\/","name":"The British Sea Buckthorn Company","inLanguage":"en-US","publisher":{"@id":"https:\/\/www.britishseabuckthorn.com\/#organization"},"potentialAction":{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https:\/\/www.britishseabuckthorn.com\/?s={search_term_string}"},"query-input":"required name=search_term_string"}}]} </script> <!-- All in One SEO --> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link relFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · staging2020.stowetrails.org
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://staging2020.stowetrails.org/wp-json/>; rel="https://api.w.org/", <https://wp.me/P9PVhx-1H>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ljs.hzh.mybluehost.me
2024-09-16 08:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:44:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://roamtobreathe.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.oor.ylh.mybluehost.me
2024-09-16 08:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://coachthomastech.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jehidalgorealestate.com
2024-09-16 08:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jehidalgorealestate.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: __wpdm_client=5cf80d8f52872dc56040dbc0836d763f; path=/; secure; HttpOnly
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · forensicsupervisorsuccess.forensicpocketguide.com
2024-09-16 08:43
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:44:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://forensicsupervisorsuccess.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:44:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rbgbank.com
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:48:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://box5315.temp.domains/~rbgbankc/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5315.temp.domains/~rbgbankc/wp-content/plugins/mojo-marketplace-wp-plugin/assets/styles/coming-soon.css?v=3.2.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> Is this your website? Log in to <a href="https://box5315.temp.domains/~rbgbankc/wp-login.php">WordPress</a> or <a href="https://www.mojomarketplace.com/login" target="_blank" rel="noopener noreferrer nofollow">MOJO</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.alvinwayneweiss.com
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:29 GMT Server: Apache Link: <https://www.alvinwayneweiss.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.mcp.haf.mybluehost.me
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:27 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 127686 Last-Modified: Sat, 14 Sep 2024 01:11:58 GMT Accept-Ranges: bytes Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: thinAiR Consulting - At thinAiR, we're not just a full-stack software development company. We specialize in crafting cutting-edge artificial intelligence solutions, immersive augmented and virtual reality experiences, and intuitive mobile apps. Our solutions are tailored to transform businesses, boost operational efficiency, and create engaging customer experiences. Let us bring your vision to life from thinAiR. <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <meta name="description" content="At thinAiR, we're not just a full-stack software development company. We specialize in crafting cutting-edge artificial intelligence solutions, immersive augmented and virtual reality experiences, and intuitive mobile apps. Our solutions are tailored to transform businesses, boost operational efficiency, and create engaging customer experiences. Let us bring your vision to life from thinAiR." /> <link rel="canonical" href="http://mcp.haf.mybluehost.me/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="thinAiR Consulting" /> <meta property="og:description" content="At thinAiR, we're not just a full-stack software development company. We specialize in crafting cutting-edge artificial intelligence solutions, immersive augmented and virtual reality experiences, and intuitive mobile apps. Our solutions are tailored to transform businesses, boost operational efficiency, and create engaging customer experiences. Let us bring your vision to life from thinAiR." /> <meta property="og:url" content="http://mcp.haf.mybluehost.me/" /> <meta property="og:site_name" content="thinAiR Consulting" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"CollectionPage","@id":"http://mcp.haf.mybluehost.me/","url":"http://mcp.haf.mybluehost.me/","name":"thinAiR Consulting - At thinAiR, we're not just a full-stack software development company. We specialize in crafting cutting-edge artificial intelligence solutions, immersive augmented and virtual reality experiences, and intuitive mobile apps. Our solutions are tailored to transform businesses, boost operational efficiency, and create engaging customer experiences. Let us bring your vision to life from thinAiR.","isPartOf":{"@id":"http://mcp.haf.mybluehost.me/#website"},"description":"At thinAiR, we're not just a full-stack software development company. We specialize in crafting cutting-edge artificial intelligence solutions, immersive augmented and virtual reality experiences, and intuitive mobile apps. Our solutions are tailored to transform businesses, boost operational efficiency, and create engaging customer experiences. Let us bring your vision to life from thinAiR.","breadcrumb":{"@id":"http://mcp.haf.mybluehost.me/#breadcrumb"},"inLanguage":"en-US"},{"@type":"BreadcrumbList","@id":"http://mcp.haf.mybluehost.me/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"http://mcp.haf.mybluehost.me/#website","url":"http://mcp.haf.mybluehost.me/","name":"thinAiR Consulting","description":"At thinAiR, we're not just a full-stack software development company. We specialize in crafting cutting-edge artificial intelligence solutions, immersive augmented and virtual reality experiences, and intuitive mobile apps. Our solutions are tailored to transform businesses, boost operational efficiency, and create engaging customer experiences. Let us bring your vision to life from thinAiR.","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"http://mcp.haf.mybluehost.me/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <title>thinAiR Consulting - At thinAiR, we're not just a full-stack software development company. We specialize in crafting cutting-edge artificial intelligence solutions, immersive augmented and virtual reality experiences, and intuitive mobile apps. Our solutions are tailored to transfoFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · choicesolutions.services
2024-09-16 08:43
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:43:17 GMT Server: Apache Link: <https://choicesolutions.services/wp-json/>; rel="https://api.w.org/", <https://choicesolutions.services/wp-json/wp/v2/pages/12>; rel="alternate"; title="JSON"; type="application/json", <https://choicesolutions.services/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:43:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.stowetrails.stowe-trails.com
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:42:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ottawallpaper.com
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:42 GMT Server: Apache Link: <https://www.ottawallpaper.com/wp-json/>; rel="https://api.w.org/", <https://www.ottawallpaper.com/wp-json/wp/v2/pages/14361>; rel="alternate"; title="JSON"; type="application/json", <https://www.ottawallpaper.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · soil-engineering.com
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://soil-engineering.com/wp-json/>; rel="https://api.w.org/", <https://soil-engineering.com/wp-json/wp/v2/pages/9>; rel="alternate"; title="JSON"; type="application/json", <https://soil-engineering.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:47:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · canada-shogi.com
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://canada-shogi.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/a8hho>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.whooi.com
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:39 GMT Server: Apache X-LiteSpeed-Tag: ee5_HTTP.200,ee5_HTTP.301 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.whooi.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:42:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.dgm.lnr.mybluehost.me
2024-09-16 08:42
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:42:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:42:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://liaholden.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://liaholden.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://liaholden.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-ef326f66.nqf.egd.mybluehost.me
2024-09-16 08:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:42:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://texassigningservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:42:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · supermartt.xlr.kdb.mybluehost.me
2024-09-16 08:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:41:51 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.supermartt.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:41:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · zut.ilc.mybluehost.me
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:47 GMT Server: Apache Link: <https://www.smallworldfamily.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yeseveryoneeats.com
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://yeseveryoneeats.com/wp-json/>; rel="https://api.w.org/", <https://yeseveryoneeats.com/wp-json/wp/v2/pages/6>; rel="alternate"; title="JSON"; type="application/json", <https://yeseveryoneeats.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:41:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.childrensfrenchbookcorner.com
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:34 GMT Server: Apache Link: <https://www.childrensfrenchbookcorner.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.childrensfrenchbookcorner.com
2024-09-16 08:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:41:34 GMT Server: Apache Link: <https://www.childrensfrenchbookcorner.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ericaellis.co
2024-09-16 08:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:40:55 GMT Server: Apache X-Pingback: https://www.ericaellis.co/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.ericaellis.co/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.gtg.cun.mybluehost.me
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://nilsencorp.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nilsencorp.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nilsencorp.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.centenarynow.com
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://centenarynow.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/bQIfh>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · visionzpsis.com
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://visionzpsis.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://visionzpsis.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://visionzpsis.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.hairsolutions12.duyanebeauty.com
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 08:40:37 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked Page title: hair Solutions — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>hair Solutions — Coming Soon</title> <script src="https://hairsolutions12.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hairsolutions12.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hairsolutions12.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yiy.rfl.mybluehost.me
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:33 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 6940 Last-Modified: Fri, 22 Jan 2021 22:38:07 GMT Accept-Ranges: bytes Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Page title: Home | MarkSolomon.net <!DOCTYPE html> <html lang="en"> <head> <!-- Required meta tags always come first --> <meta charset="utf-8"> <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no"> <meta http-equiv="x-ua-compatible" content="ie=edge"> <!-- Head content such as meta tags and encoding options, etc --> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <meta name="author" content="Joel Solomon" /> <meta name="title" content="Mark Solomon.net: editor, consultant, and teacher" /> <meta name="keywords" content="editor, consultant, MarkSolomon, Mark Solomon, marksolomon, mark solomon, Frankenweenie, Chicken Run, Sgt Stubby" /> <meta name="description" content="Mark Solomon Portfolio: editor, consultant, teacher" /> <meta name="robots" content="index, follow" /> <!-- User defined head content --> <!-- Browser title --> <title>Home | MarkSolomon.net</title> <!-- Main Theme Stylesheet --> <link rel="stylesheet" type="text/css" media="all" href="rw_common/themes/Foundry/consolidated.css?rwcache=633047859" /> <!-- RapidWeaver Color Picker Stylesheet --> <!-- Plugin injected code --> <link rel='stylesheet' type='text/css' media='all' href='rw_common/plugins/stacks/stacks.css?rwcache=633047859' /> <link rel='stylesheet' type='text/css' media='all' href='files/stacks_page_page5.css?rwcache=633047859' /> <script type='text/javascript' charset='utf-8' src='rw_common/plugins/stacks/jquery-2.2.4.min.js?rwcache=633047859'></script> <link rel="stylesheet" href="rw_common/plugins/stacks/font-awesome.min.css?rwcache=633047859"> <script type='text/javascript' charset='utf-8' src='files/stacks_page_page5.js?rwcache=633047859'></script> <meta name="formatter" content="Stacks v4.1.4 (5385)" > <meta class="stacks4 stack version" id="com.elixir.stacks.foundry" name="Foundry" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.yuzoolthemes.stacks.navigation" name="Navigation" content="1.3.9"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryBanner" name="Banner" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryHeader" name="Header" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryContainer" name="Container" content="1.3.4.4"> </head> <body class="antialiased"> <div class="blur_wrapper"> <div id='stacks_out_1' class='stacks_top'><div id='stacks_in_1' class=''><div id='stacks_out_20' class='stacks_out'><div id='stacks_in_20' class='stacks_in com_elixir_stacks_foundry_stack'> <!-- Foundry --> </div></div><div id='stacks_out_21' class='stacks_out'><div id='stacks_in_21' class='stacks_in com_yuzoolthemes_stacks_navigation_stack'> <!-- GFL --> <script src="https://ajax.googleapis.com/ajax/libs/webfont/1.6.16/webfont.js"></script> <script> WebFont.load({ google: { families: ['Oswald', 'Open Sans','Ubuntu','Roboto','Oxygen','Orbitron'] } }); </script> <!-- /GFL --> <!-- MENU HTML --> <div id="stacks_in_21" class="fixed"> <div id="fnav" class="fnav"> <div id="max-width-nav"> <ul><li class="Selected"><a href="./" rel="" class="nav_item nav_active">Home</a></li><li><a href="page-3/" rel="" class="nav_item">Editor</a></li><li><a href="page/" rel="" class="nav_item">Consultant</a></li><li><a href="page-2/" rel="" class="nav_item">Teacher</a></li><li><a href="page-4/" rel="" class="nav_item">About Me</a></li></ul> </div> </div> </div> <!-- /MENU HTML --> </div></div><div id='stacks_out_5' class='stacks_out'><div id='stacks_in_5' class='stacks_in com_elixir_stacks_foundryBanner_stack'> <div class="nav_pairing"> <div class="banner"> <div class="banner_inner"> <div class="banner_content"> <div class="container-fluid"> <div id='stacks_out_35' class='stacks_out'><div id='stacks_in_35' class='stacks_in image_stack'> <div class='centered_image' > <img class='imageStyle' src='files/stacks-image-ba7cd42.png' alt='Stacks Image 36' /> <Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cotapult.wewalkwithyou.com
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:45:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Cotapult Pte Ltd — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Cotapult Pte Ltd — Coming Soon</title> <script src="https://cotapult.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cotapult.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cotapult.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-32b76e56.ccl-us.org
2024-09-16 08:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:40:20 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://website-32b76e56.ccl-us.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.neverhadaboss.com
2024-09-16 08:40
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:40:10 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://neverhadaboss.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mlu.koc.mybluehost.me
2024-09-16 08:40
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:40:03 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://fitsumberhe.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://fitsumberhe.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; title="JSON"; type="application/json", <https://fitsumberhe.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:40:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.uuq.xxm.mybluehost.me
2024-09-16 08:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:39:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://uuq.xxm.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:39:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ett.nce.mybluehost.me
2024-09-16 08:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:38:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ett.nce.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ett.nce.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ett.nce.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · everydayisfrench.com
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.everydayisfrench.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:43:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.wwr.rbb.mybluehost.me
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wwr.rbb.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.frkextruder.com
2024-09-16 08:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:38:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://frkextruder.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:38:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · toharborlife.com
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://toharborlife.com/wp-json/>; rel="https://api.w.org/", <https://toharborlife.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://toharborlife.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.partnersdigitalmarketing.com
2024-09-16 08:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:37:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.partnersdigitalmarketing.com/wp-json/>; rel="https://api.w.org/", <https://www.partnersdigitalmarketing.com/wp-json/wp/v2/pages/34>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/P8ZgEF-y>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.theobriencollective.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 09:37:30 GMT Cache-Control: max-age=3600 X-Redirect-By: redirection Location: https://nzscratchmaps.co.nz/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.projectweekley.com
2024-09-16 08:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:37:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://projectweekley.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:37:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.stowemountainbike.stowe-trails.com
2024-09-16 08:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:36:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bravoheatingcooling.com
2024-09-16 08:36
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:36:55 GMT Server: Apache Link: <https://www.bravoheatingcooling.com/wp-json/>; rel="https://api.w.org/", <https://www.bravoheatingcooling.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://www.bravoheatingcooling.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dwg.sro.mybluehost.me
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://osbornevillage.church/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.sizzlesalsyoutube.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sizzlesalsyoutube.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.fortressbilliards.iib.jso.mybluehost.me
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fortressbilliards.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:41:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.juniorscourt.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://juniorscourt.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 16:36:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · martinispickleball.com
2024-09-16 08:36
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:36:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://martinispickleball.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:36:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.efsmi.com
2024-09-16 08:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://efsmi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mygeotokens.mindyourown.life
2024-09-16 08:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:35:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 09:35:04 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://mygeotokens.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mobiushome.com
2024-09-16 08:34
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:34:34 GMT Server: Apache Expires: Mon, 16 Sep 2024 09:34:36 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://mobiushome.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.stamenandpistilpt.com
2024-09-16 08:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:34:26 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://stamenandpistilpt.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://stamenandpistilpt.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://stamenandpistilpt.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.xwk.lnl.mybluehost.me
2024-09-16 08:33
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:33:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html> <head> <meta name="viewport" content="width=device-width"> <title>Welcome — Coming Soon</title> <script src="https://aeroventuresusa.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url( "https://aeroventuresusa.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/cs-bluehost-bg.jpg" ); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom:0; left:0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16px; font-size: 11px; top: 2px; } .bh_subscription_widget form .bh-inputs.email input[type="email"] { background-color: #fff; background-image: url( "https://aeroventuresusa.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/icon-email.svg" ); background-position: 10px center; background-repeat: no-repeat; border: 1px solid #5B5B5B; border-radius: 3px; color: #5B5B5B; font-size: 11px; margin-right: 6px; min-width: 300px; padding: 14px 15px 14px 45pFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · waterpurifierrental-com.sunmulgift.com
2024-09-16 08:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:33:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://waterpurifierrental.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:33:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ozwineinternational.com
2024-09-16 08:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:33:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ozwineinternational.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=en; expires=Tue, 16 Sep 2025 08:33:52 GMT; Max-Age=31536000; path=/; secure; SameSite=Lax
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.blueboxsoftware.net
2024-09-16 08:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:33:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://blueboxsoftware.net/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:38:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.irbf.co.uk
2024-09-16 08:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:31:40 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://irbf.co.uk/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mustbeoman.alshidi.com
2024-09-16 08:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:31:30 GMT Server: Apache Link: <https://mustbeoman.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://mustbeoman.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://mustbeoman.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · sandiparkhurst.com
2024-09-16 08:30
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:30:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sandiparkhurst.com/wp-json/>; rel="https://api.w.org/", <https://sandiparkhurst.com/wp-json/wp/v2/pages/7>; rel="alternate"; title="JSON"; type="application/json", <https://sandiparkhurst.com/>; rel=shortlink Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 16:30:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.socialjones.com
2024-09-16 08:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:30:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.socialjones.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:30:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · way.tdd.mybluehost.me
2024-09-16 08:30
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:30:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fieldrosaries.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:30:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.yxo.gqj.mybluehost.me
2024-09-16 08:29
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:29:49 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:29:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Forever To Keep Photography — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Forever To Keep Photography — Coming Soon</title> <script src="https://forevertokeepphoto.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://forevertokeepphoto.com/wp-content/plugins/bluehost-wordpress-plugin/static/coming-soon.css?v=2.12.20" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>A New WordPress Site!</h1> <h2>Coming Soon!</h2> <a class="btn" href="https://forevertokeepphoto.com/wp-login.php"> Admin Login </a> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com/wordpress" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://forevertokeepphoto.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · alicexinliu.com
2024-09-16 08:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:29:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.alicexinliu.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:34:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.healthy-queen.com
2024-09-16 08:29
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:29:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://healthy-queen.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:29:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.loapioneers.com
2024-09-16 08:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:28:49 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.loapioneers.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.airlinehotelcreditcards.com
2024-09-16 08:28
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:28:18 GMT Server: Apache Link: <https://www.airlinehotelcreditcards.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.australiatozimbabwe.com
2024-09-16 08:28
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:28:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://australiatozimbabwe.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ybk.goc.mybluehost.me
2024-09-16 08:27
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:28:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://townofkelfordnc.gov/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:28:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.thinkdigitalmatter.com
2024-09-16 08:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:25:18 GMT Server: Apache Link: <https://www.thinkdigitalmatter.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.thinkdigitalmatter.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.thinkdigitalmatter.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: DigitalMatter LLC – the structure and properties of matter <!DOCTYPE html> <html lang="en-US" class="no-js"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <link rel="profile" href="https://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.thinkdigitalmatter.com/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.thinkdigitalmatter.com/wp-content/themes/twentyfifteen/js/html5.js?ver=3.7.0"></script> <![endif]--> <script>(function(html){html.className = html.className.replace(/\bno-js\b/,'js')})(document.documentElement);</script> <title>DigitalMatter LLC – the structure and properties of matter</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link href='https://fonts.gstatic.com' crossorigin rel='preconnect' /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Feed" href="https://www.thinkdigitalmatter.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="DigitalMatter LLC » Comments Feed" href="https://www.thinkdigitalmatter.com/?feed=comments-rss2" /> <script> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.thinkdigitalmatter.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.lazygeniusmom.com
2024-09-16 08:25
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:25:08 GMT Server: Apache Vary: accept,content-type,accept-encoding,cookie Link: <https://www.lazygeniusmom.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/7BOiN>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · yrh.nmb.mybluehost.me
2024-09-16 08:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:24:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://samicherkaouipublishings.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:24:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ibfafoundation.com
2024-09-16 08:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:22:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ibfafoundation.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://ibfafoundation.com/index.php?rest_route=/wp/v2/pages/23>; rel="alternate"; title="JSON"; type="application/json", <https://ibfafoundation.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:22:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · henryjoseph.spokespersonagency.com
2024-09-16 08:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:22:37 GMT Server: Apache Link: <https://henryjoseph.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · nrk.hsk.mybluehost.me
2024-09-16 08:22
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:22:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://classwings.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:22:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.theressomuchgood.com
2024-09-16 08:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:21:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://theressomuchgood.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:26:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.formydiet.com
2024-09-16 08:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:21:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.formydiet.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:21:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jtt.okl.mybluehost.me
2024-09-16 08:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:20:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:20:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: MotherhoodLaborandLove — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>MotherhoodLaborandLove — Coming Soon</title> <script src="https://motherhoodlaborandlove.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://motherhoodlaborandlove.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://motherhoodlaborandlove.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ibfafoundation.com
2024-09-16 08:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:20:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ibfafoundation.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:19:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · bkt.tvd.mybluehost.me
2024-09-16 08:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:20:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://magnolianae.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:19:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hkr.vcj.mybluehost.me
2024-09-16 08:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:19:23 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://preachfromthehousetops.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:24:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.spleelogistics.com
2024-09-16 08:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:19:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://spleelogistics.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.efectoresponsable-pe.karlosperu.com
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://efectoresponsable.pe/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.jaycrouch.com
2024-09-16 08:18
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:18:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jaycrouch.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-fde254bc.harmonywithtruenature.com
2024-09-16 08:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:17:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inspireintegrativehealth.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:17:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · xwk.lnl.mybluehost.me
2024-09-16 08:17
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:17:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html> <head> <meta name="viewport" content="width=device-width"> <title>Welcome — Coming Soon</title> <script src="https://aeroventuresusa.com/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url( "https://aeroventuresusa.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/cs-bluehost-bg.jpg" ); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom:0; left:0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16px; font-size: 11px; top: 2px; } .bh_subscription_widget form .bh-inputs.email input[type="email"] { background-color: #fff; background-image: url( "https://aeroventuresusa.com/wp-content/plugins/mojo-marketplace-wp-plugin/images/icon-email.svg" ); background-position: 10px center; background-repeat: no-repeat; border: 1px solid #5B5B5B; border-radius: 3px; color: #5B5B5B; font-size: 11px; margin-right: 6px; min-width: 300px; padding: 14px 15px 14px 45pFound 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lfn.uel.mybluehost.me
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:16:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kevinflynnmusic.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kevinflynnmusic.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kevinflynnmusic.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.icm.ano.mybluehost.me
2024-09-16 08:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:16:26 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://icm.ano.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:16:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kkn.jpm.mybluehost.me
2024-09-16 08:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:16:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.kkn.jpm.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://wp.me/264Vc>; rel=shortlink Strict-Transport-Security: max-age=63072000; includeSubDomains; preload X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Referrer-Policy: no-referrer-when-downgrade Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:21:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.littleocean.dynamicsmachines.com
2024-09-16 08:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:15:32 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://littleocean.dynamicsmachines.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · earthlycleaning.com
2024-09-16 08:14
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:14:58 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Earthly Cleaning — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Earthly Cleaning — Coming Soon</title> <script src="https://earthlycleaning.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://earthlycleaning.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://earthlycleaning.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kkn.jpm.mybluehost.me
2024-09-16 08:14
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:14:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://mail.kkn.jpm.mybluehost.me/wp-json/>; rel="https://api.w.org/", <https://wp.me/264Vc>; rel=shortlink Strict-Transport-Security: max-age=63072000; includeSubDomains; preload X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Referrer-Policy: no-referrer-when-downgrade Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:19:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.offer.partnersdigitalmarketing.com
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://offer.partnersdigitalmarketing.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · zba.mvv.mybluehost.me
2024-09-16 08:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:14:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://heartsforschools.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.a2hdesignstudio.ca
2024-09-16 08:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:13:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://a2hdesignstudio.ca/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cine4m.com
2024-09-16 08:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:13:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.cine4m.com/wp-json/>; rel="https://api.w.org/", <https://www.cine4m.com/wp-json/wp/v2/pages/3802>; rel="alternate"; title="JSON"; type="application/json", <https://www.cine4m.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:13:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wiq.jru.mybluehost.me
2024-09-16 08:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:12:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://wiq.jru.mybluehost.me/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:12:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Connection: close Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · crefemme.com
2024-09-16 08:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:12:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://crefemme.com/wp-json/>; rel="https://api.w.org/", <https://crefemme.com/wp-json/wp/v2/pages/28>; rel="alternate"; title="JSON"; type="application/json", <https://crefemme.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:12:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.daphneybongo.com
2024-09-16 08:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:12:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://daphneybongo.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:17:24 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dhc.tvd.mybluehost.me
2024-09-16 08:11
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ofa.ano.mybluehost.me
2024-09-16 08:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:11:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dominicmattioli.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:11:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ottawallpaper.com
2024-09-16 08:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:10:56 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.ottawallpaper.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.intgtech.com
2024-09-16 08:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:10:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://intgtech.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:15:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.vbp.pmc.mybluehost.me
2024-09-16 08:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:10:03 GMT Server: Apache X-Pingback: https://www.revpatriciahart.net/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.revpatriciahart.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.avaoliviaunlimited.com
2024-09-16 08:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:09:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://avaoliviaunlimited.com/ Cache-Control: max-age=14400 Expires: Mon, 16 Sep 2024 12:09:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.grettabevis.com
2024-09-16 08:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:09:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://grettabevis.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:09:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ofo.hzw.mybluehost.me
2024-09-16 08:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:09:12 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:09:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ofo.hzw.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ofo.hzw.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ofo.hzw.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.knv.wyd.mybluehost.me
2024-09-16 08:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:09:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://em-art-d.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:09:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.changeskills.com
2024-09-16 08:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:08:43 GMT Server: Apache X-Cache-Enabled: True X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://changeskills.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:13:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tcbuilderli.com
2024-09-16 08:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:08:04 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Thomas Construction — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Thomas Construction — Coming Soon</title> <script src="https://tcbuilderli.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tcbuilderli.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tcbuilderli.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · znu.sgg.mybluehost.me
2024-09-16 08:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:07:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://metstudies.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:07:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · weleadglobal.com
2024-09-16 08:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:07:06 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Pingback: https://weleadglobal.com/xmlrpc.php Link: <https://weleadglobal.com/wp-json/>; rel="https://api.w.org/", <https://weleadglobal.com/>; rel=shortlink Set-Cookie: PHPSESSID=552ee1ba3c1c0e83281dd0e6648b2f16; path=/ Set-Cookie: pmpro_visit=1; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-5fd726fe.geckographix.ca
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: ozeim.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>ozeim.com — Coming Soon</title> <script src="https://ozeim.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ozeim.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ozeim.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qbj.swq.mybluehost.me
2024-09-16 08:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:06:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://precisionpropertymiami.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:06:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.pigarispa.com
2024-09-16 08:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:05:46 GMT Server: Apache Expires: Mon, 16 Sep 2024 09:05:49 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://pigarispa.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 17 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.islandaircontrol.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:42 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.islandaircontrol.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.sharingmyvanlife.com
2024-09-16 08:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:04:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://sharingmyvanlife.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:04:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bader.im
2024-09-16 08:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:03:49 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://bader.im/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · shrmehdi.com
2024-09-16 08:01
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 08:01:40 GMT Server: Apache Vary: accept,content-type,Accept-Encoding X-Cache-Enabled: True Link: <https://shrmehdi.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/9v86n>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 08:06:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.uxn.hgs.mybluehost.me
2024-09-16 08:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:00:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jessejthompsonlaw.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:00:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.inspireintegrativehealth.com
2024-09-16 08:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 08:00:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inspireintegrativehealth.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 10:00:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.pcproblems.com
2024-09-16 07:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:59:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie Pragma: no-cache Expires: Mon, 16 Sep 2024 08:59:29 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://www.pcproblems.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=b97e484d2599564f0e02d93ac2d26ef3; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · andyrobinetmusic.androidrobotproductions.com
2024-09-16 07:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:58:54 GMT Server: Apache Link: <https://andyrobinetguitar.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.onsitefabricarecleaning.com
2024-09-16 07:58
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:58:36 GMT Server: Apache Vary: Accept-Encoding,Cookie Cache-Control: max-age=3, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.balancebusinesssolution.net
2024-09-16 07:47
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:47:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:47:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Find Your Balance Business Solutions Ltd. — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Find Your Balance Business Solutions Ltd. — Coming Soon</title> <script src="https://balancebusinesssolution.net/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://balancebusinesssolution.net/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://balancebusinesssolution.net/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yorktownday.com
2024-09-16 07:45
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:45:34 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://yorktownday.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:45:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · sunpring.sunpringextruder.com
2024-09-16 07:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:44:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Mon, 16 Sep 2024 08:44:39 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://sunpring.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mql.ghe.mybluehost.me
2024-09-16 07:44
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:44:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:44:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://kudenservice200.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://kudenservice200.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://kudenservice200.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.corpopack.com
2024-09-16 07:44
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:44:10 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://corpopack.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.uprcwichita.com
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:43:00 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://uprcwichita.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:43:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.llk.kum.mybluehost.me
2024-09-16 07:42
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:42:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://smccapitalgrp.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:42:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · savelamu.org
2024-09-16 07:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:41:59 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 <html> <head> <meta name="robots" content="noarchive" /> <meta name="googlebot" content="nosnippet" /> </head> <body> <div align=center> <h3>Error. Page cannot be displayed. Please contact your service provider for more details. (6)</h3> <!--- 162.241.226.40---> </div> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · 888lockuup.com
2024-09-16 07:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:41:59 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.888lockuup.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bfftestprep.com
2024-09-16 07:41
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:41:37 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://bfftestprep.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · etherealbeauty.blog
2024-09-16 07:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:41:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:41:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title> — Coming Soon</title> <script src="https://etherealbeauty.blog/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://etherealbeauty.blog/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://etherealbeauty.blog/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-0736747f.umh.sgg.mybluehost.me
2024-09-16 07:41
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:41:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:41:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: www.reaunique.org — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>www.reaunique.org — Coming Soon</title> <script src="https://website-0736747f.umh.sgg.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://website-0736747f.umh.sgg.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://website-0736747f.umh.sgg.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-5fb62e2d.szw.tui.mybluehost.me
2024-09-16 07:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:39:53 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:39:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: QATV — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>QATV — Coming Soon</title> <script src="https://szw.tui.mybluehost.me/website_5fb62e2d/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://szw.tui.mybluehost.me/website_5fb62e2d/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://szw.tui.mybluehost.me/website_5fb62e2d/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · stowetrails.com
2024-09-16 07:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:39:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stowetrails.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:39:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ludkaslanguagelounge.com
2024-09-16 07:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:39:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://ludkaslanguagelounge.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:39:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cotapult.com
2024-09-16 07:39
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:39:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:44:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Cotapult Pte Ltd — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Cotapult Pte Ltd — Coming Soon</title> <script src="https://cotapult.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://cotapult.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://cotapult.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · avisofitness.booktipper.com
2024-09-16 07:39
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:39:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://avisofitness.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:39:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · theplayfulminds.com
2024-09-16 07:38
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:38:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 237 Location: https://theplayfulminds.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://theplayfulminds.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · zdk.sco.mybluehost.me
2024-09-16 07:38
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:38:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://inkfurie.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:38:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.zentaingenieria.com
2024-09-16 07:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:38:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:38:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://zentaingenieria.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://zentaingenieria.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://zentaingenieria.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · animefreesite.com
2024-09-16 07:38
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:38:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://animefreesite.com/wp-json/>; rel="https://api.w.org/", <https://animefreesite.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://animefreesite.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:38:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jcmagazine.karlosperu.com
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://jcmagazine.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.website-7a584425.partnersdigitalmarketing.com
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.akn907.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yanbenotmane.com
2024-09-16 07:37
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:37:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:37:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://yanbenotmane.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://yanbenotmane.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://yanbenotmane.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.oxal.co.uk
2024-09-16 07:37
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:37:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://oxal.co.uk/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:42:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.hdi.bqv.mybluehost.me
2024-09-16 07:36
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:36:56 GMT Server: Apache Location: https://mail.hdi.bqv.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 244 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.hdi.bqv.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.omaafricancuisine.com
2024-09-16 07:35
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:35:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.omaafricancuisine.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.omaafricancuisine.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.friendsofhorseshoebendanimals.com
2024-09-16 07:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:35:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Pingback: https://friendsofhorseshoebendanimals.com/xmlrpc.php X-Redirect-By: WordPress Location: https://friendsofhorseshoebendanimals.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=10ed362415de5dfbc93009f7e4b911a3; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.urbanheropoodles.com
2024-09-16 07:35
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:35:23 GMT Server: Apache X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Location: https://urbanheropoodles.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:35:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== content-Security-Policy: upgrade-insecure-requests X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.dbh.csv.mybluehost.me
2024-09-16 07:35
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:35:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:35:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 07:35:13 GMT; Max-Age=315360000; path=/ Set-Cookie: wcpay_currency=USD_1; expires=Mon, 16 Sep 2024 08:35:15 GMT; Max-Age=3600; path=/ Transfer-Encoding: chunked Page title: Prestige Luxury Transportation — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Prestige Luxury Transportation — Coming Soon</title> <script src="https://prestigeluxurytransportationfl.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://prestigeluxurytransportationfl.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://prestigeluxurytransportationfl.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · irbf.co.uk
2024-09-16 07:34
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:34:55 GMT Server: Apache Link: <https://irbf.co.uk/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · tablierbleu.com
2024-09-16 07:33
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:33:20 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · trustcaptain-co-uk.zbo.pfi.mybluehost.me
2024-09-16 07:33
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:33:13 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://trustcaptain.co.uk/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:33:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · nqf.egd.mybluehost.me
2024-09-16 07:32
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:32:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:32:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://nqf.egd.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nqf.egd.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nqf.egd.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.usi.jso.mybluehost.me
2024-09-16 07:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:31:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:36:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://usi.jso.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://usi.jso.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://usi.jso.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.visionzpsis.com
2024-09-16 07:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:31:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://visionzpsis.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:31:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.rofaendurance.com
2024-09-16 07:31
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:31:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Location: https://rofaendurance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=9f86041f92a05e3f34314be5ca2a90ce; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-00475774.ane.pzr.mybluehost.me
2024-09-16 07:31
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:31:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:31:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: hmbll — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>hmbll — Coming Soon</title> <script src="https://hmbll.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://hmbll.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://hmbll.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · pureprecise.com
2024-09-16 07:31
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:31:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 233 Location: https://pureprecise.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://pureprecise.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tremarin.co
2024-09-16 07:30
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:30:42 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · zkh.ipd.mybluehost.me
2024-09-16 07:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:29:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: http://zkh.ipd.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://zkh.ipd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.zkh.ipd.mybluehost.me
2024-09-16 07:29
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:29:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.zkh.ipd.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.zkh.ipd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.alwehdaclub.sa
2024-09-16 07:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:26:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://alwehdaclub.sa/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · practicas.zelayasconstruction.com
2024-09-16 07:25
HTTP/1.1 403 Forbidden Date: Mon, 16 Sep 2024 07:25:40 GMT Server: Apache Content-Length: 318 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 403 Forbidden <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>403 Forbidden</title> </head><body> <h1>Forbidden</h1> <p>You don't have permission to access this resource.</p> <p>Additionally, a 403 Forbidden error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ltv.pdu.mybluehost.me
2024-09-16 07:25
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:25:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://honeybeehunnieglobal.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:25:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.qfl.bma.mybluehost.me
2024-09-16 07:24
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:25:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://primeraiglesiaed.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:24:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · website-5fd726fe.geckographix.ca
2024-09-16 07:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:24:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:24:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: ozeim.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>ozeim.com — Coming Soon</title> <script src="http://ozeim.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://ozeim.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ozeim.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · patrickcheatham.com
2024-09-16 07:24
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:24:07 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://patrickcheatham.com/wp-json/>; rel="https://api.w.org/", <https://patrickcheatham.com/wp-json/wp/v2/pages/2>; rel="alternate"; title="JSON"; type="application/json", <https://patrickcheatham.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:24:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.beu.qjv.mybluehost.me
2024-09-16 07:24
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:24:04 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-85dcd0be.pzq.kei.mybluehost.me
2024-09-16 07:23
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.modernaexteriors.com
2024-09-16 07:22
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:22:47 GMT Server: Apache Location: http://www.modernaexteriors.com/cgi-sys/suspendedpage.cgi Content-Length: 241 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.modernaexteriors.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · edn.lef.mybluehost.me
2024-09-16 07:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:22:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://grettabevis.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:22:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cqg.pgm.mybluehost.me
2024-09-16 07:22
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:22:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.altaseadsconservancy.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:22:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kpb.goj.mybluehost.me
2024-09-16 07:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:21:58 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 07:22:04 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://nathaliewallcoaching.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:21:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dnp.tqp.mybluehost.me
2024-09-16 07:21
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:21:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://spicedock.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:21:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · paquettedesign.com
2024-09-16 07:21
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:21:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 236 Location: https://paquettedesign.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://paquettedesign.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · old.foodmarketgypsy.com
2024-09-16 07:21
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ptr.oui.mybluehost.me
2024-09-16 07:20
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:20:16 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:20:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://bengonet.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bengonet.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bengonet.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.lakehillsgs.org
2024-09-16 07:20
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:20:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: https://mail.lakehillsgs.org/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.lakehillsgs.org/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hly.ref.mybluehost.me
2024-09-16 07:19
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:19:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://hly.ref.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://hly.ref.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · nextnewdeal.blog
2024-09-16 07:19
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:19:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 233 Location: http://nextnewdeal.blog/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://nextnewdeal.blog/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sph.zca.mybluehost.me
2024-09-16 07:19
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:19:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hindsightfilms.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:19:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · spurwonder.elisamorse.com
2024-09-16 07:18
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:18:49 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.alcyonespace.com
2024-09-16 07:17
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:17:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alcyonespace.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:17:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · hjk.jdq.mybluehost.me
2024-09-16 07:17
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:17:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: http://hjk.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://hjk.jdq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kplptrust.com
2024-09-16 07:16
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:16:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=2df46d79590be6b24bbc93cca3ac1929; path=/ set-cookie: __cf_bm=vo3fWN7q9Hi9EBQfS1Ow6GL__fKfby5GbUUJK7xAn6k-1726471015-1.0.1.1-e48WWtTHedtZiig_DnaSCnPjIZW7p3N5FWhXi2pvBzzVfCHuIxmt51.iQ5RA3qdTW19RcNqBPDBLzfI67RMJ2j5em2KUX5sEntL3Dw4_l2Y; path=/; expires=Mon, 16-Sep-24 07:46:55 GMT; domain=.clickfunnels.com; HttpOnly; Secure set-cookie: _cfuvid=Bj70nnnA0gKcT4uTKmo1UIj5hxMSJVffvkcAdExZohQ-1726471015311-0.0.1.1-604800000; path=/; domain=.clickfunnels.com; HttpOnly; Secure; SameSite=None Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-ad3eed49.blueandgrayfinancial.com
2024-09-16 07:16
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:16:23 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jeancarlosstudio.jeancarlosartist.com
2024-09-16 07:16
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:16:10 GMT Server: Apache X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.jeancarlosartist.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:21:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Access-Control-Allow-Origin: * Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.qfp.ths.mybluehost.me
2024-09-16 07:16
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.silverfitnessfocus.booktipper.com
2024-09-16 07:15
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:15:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://silverfitnessfocus.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=7a6a19b0b72d572c5537f51656316dbd; path=/ Set-Cookie: nfdbrandname=BlueHost; expires=Thu, 14 Sep 2034 07:15:33 GMT; Max-Age=315360000; path=/
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kxw.oxd.mybluehost.me
2024-09-16 07:14
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:14:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.kxw.oxd.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.kxw.oxd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.blkfairy.com
2024-09-16 07:14
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:14:25 GMT Server: Apache Location: https://mail.blkfairy.com/cgi-sys/suspendedpage.cgi Content-Length: 235 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.blkfairy.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tct.jwp.mybluehost.me
2024-09-16 07:14
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:14:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zachcomputerservices.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:14:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 3 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tks.duj.mybluehost.me
2024-09-16 07:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:13:19 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://willow.ae/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · forensicsupervisorsuccess.com
2024-09-16 07:13
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:13:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://forensicsupervisorsuccess.com/wp-json/>; rel="https://api.w.org/", <https://forensicsupervisorsuccess.com/wp-json/wp/v2/pages/7>; rel="alternate"; title="JSON"; type="application/json", <https://forensicsupervisorsuccess.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ncn.ihj.mybluehost.me
2024-09-16 07:13
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:13:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ncn.ihj.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:13:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · abpdgirlspoetryarchive.com
2024-09-16 07:12
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:13:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://abpdgirlspoetryarchive.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://abpdgirlspoetryarchive.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.vep.oxd.mybluehost.me
2024-09-16 07:12
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:12:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://mail.vep.oxd.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.vep.oxd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · cleangirlglow.com
2024-09-16 07:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:12:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cleangirlglow.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · glamourtradingco.xlr.kdb.mybluehost.me
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:16 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=53a2d0c9cce53af5dbb0b86f707a77b7; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://glamourtradingco.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · smilesforadventure.com
2024-09-16 07:12
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:12:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: http://smilesforadventure.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://smilesforadventure.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.rln.bur.mybluehost.me
2024-09-16 07:12
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:12:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Strict-Transport-Security: max-age=31536000; X-XSS-Protection: 0 X-Content-Type-Options: nosniff Referrer-Policy: strict-origin-when-cross-origin Content-Security-Policy: upgrade-insecure-requests; Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://phoenixdpi.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 0 X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-0fe27fd5.wqb.fgc.mybluehost.me
2024-09-16 07:12
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:12:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://magneticminstrel.net/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:12:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.artaffairs.gallery
2024-09-16 07:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:11:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://artaffairs.gallery/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:16:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · iig.ocl.mybluehost.me
2024-09-16 07:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:11:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wealthywallets.org/ Cache-Control: max-age=0 Expires: Mon, 16 Sep 2024 07:11:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · tajdidsupport.com
2024-09-16 07:11
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:11:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 234 Location: http://tajdidsupport.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://tajdidsupport.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lzw.sco.mybluehost.me
2024-09-16 07:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:11:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:11:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://lzw.sco.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lzw.sco.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lzw.sco.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.rbgbank.com
2024-09-16 07:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:11:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:16:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://box5315.temp.domains/~rbgbankc/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5315.temp.domains/~rbgbankc/wp-content/plugins/mojo-marketplace-wp-plugin/assets/styles/coming-soon.css?v=3.2.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> </div> </main> </div> <footer> <p class="text-center"> Is this your website? Log in to <a href="https://box5315.temp.domains/~rbgbankc/wp-login.php">WordPress</a> or <a href="https://www.mojomarketplace.com/login" target="_blank" rel="noopener noreferrer nofollow">MOJO</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.ehfs.health
2024-09-16 07:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:11:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.julietafumberg.iib.jso.mybluehost.me
2024-09-16 07:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:11:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.julietafumberg.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:11:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.ehfs.health
2024-09-16 07:11
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:11:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ehfs.health/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · agriexotic.com
2024-09-16 07:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:11:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: 20c_HTTP.200 Link: <https://agriexotic.com/wp-json/>; rel="https://api.w.org/", <https://agriexotic.com/wp-json/wp/v2/pages/1239>; rel="alternate"; title="JSON"; type="application/json", <https://agriexotic.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · internationalkenpokobudohakutsuruassociation.com
2024-09-16 07:11
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:11:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://internationalkenpokobudohakutsuruassociation.com/wp-json/>; rel="https://api.w.org/", <https://internationalkenpokobudohakutsuruassociation.com/wp-json/wp/v2/pages/27>; rel="alternate"; title="JSON"; type="application/json", <https://internationalkenpokobudohakutsuruassociation.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:11:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.whi.oxd.mybluehost.me
2024-09-16 07:10
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:10:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://mail.whi.oxd.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.whi.oxd.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · fwv.viq.mybluehost.me
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.wamlblog.net/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:15:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.btw.slw.mybluehost.me
2024-09-16 07:10
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 07:10:51 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Show Bible — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Show Bible — Coming Soon</title> <script src="https://btw.slw.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://btw.slw.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://btw.slw.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · wbm.vvg.mybluehost.me
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.sunmulgift.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.priceprodc.com
2024-09-16 07:10
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://priceprogroup.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://priceprogroup.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://priceprogroup.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ffa.vhl.mybluehost.me
2024-09-16 07:10
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:30 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://ffa.vhl.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ffa.vhl.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ffa.vhl.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.fvb.bof.mybluehost.me
2024-09-16 07:10
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:10:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://fvb.bof.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:10:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.meandmytherapist.com
2024-09-16 07:10
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:10:22 GMT Server: Apache Link: <https://www.meandmytherapist.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/8zm8O>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.solitude310gkr.com
2024-09-16 07:10
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:10:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 241 Location: https://mail.solitude310gkr.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.solitude310gkr.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · doulosapologetics.com
2024-09-16 07:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:09:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://doulosapologetics.com/wp-json/>; rel="https://api.w.org/", <https://doulosapologetics.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://doulosapologetics.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:09:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.fmatkd.com
2024-09-16 07:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:09:43 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.fmatkd.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.gpe.rsl.mybluehost.me
2024-09-16 07:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:09:42 GMT Server: Apache Link: <https://thelatenotes.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:09:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · shrmehdi.thementoringprogram.com
2024-09-16 07:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:09:39 GMT Server: Apache Vary: accept,content-type,Accept-Encoding X-Cache-Enabled: True Link: <https://shrmehdi.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/9v86n>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:14:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yap.ref.mybluehost.me
2024-09-16 07:09
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:09:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.yap.ref.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.yap.ref.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.nataliegrayfoundation.org
2024-09-16 07:09
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:09:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nataliegrayfoundation.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:09:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.dotimpact.com
2024-09-16 07:09
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:09:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 235 Location: http://mail.dotimpact.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.dotimpact.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · pok.tqd.mybluehost.me
2024-09-16 07:09
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:09:15 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:09:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Lumie — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Lumie — Coming Soon</title> <script src="https://lumie.site/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://lumie.site/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://lumie.site/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · starofalbion.com
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://starofalbion.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.littlemermaidglassbottomboat.com
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://www.littlemermaidglassbottomboat.com/wp-json/>; rel="https://api.w.org/", <https://www.littlemermaidglassbottomboat.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: LittleMermaidGlassBottomBoat <!DOCTYPE html> <html class="html" lang="en-US"> <head> <meta charset="UTF-8"> <link rel="profile" href="https://gmpg.org/xfn/11"> <title>LittleMermaidGlassBottomBoat</title> <meta name='robots' content='noindex,nofollow' /> <meta name="viewport" content="width=device-width, initial-scale=1"><link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="LittleMermaidGlassBottomBoat » Feed" href="https://www.littlemermaidglassbottomboat.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="LittleMermaidGlassBottomBoat » Comments Feed" href="https://www.littlemermaidglassbottomboat.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.littlemermaidglassbottomboat.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.4.16"}}; /*! This file is auto-generated */ !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://www.littlemermaidglassbottomboat.com/wp-includes/css/dist/block-library/style.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='https://www.littlemermaidglassbottomboat.com/wp-includes/css/dist/block-library/theme.min.css?ver=5.4.16' type='text/css' media='all' /> <link rel='stylesheet' id='font-awesome-css' href='https://www.littlemermaidglassbottomboat.com/wp-content/themes/oceanwp/assets/fonts/fontawesome/css/all.min.css?ver=5.11.2' type='text/css' media='all' /> <link rel='stylesheet' id='simple-line-icons-css' href='https://www.littlemermaidglassbottomboat.com/wp-content/themes/oceanwp/assets/css/third/simple-line-icons.min.css?ver=2.4.0' typeFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cisosecsolutions.com
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://cisosecsolutions.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/bYT5d>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:13:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.uprcwichita.com
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:23 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://uprcwichita.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.fhg.plx.mybluehost.me
2024-09-16 07:08
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://jennayoungconsulting.com/ Cache-Control: max-age=28800 Expires: Mon, 16 Sep 2024 15:08:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fjennayoungconsulting.com%2F; expires=Mon, 14 Oct 2024 07:08:24 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mayaelchuco.com
2024-09-16 07:08
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mayaelchuco.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:08:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · nln.pvh.mybluehost.me
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Location: https://www.blueandgrayfinancial.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=9fb8da260250dacf8b1d0b75b54be648; path=/ Set-Cookie: FORMLIFT_ID=formlift_session_66e7d95343ea50.47789424; expires=Wed, 16-Oct-2024 07:08:03 GMT; Max-Age=2592000; path=/; secure; HttpOnly
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · jesicaciriofit.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:08:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Pingback: https://jesicaciriofit.com/xmlrpc.php Link: <https://jesicaciriofit.com/wp-json/>; rel="https://api.w.org/", <https://jesicaciriofit.com/>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://jesicaciriofit.com/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://jesicaciriofit.com Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: pll_language=es; expires=Tue, 16-Sep-2025 07:08:00 GMT; Max-Age=31536000; path=/; secure Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.floridagirltravels.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://floridagirltravels.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.uxn.hgs.mybluehost.me
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:08:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jessejthompsonlaw.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · rms.uqp.mybluehost.me
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://gutsygal.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · nje.ano.mybluehost.me
2024-09-16 07:07
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:07:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://nje.ano.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://nje.ano.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.shitibuilt.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://gebuilds.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.sovereigncapitalnyc.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:32 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=8ebfae686a50c4c86ac428ceb78e16ac; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.sovereigncapitalnyc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.hillts.com
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hillts.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.happysoulwhotravels.com
2024-09-16 07:07
HTTP/1.1 404 Not Found Date: Mon, 16 Sep 2024 07:07:30 GMT Server: Apache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Happy Soul Who Travels — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Happy Soul Who Travels — Coming Soon</title> <script src="https://happysoulwhotravels.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://happysoulwhotravels.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://happysoulwhotravels.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-a4347e21.projectsmind.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: track.projectsmind.com — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>track.projectsmind.com — Coming Soon</title> <script src="https://track.projectsmind.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://track.projectsmind.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://track.projectsmind.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.wordfortress.com
2024-09-16 07:07
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:07:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://www.wordfortress.com/wp-json/>; rel="https://api.w.org/", <https://www.wordfortress.com/wp-json/wp/v2/pages/5>; rel="alternate"; title="JSON"; type="application/json", <https://wp.me/PasMeL-5>; rel=shortlink Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:20 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.digitalstar.ca
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitalstar.ca/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:12:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.magneticminstrel.net
2024-09-16 07:07
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:07:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://magneticminstrel.net/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:07:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · gtg.cun.mybluehost.me
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:54 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://nilsencorp.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nilsencorp.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nilsencorp.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.pureprecise.com
2024-09-16 07:06
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:06:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 236 Location: http://www.pureprecise.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.pureprecise.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-dcb9f1ad.aps.fts.mybluehost.me
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: outofoffice.com.co — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>outofoffice.com.co — Coming Soon</title> <script src="https://outofoffice.com.co/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://outofoffice.com.co/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://outofoffice.com.co/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.cdr.rgy.mybluehost.me
2024-09-16 07:06
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:06:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://www.cdr.rgy.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.cdr.rgy.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.abundantlovechildrenshome.com
2024-09-16 07:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:06:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://abundantlovechildrenshome.com/xmlrpc.php X-Redirect-By: WordPress Location: https://abundantlovechildrenshome.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.yvv.sup.mybluehost.me
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ekaktech.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · galenacomic.com
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:43 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 70765 Last-Modified: Sun, 15 Sep 2024 23:37:43 GMT Accept-Ranges: bytes Cache-Control: max-age=14400 Expires: Mon, 16 Sep 2024 11:06:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Page title: Galena Comic <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <title>Galena Comic</title> <meta name='robots' content='max-image-preview:large' /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <meta name="generator" content="GoodLight 1.1" /> <link rel="alternate" type="application/rss+xml" title="Galena Comic » Feed" href="https://www.galenacomic.com/feed" /> <link rel="alternate" type="application/rss+xml" title="Galena Comic » Comments Feed" href="https://www.galenacomic.com/comments/feed" /> <link rel="pingback" href="https://www.galenacomic.com/xmlrpc.php" /> <meta property="og:title" content="Library" /> <meta property="og:description" content="Chapter 13 The price of Failure Chapter 12 Annual Chapter 11 pt. 2 Chapter 11 Up From the Depths Chapter ..." /> <meta property="og:url" content="https://www.galenacomic.com/" /> <meta property="og:image" content="https://www.galenacomic.com/wp-content/uploads/2017/02/Cover_4-150x150.jpg" /> <meta property="og:type" content="website" /> <meta property="og:site_name" content="Galena Comic" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.galenacomic.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.6.2"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supFound 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.gqg.lnr.mybluehost.me
2024-09-16 07:06
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:06:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://mail.gqg.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.gqg.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.website-08a5e277.siestasailing.com
2024-09-16 07:06
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:06:15 GMT Server: Apache Location: http://www.website-08a5e277.siestasailing.com/cgi-sys/suspendedpage.cgi Content-Length: 255 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://www.website-08a5e277.siestasailing.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.sammysexports.com
2024-09-16 07:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:06:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sammysexports.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:06:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.carlarenata.com
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:09 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://www.carlarenata.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/3JWSD>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.soil-engineering.com
2024-09-16 07:06
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:06:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://soil-engineering.com/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:11:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.androidrobotstudios.com
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:06 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Pragma: no-cache Cache-Control: no-store, no-cache, must-revalidate Set-Cookie: PHPSESSID=eea9251de9b3e6e212d974097595e401; path=/ Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Android Robot Studios — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Android Robot Studios — Coming Soon</title> <script src="https://androidrobotstudios.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://androidrobotstudios.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://androidrobotstudios.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.strengthmekaniks.com
2024-09-16 07:06
HTTP/1.1 500 Internal Server Error Date: Mon, 16 Sep 2024 07:06:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Connection: close Transfer-Encoding: chunked Page title: WordPress › Error <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='max-image-preview:large, noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ennvisionn.com
2024-09-16 07:06
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:06:03 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:11:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: ennvisionn — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>ennvisionn — Coming Soon</title> <script src="https://ennvisionn.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ennvisionn.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ennvisionn.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.usi.jso.mybluehost.me
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:06:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://usi.jso.mybluehost.me/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:11:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.abatementsolutionslacrosse.com
2024-09-16 07:05
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:05:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.abatementsolutionslacrosse.com/wp-json/>; rel="https://api.w.org/", <https://www.abatementsolutionslacrosse.com/wp-json/wp/v2/pages/4>; rel="alternate"; title="JSON"; type="application/json", <https://www.abatementsolutionslacrosse.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mnj.rgl.mybluehost.me
2024-09-16 07:05
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:05:55 GMT Server: Apache Location: https://mail.mnj.rgl.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 244 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.mnj.rgl.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · royallydigitalproducts.com
2024-09-16 07:05
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:05:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: http://royallydigitalproducts.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://royallydigitalproducts.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.advancedhairalternatives.iib.jso.mybluehost.me
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://advancedhairalternatives.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.kqv.zzt.mybluehost.me
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kqv.zzt.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · intermediateresolutions.com
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://intermediateresolutions.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.hgu.aqd.mybluehost.me
2024-09-16 07:05
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:05:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://uppercrustvegan.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:05:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.kidsdeal.us
2024-09-16 07:05
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:05:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://kidsdeal.us/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:10:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.smccapitalgrp.com
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://smccapitalgrp.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ltv.pdu.mybluehost.me
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://honeybeehunnieglobal.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.knv.wyd.mybluehost.me
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://em-art-d.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.mindyourownbirth.ca
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mindyourownbirth.ca/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 07:09:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ksnartistry.com
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ksnartistry.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.trading.kismetmind.com
2024-09-16 07:04
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:04:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trading.kismetmind.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Ftrading.kismetmind.com%2F; expires=Mon, 14 Oct 2024 07:04:12 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.uwg.ewp.mybluehost.me
2024-09-16 07:04
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:04:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://realtornathaliebay.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:04:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · simbaonlinestore.com
2024-09-16 07:03
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · hosnakalantar.com
2024-09-16 07:03
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:04:00 GMT Server: Apache Location: https://hosnakalantar.com/cgi-sys/suspendedpage.cgi Content-Length: 235 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://hosnakalantar.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · dietarycafe.com
2024-09-16 07:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:03:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.dietarycafe.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:03:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · llk.kum.mybluehost.me
2024-09-16 07:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:03:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://smccapitalgrp.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:03:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-423d9573.beu.qjv.mybluehost.me
2024-09-16 07:03
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:03:11 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.zyf.rnz.mybluehost.me
2024-09-16 07:03
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:03:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://zyf.rnz.mybluehost.me/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:03:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.nextnewdeal.blog
2024-09-16 07:03
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:03:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://mail.nextnewdeal.blog/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.nextnewdeal.blog/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tpy.wbq.mybluehost.me
2024-09-16 07:03
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:03:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.tpy.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.tpy.wbq.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · ope.vsb.mybluehost.me
2024-09-16 07:02
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:02:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://ope.vsb.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://ope.vsb.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.smilesforadventure.com
2024-09-16 07:02
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:02:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://www.smilesforadventure.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.smilesforadventure.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.lyy.wev.mybluehost.me
2024-09-16 07:01
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:02:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://trendzforlesslb.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:01:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.acoolroom.com
2024-09-16 07:00
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 07:00:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://acoolroom.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:00:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.thejedipath.store
2024-09-16 07:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:00:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:00:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://thejedipath.store/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thejedipath.store/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thejedipath.store/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-e8fb4000.ygo.bsd.mybluehost.me
2024-09-16 07:00
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 07:00:36 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 09:00:36 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: generalcontractorcapemay — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>generalcontractorcapemay — Coming Soon</title> <script src="https://generalcontractorcapemay.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://generalcontractorcapemay.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://generalcontractorcapemay.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.drip420.com
2024-09-16 07:00
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 07:00:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 234 Location: https://mail.drip420.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.drip420.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · website-bcf4fd6a.cib.rfn.mybluehost.me
2024-09-16 06:59
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:59:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 256 Location: https://website-bcf4fd6a.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://website-bcf4fd6a.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · onthehousetops.com
2024-09-16 06:59
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:59:16 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · aispeechteacher.daphneybongo.com
2024-09-16 06:59
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:59:11 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.tinitiatives.com
2024-09-16 06:59
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:59:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tinitiatives.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:59:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.cib.rfn.mybluehost.me
2024-09-16 06:58
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:58:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.getlostwithsk.com
2024-09-16 06:58
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:58:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://getlostwithsk.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:58:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.socialcarepeople.com.au
2024-09-16 06:58
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:58:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://socialcarepeople.com.au/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:58:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.yiy.rfl.mybluehost.me
2024-09-16 06:57
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:57:43 GMT Server: nginx/1.21.6 Content-Type: text/html Content-Length: 6940 Last-Modified: Fri, 22 Jan 2021 22:38:07 GMT Accept-Ranges: bytes Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Page title: Home | MarkSolomon.net <!DOCTYPE html> <html lang="en"> <head> <!-- Required meta tags always come first --> <meta charset="utf-8"> <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no"> <meta http-equiv="x-ua-compatible" content="ie=edge"> <!-- Head content such as meta tags and encoding options, etc --> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <meta name="author" content="Joel Solomon" /> <meta name="title" content="Mark Solomon.net: editor, consultant, and teacher" /> <meta name="keywords" content="editor, consultant, MarkSolomon, Mark Solomon, marksolomon, mark solomon, Frankenweenie, Chicken Run, Sgt Stubby" /> <meta name="description" content="Mark Solomon Portfolio: editor, consultant, teacher" /> <meta name="robots" content="index, follow" /> <!-- User defined head content --> <!-- Browser title --> <title>Home | MarkSolomon.net</title> <!-- Main Theme Stylesheet --> <link rel="stylesheet" type="text/css" media="all" href="rw_common/themes/Foundry/consolidated.css?rwcache=633047859" /> <!-- RapidWeaver Color Picker Stylesheet --> <!-- Plugin injected code --> <link rel='stylesheet' type='text/css' media='all' href='rw_common/plugins/stacks/stacks.css?rwcache=633047859' /> <link rel='stylesheet' type='text/css' media='all' href='files/stacks_page_page5.css?rwcache=633047859' /> <script type='text/javascript' charset='utf-8' src='rw_common/plugins/stacks/jquery-2.2.4.min.js?rwcache=633047859'></script> <link rel="stylesheet" href="rw_common/plugins/stacks/font-awesome.min.css?rwcache=633047859"> <script type='text/javascript' charset='utf-8' src='files/stacks_page_page5.js?rwcache=633047859'></script> <meta name="formatter" content="Stacks v4.1.4 (5385)" > <meta class="stacks4 stack version" id="com.elixir.stacks.foundry" name="Foundry" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.yuzoolthemes.stacks.navigation" name="Navigation" content="1.3.9"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryBanner" name="Banner" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryHeader" name="Header" content="1.3.4.4"> <meta class="stacks4 stack version" id="com.elixir.stacks.foundryContainer" name="Container" content="1.3.4.4"> </head> <body class="antialiased"> <div class="blur_wrapper"> <div id='stacks_out_1' class='stacks_top'><div id='stacks_in_1' class=''><div id='stacks_out_20' class='stacks_out'><div id='stacks_in_20' class='stacks_in com_elixir_stacks_foundry_stack'> <!-- Foundry --> </div></div><div id='stacks_out_21' class='stacks_out'><div id='stacks_in_21' class='stacks_in com_yuzoolthemes_stacks_navigation_stack'> <!-- GFL --> <script src="https://ajax.googleapis.com/ajax/libs/webfont/1.6.16/webfont.js"></script> <script> WebFont.load({ google: { families: ['Oswald', 'Open Sans','Ubuntu','Roboto','Oxygen','Orbitron'] } }); </script> <!-- /GFL --> <!-- MENU HTML --> <div id="stacks_in_21" class="fixed"> <div id="fnav" class="fnav"> <div id="max-width-nav"> <ul><li class="Selected"><a href="./" rel="" class="nav_item nav_active">Home</a></li><li><a href="page-3/" rel="" class="nav_item">Editor</a></li><li><a href="page/" rel="" class="nav_item">Consultant</a></li><li><a href="page-2/" rel="" class="nav_item">Teacher</a></li><li><a href="page-4/" rel="" class="nav_item">About Me</a></li></ul> </div> </div> </div> <!-- /MENU HTML --> </div></div><div id='stacks_out_5' class='stacks_out'><div id='stacks_in_5' class='stacks_in com_elixir_stacks_foundryBanner_stack'> <div class="nav_pairing"> <div class="banner"> <div class="banner_inner"> <div class="banner_content"> <div class="container-fluid"> <div id='stacks_out_35' class='stacks_out'><div id='stacks_in_35' class='stacks_in image_stack'> <div class='centered_image' > <img class='imageStyle' src='files/stacks-image-ba7cd42.png' alt='Stacks Image 36' /> <Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · xvx.jwz.mybluehost.me
2024-09-16 06:57
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:57:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://xvx.jwz.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://xvx.jwz.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.townofkelfordnc.gov
2024-09-16 06:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:56:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://townofkelfordnc.gov/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:56:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.glamourtradingco.com
2024-09-16 06:56
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:56:26 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache X-Redirect-By: WordPress Set-Cookie: PHPSESSID=b9bde0100201cac2aecc1341da987fd0; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://glamourtradingco.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.xiv.pan.mybluehost.me
2024-09-16 06:56
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:56:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.xiv.pan.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.xiv.pan.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · www.elbds.com
2024-09-16 06:55
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:56:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://elbds.com/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:56:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · gqg.lnr.mybluehost.me
2024-09-16 06:55
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:55:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 238 Location: http://gqg.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://gqg.lnr.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · aleeshaleadgenerationexpert.com
2024-09-16 06:55
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:55:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 249 Location: https://aleeshaleadgenerationexpert.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://aleeshaleadgenerationexpert.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.onthehousetops.com
2024-09-16 06:54
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:54:50 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.cib.rfn.mybluehost.me
2024-09-16 06:54
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:54:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · cib.rfn.mybluehost.me
2024-09-16 06:54
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:54:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · vcc.rgy.mybluehost.me
2024-09-16 06:53
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:53:52 GMT Server: Apache Location: https://vcc.rgy.mybluehost.me/cgi-sys/suspendedpage.cgi Content-Length: 239 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://vcc.rgy.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.ope.vsb.mybluehost.me
2024-09-16 06:53
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:53:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.ope.vsb.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.ope.vsb.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-bcf4fd6a.cib.rfn.mybluehost.me
2024-09-16 06:53
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:53:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 260 Location: https://www.website-bcf4fd6a.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.website-bcf4fd6a.cib.rfn.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · coronaregime.com
2024-09-16 06:53
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:53:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://coronaregime.com/>; rel=shortlink Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cross-Origin-Embedder-Policy: unsafe-none Cross-Origin-Opener-Policy: unsafe-none Cross-Origin-Resource-Policy: cross-origin Referrer-Policy: strict-origin-when-cross-origin X-Download-Options: noopen X-Frame-Options: SAMEORIGIN X-XSS-Protection: 1; mode=block X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: vchideactivationmsg_vc11=7.3 Transfer-Encoding: chunked Page title: Site is undergoing maintenance <!DOCTYPE html> <html lang="en-GB"> <head> <meta charset="UTF-8" /> <title>Site is undergoing maintenance</title> <link rel="icon" href="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-32x32.png" sizes="32x32" /> <link rel="icon" href="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-192x192.png" sizes="192x192" /> <link rel="apple-touch-icon" href="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-180x180.png" /> <meta name="msapplication-TileImage" content="https://coronaregime.com/osuwubif/2024/02/cropped-Bluesupply_favicon-270x270.png" /> <meta name="viewport" content="width=device-width, maximum-scale=1, initial-scale=1, minimum-scale=1"> <meta name="description" content=""/> <meta http-equiv="X-UA-Compatible" content="" /> <meta property="og:site_name" content="COMING SOON - "/> <meta property="og:title" content="Site is undergoing maintenance"/> <meta property="og:type" content="Maintenance"/> <meta property="og:url" content="https://coronaregime.com"/> <meta property="og:description" content="Site will be available soon. Thank you for your patience!"/> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel='stylesheet' id='mtnc-style-css' href='https://coronaregime.com/stywhops/maintenance/load/css/style.css?ver=1707199968' type='text/css' media='all' /> <link rel='stylesheet' id='mtnc-fonts-css' href='https://coronaregime.com/stywhops/maintenance/load/css/fonts.css?ver=1707199968' type='text/css' media='all' /> <style type="text/css">body {background-color: #111111}.preloader {background-color: #111111}body {font-family: Open Sans; }.site-title, .preloader i, .login-form, .login-form a.lost-pass, .btn-open-login-form, .site-content, .user-content-wrapper, .user-content, footer, .maintenance a{color: #ffffff;} a.close-user-content, #mailchimp-box form input[type="submit"], .login-form input#submit.button {border-color:#ffffff} input[type="submit"]:hover{background-color:#ffffff} input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-text-fill-color:#ffffff} body > .login-form-container{background-color:#111111}.btn-open-login-form{background-color:#111111}input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-box-shadow:0 0 0 50px #111111 inset}input[type='submit']:hover{color:#111111} #custom-subscribe #submit-subscribe:before{background-color:#111111} </style> <!--[if IE]> <style type="text/css"> </style> <script type="text/javascript" src="https://coronaregime.com/stywhops/maintenance/load/js/jquery.backstretch.min.js"></script> <![endif]--> <link rel="stylesheet" href="https://fonts.bunny.net/css?family=Open%20Sans:300,300italic,regular,italic,600,600italic,700,700italic,800,800italic:300"></head> <body class="maintenance "> <div class="main-container"> <div class="preloader"><i class="fi-widget" aria-hidden="true"></i></div> <div id="wrapper"> <div class="center logotype"> <header> <div class="logo-box istext" rel="home"><h1 class="site-title">COMING SOON</h1></div> </header> </div> <div id="content" class="site-content"> <div class="center"> <h2 class="heading font-center" style="font-weight:300;font-style:normal">Maintenance mode is on</h2><div class="description" style="font-weight:300;font-style:normal"><p>Site will be available soon. Thank you for your patience!</p> </div> </div> </div> </div> <footer> <div class="center"> <div style="font-weight:300;font-style:normal">© 2024</div> </div> </footer> <picture class="bg-img"> <img src="https://coronaregime.com/osuwubif/2024/02/mt-sample-background.jpg"> </picture> </div> <div class="login-form-container"> <input type="hidden" id="mtnc_login_check" name="mtnc_login_check" value="a940769753" /><input type="hidden" name="_wp_http_referer" value="/" /><form id="login-form" class="login-form" method="post"><label>User Login</label><span class="login-error"></span><span class="licon user-icon"><input type="text" name="log" id="log" value="" size="20" class="input username" placeholder="UsernamFound 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.jpq.pan.mybluehost.me
2024-09-16 06:53
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:53:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.jpq.pan.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.jpq.pan.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.ujr.lef.mybluehost.me
2024-09-16 06:52
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:53:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://www.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.henryjoseph.com
2024-09-16 06:52
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:52:40 GMT Server: Apache Link: <https://henryjoseph.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · mail.samuelecherubini.com
2024-09-16 06:52
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:52:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 242 Location: http://mail.samuelecherubini.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="http://mail.samuelecherubini.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:80 · digitalstar.ca
2024-09-16 06:52
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:52:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitalstar.ca/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:57:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · subdomain.ophandgwen.com
2024-09-16 06:52
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:52:22 GMT Server: Apache Location: https://subdomain.ophandgwen.com/cgi-sys/suspendedpage.cgi Content-Length: 242 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://subdomain.ophandgwen.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · nnhsclubs.com
2024-09-16 06:52
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:52:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://nnhsclubs.com/wp-json/>; rel="https://api.w.org/", <https://nnhsclubs.com/wp-json/wp/v2/pages/10>; rel="alternate"; type="application/json", <https://nnhsclubs.com/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:57:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Thu, 14 Sep 2034 06:52:08 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.theleadershiprx.com
2024-09-16 06:51
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.website-1e353099.ujr.lef.mybluehost.me
2024-09-16 06:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:51:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 260 Location: https://www.website-1e353099.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.website-1e353099.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · renewyou.alvinwayneweiss.com
2024-09-16 06:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:51:32 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://renewyou.io/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:51:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · allnaturalrepellent.com
2024-09-16 06:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:51:27 GMT Server: Apache Location: https://allnaturalrepellent.com/cgi-sys/suspendedpage.cgi Content-Length: 241 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://allnaturalrepellent.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.xiv.pan.mybluehost.me
2024-09-16 06:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:51:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 244 Location: https://mail.xiv.pan.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.xiv.pan.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · kelp-ark.org
2024-09-16 06:51
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:51:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.altaseadsconservancy.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:51:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.allnaturalrepellent.com
2024-09-16 06:51
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:51:06 GMT Server: Apache Location: https://mail.allnaturalrepellent.com/cgi-sys/suspendedpage.cgi Content-Length: 246 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.allnaturalrepellent.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.hookcommlink.com
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:41 GMT Server: Apache Location: https://mail.hookcommlink.com/cgi-sys/suspendedpage.cgi Content-Length: 239 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.hookcommlink.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · samuelecherubini-com.ujr.lef.mybluehost.me
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 260 Location: https://samuelecherubini-com.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://samuelecherubini-com.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.mindyourownbirth.ca
2024-09-16 06:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:50:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mindyourownbirth.ca/ Cache-Control: max-age=300 Expires: Mon, 16 Sep 2024 06:55:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · nws.iml.mybluehost.me
2024-09-16 06:50
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:50:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:50:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://nws.iml.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://nws.iml.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://nws.iml.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.bsv.kdq.mybluehost.me
2024-09-16 06:50
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:50:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mossbayhall.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.uscies.com
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:13 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.samuelecherubini.com
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 243 Location: https://mail.samuelecherubini.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.samuelecherubini.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · uscies.com
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:07 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lcx.ssy.mybluehost.me
2024-09-16 06:50
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:50:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 239 Location: https://lcx.ssy.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://lcx.ssy.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · doanebaptistchurch.org
2024-09-16 06:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:49:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:49:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Doane Baptist Church — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Doane Baptist Church — Coming Soon</title> <script src="https://doanebaptistchurch.org/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://doanebaptistchurch.org/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.14.9" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://doanebaptistchurch.org/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.doanebaptistchurch.org
2024-09-16 06:49
HTTP/1.1 301 Moved Permanently Date: Mon, 16 Sep 2024 06:49:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://doanebaptistchurch.org/ Cache-Control: max-age=7200 Expires: Mon, 16 Sep 2024 08:49:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · lawnrangermi.com
2024-09-16 06:49
HTTP/1.1 200 OK Date: Mon, 16 Sep 2024 06:49:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://lawnrangermi.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://lawnrangermi.com/index.php?rest_route=/wp/v2/pages/11>; rel="alternate"; title="JSON"; type="application/json", <https://lawnrangermi.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · mail.medigappeople.com
2024-09-16 06:49
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:49:40 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 hours ago by HttpPluginCreate report
-
Open service 162.241.226.40:443 · www.samuelecherubini-com.ujr.lef.mybluehost.me
2024-09-16 06:49
HTTP/1.1 302 Found Date: Mon, 16 Sep 2024 06:49:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 264 Location: https://www.samuelecherubini-com.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.samuelecherubini-com.ujr.lef.mybluehost.me/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 19 hours ago by HttpPluginCreate report
andromedaswish.comautodiscover.byd.wyz.mybluehost.mebyd.wyz.mybluehost.mecpanel.byd.wyz.mybluehost.mecpcalendars.byd.wyz.mybluehost.mecpcontacts.byd.wyz.mybluehost.memail.andromedaswish.commail.byd.wyz.mybluehost.mewebdisk.byd.wyz.mybluehost.mewebmail.byd.wyz.mybluehost.mewww.andromedaswish.comwww.byd.wyz.mybluehost.me
autodiscover.breakupglowupfight.combadgirlgoodfighter.combeccathesun.combingefreeathlete.combreakupglowupfight.comcpanel.breakupglowupfight.comcpcalendars.breakupglowupfight.comcpcontacts.breakupglowupfight.commail.badgirlgoodfighter.commail.beccathesun.commail.bingefreeathlete.commail.breakupglowupfight.comwebdisk.breakupglowupfight.comwebmail.breakupglowupfight.comwww.badgirlgoodfighter.comwww.beccathesun.comwww.bingefreeathlete.comwww.breakupglowupfight.com
autodiscover.jen.jdq.mybluehost.mecpanel.jen.jdq.mybluehost.mecpcalendars.jen.jdq.mybluehost.mecpcontacts.jen.jdq.mybluehost.mejen.jdq.mybluehost.memail.jen.jdq.mybluehost.memail.trevormusgrove.comtrevormusgrove.comwebdisk.jen.jdq.mybluehost.mewebmail.jen.jdq.mybluehost.mewww.jen.jdq.mybluehost.mewww.trevormusgrove.com
autodiscover.qak.pju.mybluehost.mecpanel.qak.pju.mybluehost.mecpcalendars.qak.pju.mybluehost.mecpcontacts.qak.pju.mybluehost.memail.philipalves.commail.qak.pju.mybluehost.mephilipalves.comqak.pju.mybluehost.mewebdisk.qak.pju.mybluehost.mewebmail.qak.pju.mybluehost.mewww.philipalves.comwww.qak.pju.mybluehost.me
autodiscover.recipesandplaces.comcpanel.recipesandplaces.comcpcalendars.recipesandplaces.comcpcontacts.recipesandplaces.commail.recipesandplaces.comrecipesandplaces.comwebdisk.recipesandplaces.comwebmail.recipesandplaces.comwww.recipesandplaces.com
autodiscover.duyanebeauty.comautodiscover.paracleteministriesinternational.orgcpanel.duyanebeauty.comcpanel.paracleteministriesinternational.orgcpcalendars.duyanebeauty.comcpcalendars.paracleteministriesinternational.orgcpcontacts.duyanebeauty.comcpcontacts.paracleteministriesinternational.orgduyanebeauty.commail.duyanebeauty.commail.paracleteministriesinternational.orgmail.tfg.cyv.mybluehost.meparacleteministriesinternational-org.duyanebeauty.comparacleteministriesinternational.orgtfg.cyv.mybluehost.mewebdisk.duyanebeauty.comwebdisk.paracleteministriesinternational.orgwebmail.duyanebeauty.comwebmail.paracleteministriesinternational.orgwww.duyanebeauty.comwww.paracleteministriesinternational-org.duyanebeauty.comwww.paracleteministriesinternational.orgwww.tfg.cyv.mybluehost.me
a3dp.com.auautodiscover.a3dp.com.aucpanel.a3dp.com.aucpcalendars.a3dp.com.aucpcontacts.a3dp.com.aumail.a3dp.com.auwebdisk.a3dp.com.auwebmail.a3dp.com.auwww.a3dp.com.au
autodiscover.dietsupplementsranking.comautodiscover.insobeau.comcpanel.dietsupplementsranking.comcpanel.insobeau.comcpcalendars.dietsupplementsranking.comcpcalendars.insobeau.comcpcontacts.dietsupplementsranking.comcpcontacts.insobeau.comdietsupplementsranking-com.sunmulgift.comdietsupplementsranking.cominsobeau-com.sunmulgift.cominsobeau.commail.dietsupplementsranking.commail.insobeau.comwebdisk.dietsupplementsranking.comwebdisk.insobeau.comwebmail.dietsupplementsranking.comwebmail.insobeau.comwww.dietsupplementsranking-com.sunmulgift.comwww.dietsupplementsranking.comwww.insobeau-com.sunmulgift.comwww.insobeau.com
autodiscover.jjv.ocl.mybluehost.mecpanel.jjv.ocl.mybluehost.mecpcalendars.jjv.ocl.mybluehost.mecpcontacts.jjv.ocl.mybluehost.mejjv.ocl.mybluehost.memail.jjv.ocl.mybluehost.memail.mannmadetech.commannmadetech.comwebdisk.jjv.ocl.mybluehost.mewebmail.jjv.ocl.mybluehost.mewww.jjv.ocl.mybluehost.mewww.mannmadetech.com
autodiscover.holistichealthbalancebycathey.comcpanel.holistichealthbalancebycathey.comcpcalendars.holistichealthbalancebycathey.comcpcontacts.holistichealthbalancebycathey.comholistichealthbalancebycathey.commail.holistichealthbalancebycathey.comwebdisk.holistichealthbalancebycathey.comwebmail.holistichealthbalancebycathey.comwww.holistichealthbalancebycathey.com
hamiltonplumbingsc.com.auwebsite-c0a7f9bb.wwa.gqj.mybluehost.mewww.website-c0a7f9bb.wwa.gqj.mybluehost.me
autodiscover.wrc.kdq.mybluehost.mecpanel.wrc.kdq.mybluehost.mecpcalendars.wrc.kdq.mybluehost.mecpcontacts.wrc.kdq.mybluehost.memail.wrc.kdq.mybluehost.mewebdisk.wrc.kdq.mybluehost.mewebmail.wrc.kdq.mybluehost.mewrc.kdq.mybluehost.mewww.wrc.kdq.mybluehost.me
brsmarthomeltd.co.uk
alwehdaclub.saksi.fnp.mybluehost.memail.alwehdaclub.samail.ksi.fnp.mybluehost.mewww.alwehdaclub.sawww.ksi.fnp.mybluehost.me
autodiscover.ljk.qzx.mybluehost.mebuoyancies.comcpanel.ljk.qzx.mybluehost.mecpcalendars.ljk.qzx.mybluehost.mecpcontacts.ljk.qzx.mybluehost.meljk.qzx.mybluehost.memail.buoyancies.commail.ljk.qzx.mybluehost.mewebdisk.ljk.qzx.mybluehost.mewebmail.ljk.qzx.mybluehost.mewww.buoyancies.comwww.ljk.qzx.mybluehost.me
autodiscover.qie.ttm.mybluehost.mecpanel.qie.ttm.mybluehost.mecpcalendars.qie.ttm.mybluehost.mecpcontacts.qie.ttm.mybluehost.megallosbarbershop.commail.gallosbarbershop.commail.qie.ttm.mybluehost.meqie.ttm.mybluehost.mewebdisk.qie.ttm.mybluehost.mewebmail.qie.ttm.mybluehost.mewww.gallosbarbershop.comwww.qie.ttm.mybluehost.me
autodiscover.wilmahollis.comcpanel.wilmahollis.comcpcalendars.wilmahollis.comcpcontacts.wilmahollis.commail.wilmahollis.comwebdisk.wilmahollis.comwebmail.wilmahollis.comwilmahollis.comwww.wilmahollis.com
autodiscover.nfi.qni.mybluehost.mecpanel.nfi.qni.mybluehost.mecpcalendars.nfi.qni.mybluehost.mecpcontacts.nfi.qni.mybluehost.memail.nfi.qni.mybluehost.memail.pureprecise.comnfi.qni.mybluehost.mepureprecise.comwebdisk.nfi.qni.mybluehost.mewebmail.nfi.qni.mybluehost.mewww.nfi.qni.mybluehost.mewww.pureprecise.com
alcyonespace.comautodiscover.mse.ihh.mybluehost.mecpanel.mse.ihh.mybluehost.mecpcalendars.mse.ihh.mybluehost.mecpcontacts.mse.ihh.mybluehost.memail.alcyonespace.commail.mse.ihh.mybluehost.memse.ihh.mybluehost.mewebdisk.mse.ihh.mybluehost.mewebmail.mse.ihh.mybluehost.mewww.alcyonespace.comwww.mse.ihh.mybluehost.me
autodiscover.dnp.tqp.mybluehost.mecpanel.dnp.tqp.mybluehost.mecpcalendars.dnp.tqp.mybluehost.mecpcontacts.dnp.tqp.mybluehost.mednp.tqp.mybluehost.memail.dnp.tqp.mybluehost.memail.spicedock.comspicedock.comwebdisk.dnp.tqp.mybluehost.mewebmail.dnp.tqp.mybluehost.mewww.dnp.tqp.mybluehost.mewww.spicedock.com
autodiscover.mr-quackersartistry.comautodiscover.sabrinamtzart.comcpanel.mr-quackersartistry.comcpanel.sabrinamtzart.comcpcalendars.mr-quackersartistry.comcpcalendars.sabrinamtzart.comcpcontacts.mr-quackersartistry.comcpcontacts.sabrinamtzart.commail.mr-quackersartistry.commail.sabrinamtzart.commr-quackersartistry.comsabrinamtzart.comsabrinamtzart.mr-quackersartistry.comwebdisk.mr-quackersartistry.comwebdisk.sabrinamtzart.comwebmail.mr-quackersartistry.comwebmail.sabrinamtzart.comwww.mail.mr-quackersartistry.comwww.mr-quackersartistry.comwww.sabrinamtzart.comwww.sabrinamtzart.mr-quackersartistry.com
viigems.duyanebeauty.comwww.viigems.duyanebeauty.com
autodiscover.hbh.fyd.mybluehost.mecpanel.hbh.fyd.mybluehost.mecpcalendars.hbh.fyd.mybluehost.mecpcontacts.hbh.fyd.mybluehost.meeillcwa.comhbh.fyd.mybluehost.memail.hbh.fyd.mybluehost.mewebdisk.hbh.fyd.mybluehost.mewebmail.hbh.fyd.mybluehost.mewww.eillcwa.comwww.hbh.fyd.mybluehost.me
perspectivesireland.comwww.perspectivesireland.com
*.bluehost.combluehost.com
apx.xfn.mybluehost.meautodiscover.apx.xfn.mybluehost.mecpanel.apx.xfn.mybluehost.mecpcalendars.apx.xfn.mybluehost.mecpcontacts.apx.xfn.mybluehost.memail.apx.xfn.mybluehost.mewebdisk.apx.xfn.mybluehost.mewebmail.apx.xfn.mybluehost.mewww.apx.xfn.mybluehost.me
autodiscover.lougheedband.comautodiscover.walkabouthills.comcpanel.lougheedband.comcpanel.walkabouthills.comcpcalendars.lougheedband.comcpcalendars.walkabouthills.comcpcontacts.lougheedband.comcpcontacts.walkabouthills.comlougheedband.comlougheedband.paintedwolfmedia.commail.lougheedband.commail.walkabouthills.comwalkabouthills.comwalkabouthills.paintedwolfmedia.comwebdisk.lougheedband.comwebdisk.walkabouthills.comwebmail.lougheedband.comwebmail.walkabouthills.comwww.lougheedband.comwww.lougheedband.paintedwolfmedia.comwww.walkabouthills.comwww.walkabouthills.paintedwolfmedia.com
autodiscover.hly.ref.mybluehost.mecpanel.hly.ref.mybluehost.mecpcalendars.hly.ref.mybluehost.mecpcontacts.hly.ref.mybluehost.meegastar.comhly.ref.mybluehost.memail.egastar.commail.hly.ref.mybluehost.mewebdisk.hly.ref.mybluehost.mewebmail.hly.ref.mybluehost.mewww.egastar.comwww.hly.ref.mybluehost.me
autodiscover.jrj.ygs.mybluehost.mecpanel.jrj.ygs.mybluehost.mecpcalendars.jrj.ygs.mybluehost.mecpcontacts.jrj.ygs.mybluehost.mejrj.ygs.mybluehost.memail.jrj.ygs.mybluehost.mewebdisk.jrj.ygs.mybluehost.mewebmail.jrj.ygs.mybluehost.mewww.jrj.ygs.mybluehost.me
autodiscover.wwr.rbb.mybluehost.mecpanel.wwr.rbb.mybluehost.mecpcalendars.wwr.rbb.mybluehost.mecpcontacts.wwr.rbb.mybluehost.megainthedifference.commail.gainthedifference.commail.wwr.rbb.mybluehost.mewebdisk.wwr.rbb.mybluehost.mewebmail.wwr.rbb.mybluehost.mewwr.rbb.mybluehost.mewww.gainthedifference.comwww.wwr.rbb.mybluehost.me
autodiscover.fie.dei.mybluehost.mecpanel.fie.dei.mybluehost.mecpcalendars.fie.dei.mybluehost.mecpcontacts.fie.dei.mybluehost.mefie.dei.mybluehost.memail.fie.dei.mybluehost.memail.texasdfwrealtor.comtexasdfwrealtor.comwebdisk.fie.dei.mybluehost.mewebmail.fie.dei.mybluehost.mewww.fie.dei.mybluehost.mewww.texasdfwrealtor.com
autodiscover.ptr.oui.mybluehost.mebengonet.comcpanel.ptr.oui.mybluehost.mecpcalendars.ptr.oui.mybluehost.mecpcontacts.ptr.oui.mybluehost.memail.bengonet.commail.ptr.oui.mybluehost.meptr.oui.mybluehost.mewebdisk.ptr.oui.mybluehost.mewebmail.ptr.oui.mybluehost.mewww.bengonet.comwww.ptr.oui.mybluehost.me
autodiscover.dhc.tvd.mybluehost.mecpanel.dhc.tvd.mybluehost.mecpcalendars.dhc.tvd.mybluehost.mecpcontacts.dhc.tvd.mybluehost.medhc.tvd.mybluehost.memail.dhc.tvd.mybluehost.memail.smileanddialconsulting.comsmileanddialconsulting.comwebdisk.dhc.tvd.mybluehost.mewebmail.dhc.tvd.mybluehost.mewww.dhc.tvd.mybluehost.mewww.smileanddialconsulting.com
autodiscover.qmd.bzx.mybluehost.mecpanel.qmd.bzx.mybluehost.mecpcalendars.qmd.bzx.mybluehost.mecpcontacts.qmd.bzx.mybluehost.memail.qmd.bzx.mybluehost.memail.scottpysher.comqmd.bzx.mybluehost.mescottpysher.comwebdisk.qmd.bzx.mybluehost.mewebmail.qmd.bzx.mybluehost.mewww.qmd.bzx.mybluehost.mewww.scottpysher.com
app.wealthygen.comshop.wealthygen.comwww.app.wealthygen.comwww.shop.wealthygen.com
autodiscover.ooa.pvh.mybluehost.mebrightaiideas.comcpanel.ooa.pvh.mybluehost.mecpcalendars.ooa.pvh.mybluehost.mecpcontacts.ooa.pvh.mybluehost.memail.brightaiideas.commail.ooa.pvh.mybluehost.meooa.pvh.mybluehost.mewebdisk.ooa.pvh.mybluehost.mewebmail.ooa.pvh.mybluehost.mewww.brightaiideas.comwww.ooa.pvh.mybluehost.me
autodiscover.ffa.vhl.mybluehost.mecpanel.ffa.vhl.mybluehost.mecpcalendars.ffa.vhl.mybluehost.mecpcontacts.ffa.vhl.mybluehost.meffa.vhl.mybluehost.memail.ffa.vhl.mybluehost.mewebdisk.ffa.vhl.mybluehost.mewebmail.ffa.vhl.mybluehost.mewww.ffa.vhl.mybluehost.me
autodiscover.modernaexteriors.comautodiscover.modernagatesandfences.comcpanel.modernaexteriors.comcpanel.modernagatesandfences.comcpcalendars.modernaexteriors.comcpcalendars.modernagatesandfences.comcpcontacts.modernaexteriors.comcpcontacts.modernagatesandfences.commail.modernaexteriors.commail.modernagatesandfences.commodernaexteriors.commodernaexteriors.modernafencela.commodernagatesandfences.commodernagatesandfences.modernafencela.comwebdisk.modernaexteriors.comwebdisk.modernagatesandfences.comwebmail.modernaexteriors.comwebmail.modernagatesandfences.comwww.modernaexteriors.comwww.modernaexteriors.modernafencela.comwww.modernagatesandfences.comwww.modernagatesandfences.modernafencela.com
autodiscover.fhg.plx.mybluehost.mecpanel.fhg.plx.mybluehost.mecpcalendars.fhg.plx.mybluehost.mecpcontacts.fhg.plx.mybluehost.mefhg.plx.mybluehost.mejennayoungconsulting.commail.fhg.plx.mybluehost.memail.jennayoungconsulting.comwebdisk.fhg.plx.mybluehost.mewebmail.fhg.plx.mybluehost.mewww.fhg.plx.mybluehost.mewww.jennayoungconsulting.com
autodiscover.cwx.ywv.mybluehost.mecpanel.cwx.ywv.mybluehost.mecpcalendars.cwx.ywv.mybluehost.mecpcontacts.cwx.ywv.mybluehost.mecwx.ywv.mybluehost.memail.cwx.ywv.mybluehost.memail.priceprodc.commail.pricepronv.commail.priceprova.compriceprodc.compriceprogroup.compricepronv.compriceprova.comwebdisk.cwx.ywv.mybluehost.mewebmail.cwx.ywv.mybluehost.mewww.cwx.ywv.mybluehost.mewww.priceprodc.comwww.priceprogroup.comwww.pricepronv.comwww.priceprova.com
autodiscover.spacemanmoving.comcpcalendars.spacemanmoving.comcpcontacts.spacemanmoving.commail.spacemanmoving.comspacemanmoving.vrv.vjk.mybluehost.mewebdisk.spacemanmoving.comwww.spacemanmoving.vrv.vjk.mybluehost.me
autodiscover.internationalkenpokobudohakutsuruassociation.comcpanel.internationalkenpokobudohakutsuruassociation.comcpcalendars.internationalkenpokobudohakutsuruassociation.comcpcontacts.internationalkenpokobudohakutsuruassociation.cominternationalkenpokobudohakutsuruassociation.commail.internationalkenpokobudohakutsuruassociation.comwebdisk.internationalkenpokobudohakutsuruassociation.comwebmail.internationalkenpokobudohakutsuruassociation.comwww.internationalkenpokobudohakutsuruassociation.com
frk-machine.comfrk-machine.sunpringextruder.comru.sunpringextruder.comwww.frk-machine.comwww.frk-machine.sunpringextruder.comwww.ru.sunpringextruder.com
autodiscover.paintedwolfmedia.comcpanel.paintedwolfmedia.comcpcalendars.paintedwolfmedia.comcpcontacts.paintedwolfmedia.commail.paintedwolfmedia.compaintedwolfmedia.comwebdisk.paintedwolfmedia.comwebmail.paintedwolfmedia.comwww.paintedwolfmedia.com
autodiscover.prx.doq.mybluehost.mecpanel.prx.doq.mybluehost.mecpcalendars.prx.doq.mybluehost.mecpcontacts.prx.doq.mybluehost.memail.prx.doq.mybluehost.memail.simbaonlinestore.comprx.doq.mybluehost.mesimbaonlinestore.comwebdisk.prx.doq.mybluehost.mewebmail.prx.doq.mybluehost.mewww.prx.doq.mybluehost.mewww.simbaonlinestore.com
autodiscover.lld.wvs.mybluehost.mecpanel.lld.wvs.mybluehost.mecpcalendars.lld.wvs.mybluehost.mecpcontacts.lld.wvs.mybluehost.melld.wvs.mybluehost.memail.lld.wvs.mybluehost.memail.musicjazzg.commusicjazzg.comwebdisk.lld.wvs.mybluehost.mewebmail.lld.wvs.mybluehost.mewww.lld.wvs.mybluehost.mewww.musicjazzg.com
autodiscover.goodentllc.comcpanel.goodentllc.comcpcalendars.goodentllc.comcpcontacts.goodentllc.comgoodentllc.comgoodentllc.liketheholiday.commail.goodentllc.comwebdisk.goodentllc.comwebmail.goodentllc.comwww.goodentllc.comwww.goodentllc.liketheholiday.com
autodiscover.rxn.kdf.mybluehost.mecpanel.rxn.kdf.mybluehost.mecpcalendars.rxn.kdf.mybluehost.mecpcontacts.rxn.kdf.mybluehost.memail.rxn.kdf.mybluehost.merxn.kdf.mybluehost.mewebdisk.rxn.kdf.mybluehost.mewebmail.rxn.kdf.mybluehost.mewww.rxn.kdf.mybluehost.me
autodiscover.blubakery.cablubakery-ca.bludesigns.cablubakery.cacpanel.blubakery.cacpcalendars.blubakery.cacpcontacts.blubakery.camail.blubakery.cawebdisk.blubakery.cawebmail.blubakery.cawww.blubakery-ca.bludesigns.cawww.blubakery.ca
autodiscover.cine4m.comcine4m-com.sunmulgift.comcine4m.comcpanel.cine4m.comcpcalendars.cine4m.comcpcontacts.cine4m.commail.cine4m.comwebdisk.cine4m.comwebmail.cine4m.comwww.cine4m-com.sunmulgift.comwww.cine4m.com
autodiscover.uni.jvd.mybluehost.mecpanel.uni.jvd.mybluehost.mecpcalendars.uni.jvd.mybluehost.mecpcontacts.uni.jvd.mybluehost.meksnartistry.commail.uni.jvd.mybluehost.meuni.jvd.mybluehost.mewebdisk.uni.jvd.mybluehost.mewebmail.uni.jvd.mybluehost.mewww.ksnartistry.comwww.uni.jvd.mybluehost.me
trading.kismetmind.comwww.trading.kismetmind.com
animefreesite.comanimefreesite.sunmulgift.comautodiscover.animefreesite.comcpanel.animefreesite.comcpcalendars.animefreesite.comcpcontacts.animefreesite.commail.animefreesite.comwebdisk.animefreesite.comwebmail.animefreesite.comwww.animefreesite.comwww.animefreesite.sunmulgift.com
autodiscover.wikiactivism.comcpanel.wikiactivism.comcpcalendars.wikiactivism.comcpcontacts.wikiactivism.commail.riseupabove.commail.wikiactivism.comriseupabove.comwebdisk.wikiactivism.comwebmail.wikiactivism.comwikiactivism.comwww.riseupabove.comwww.wikiactivism.com
dbh.csv.mybluehost.memail.dbh.csv.mybluehost.mewww.dbh.csv.mybluehost.me
autodiscover.yda.xrd.mybluehost.mecpanel.yda.xrd.mybluehost.mecpcalendars.yda.xrd.mybluehost.mecpcontacts.yda.xrd.mybluehost.mefcmta.orgmail.fcmta.orgmail.yda.xrd.mybluehost.mewebdisk.yda.xrd.mybluehost.mewebmail.yda.xrd.mybluehost.mewww.fcmta.orgwww.yda.xrd.mybluehost.meyda.xrd.mybluehost.me
autodiscover.oec.jqh.mybluehost.mecpanel.oec.jqh.mybluehost.mecpcalendars.oec.jqh.mybluehost.mecpcontacts.oec.jqh.mybluehost.meelbds.commail.elbds.commail.oec.jqh.mybluehost.meoec.jqh.mybluehost.mewebdisk.oec.jqh.mybluehost.mewebmail.oec.jqh.mybluehost.mewww.elbds.comwww.oec.jqh.mybluehost.me
autodiscover.vcc.rgy.mybluehost.mecpanel.vcc.rgy.mybluehost.mecpcalendars.vcc.rgy.mybluehost.mecpcontacts.vcc.rgy.mybluehost.memail.optimizevaservicesllc.commail.vcc.rgy.mybluehost.meoptimizevaservicesllc.comvcc.rgy.mybluehost.mewebdisk.vcc.rgy.mybluehost.mewebmail.vcc.rgy.mybluehost.mewww.optimizevaservicesllc.comwww.vcc.rgy.mybluehost.me
autodiscover.soil-engineering.comcpanel.soil-engineering.comcpcalendars.soil-engineering.comcpcontacts.soil-engineering.commail.soil-engineering.comsoil-engineering.comsoil-engineering.fjh.dwa.mybluehost.mewebdisk.soil-engineering.comwebmail.soil-engineering.comwww.soil-engineering.comwww.soil-engineering.fjh.dwa.mybluehost.me
autodiscover.svc.uzz.mybluehost.mecpanel.svc.uzz.mybluehost.mecpcalendars.svc.uzz.mybluehost.mecpcontacts.svc.uzz.mybluehost.memail.martinispickleball.commail.svc.uzz.mybluehost.memartinispickleball.comsvc.uzz.mybluehost.mewebdisk.svc.uzz.mybluehost.mewebmail.svc.uzz.mybluehost.mewww.martinispickleball.comwww.svc.uzz.mybluehost.me
autodiscover.tinitiatives.comcpanel.tinitiatives.comcpcalendars.tinitiatives.comcpcontacts.tinitiatives.commail.tinitiatives.comtinitiatives.comwebdisk.tinitiatives.comwebmail.tinitiatives.comwebsite-1a89461e.ane.pzr.mybluehost.mewww.tinitiatives.comwww.website-1a89461e.ane.pzr.mybluehost.me
autodiscover.thebuildabetterman.comcpanel.thebuildabetterman.comcpcalendars.thebuildabetterman.comcpcontacts.thebuildabetterman.commail.thebuildabetterman.comthebuildabetterman.comwebdisk.thebuildabetterman.comwebmail.thebuildabetterman.comwww.thebuildabetterman.com
autodiscover.yap.ref.mybluehost.mecpanel.yap.ref.mybluehost.mecpcalendars.yap.ref.mybluehost.mecpcontacts.yap.ref.mybluehost.memail.natesonlinemarketing.commail.yap.ref.mybluehost.menatesonlinemarketing.comwebdisk.yap.ref.mybluehost.mewebmail.yap.ref.mybluehost.mewww.natesonlinemarketing.comwww.yap.ref.mybluehost.meyap.ref.mybluehost.me
autodiscover.zlunasalon.comcpanel.zlunasalon.comcpcalendars.zlunasalon.comcpcontacts.zlunasalon.commail.zlunasalon.comwebdisk.zlunasalon.comwebmail.zlunasalon.comwww.zlunasalon.comzlunasalon.com
autodiscover.wvw.ifs.mybluehost.mecpanel.wvw.ifs.mybluehost.mecpcalendars.wvw.ifs.mybluehost.mecpcontacts.wvw.ifs.mybluehost.memail.wvw.ifs.mybluehost.mewebdisk.wvw.ifs.mybluehost.mewebmail.wvw.ifs.mybluehost.mewvw.ifs.mybluehost.mewww.wvw.ifs.mybluehost.me
vegas-x-tech.modernafencela.comwww.vegas-x-tech.modernafencela.com
autodiscover.forensicsupervisorsuccess.comcpanel.forensicsupervisorsuccess.comcpcalendars.forensicsupervisorsuccess.comcpcontacts.forensicsupervisorsuccess.comforensicsupervisorsuccess.comforensicsupervisorsuccess.forensicpocketguide.commail.forensicsupervisorsuccess.comwebdisk.forensicsupervisorsuccess.comwebmail.forensicsupervisorsuccess.comwww.forensicsupervisorsuccess.comwww.forensicsupervisorsuccess.forensicpocketguide.com
autodiscover.kps.dei.mybluehost.mecpanel.kps.dei.mybluehost.mecpcalendars.kps.dei.mybluehost.mecpcontacts.kps.dei.mybluehost.mekps.dei.mybluehost.memail.kps.dei.mybluehost.mewebdisk.kps.dei.mybluehost.mewebmail.kps.dei.mybluehost.mewww.kps.dei.mybluehost.me
autodiscover.hollytoscanini.comautodiscover.howtolosethewait.comcpanel.hollytoscanini.comcpanel.howtolosethewait.comcpcalendars.hollytoscanini.comcpcalendars.howtolosethewait.comcpcontacts.hollytoscanini.comcpcontacts.howtolosethewait.comhollytoscanini.comhowtolosethewait.commail.hollytoscanini.commail.howtolosethewait.commail.ujo.oef.mybluehost.meujo.oef.mybluehost.mewebdisk.hollytoscanini.comwebdisk.howtolosethewait.comwebmail.hollytoscanini.comwebmail.howtolosethewait.comwebsite-d8fc586a.hollytoscanini.comwww.hollytoscanini.comwww.howtolosethewait.comwww.ujo.oef.mybluehost.mewww.website-d8fc586a.hollytoscanini.com
autodiscover.mathesisml.comcpanel.mathesisml.comcpcalendars.mathesisml.comcpcontacts.mathesisml.commail.mathesisml.commathesisml.comwebdisk.mathesisml.comwebmail.mathesisml.comwww.mathesisml.com
autodiscover.icm.ano.mybluehost.mecpanel.icm.ano.mybluehost.mecpcalendars.icm.ano.mybluehost.mecpcontacts.icm.ano.mybluehost.meicm.ano.mybluehost.memail.icm.ano.mybluehost.mewebdisk.icm.ano.mybluehost.mewebmail.icm.ano.mybluehost.mewww.icm.ano.mybluehost.me
alicexinliu.comautodiscover.alicexinliu.comcpanel.alicexinliu.comcpcalendars.alicexinliu.comcpcontacts.alicexinliu.commail.alicexinliu.comwebdisk.alicexinliu.comwebmail.alicexinliu.comwww.alicexinliu.com
autodiscover.tredemapping.comcpanel.tredemapping.comcpcalendars.tredemapping.comcpcontacts.tredemapping.commail.tredemapping.comtredemapping.comwebdisk.tredemapping.comwebmail.tredemapping.comwww.tredemapping.com
autodiscover.rodolfistasdecorazon.comautodiscover.rodolfistasdecorazon.orgcpanel.rodolfistasdecorazon.comcpanel.rodolfistasdecorazon.orgcpcalendars.rodolfistasdecorazon.comcpcalendars.rodolfistasdecorazon.orgcpcontacts.rodolfistasdecorazon.comcpcontacts.rodolfistasdecorazon.orgmail.rodolfistasdecorazon.commail.rodolfistasdecorazon.orgrodolfistasdecorazon-org.usi.jso.mybluehost.merodolfistasdecorazon.comrodolfistasdecorazon.orgrodolfistasdecorazon.usi.jso.mybluehost.mewebdisk.rodolfistasdecorazon.comwebdisk.rodolfistasdecorazon.orgwebmail.rodolfistasdecorazon.comwebmail.rodolfistasdecorazon.orgwww.rodolfistasdecorazon-org.usi.jso.mybluehost.mewww.rodolfistasdecorazon.comwww.rodolfistasdecorazon.orgwww.rodolfistasdecorazon.usi.jso.mybluehost.me
autodiscover.toptrippicks.comcpanel.toptrippicks.comcpcalendars.toptrippicks.comcpcontacts.toptrippicks.commail.toptrippicks.comtoptrippicks.comwebdisk.toptrippicks.comwebmail.toptrippicks.comwebsite-ff8c04c5.ond.emu.mybluehost.mewww.toptrippicks.comwww.website-ff8c04c5.ond.emu.mybluehost.me
asilverliningcounseling.orgautodiscover.asilverliningcounseling.orgcpanel.asilverliningcounseling.orgcpcalendars.asilverliningcounseling.orgcpcontacts.asilverliningcounseling.orgmail.asilverliningcounseling.orgwebdisk.asilverliningcounseling.orgwebmail.asilverliningcounseling.orgwww.asilverliningcounseling.org
allergypacific.comautodiscover.uio.ifs.mybluehost.mecpanel.uio.ifs.mybluehost.mecpcalendars.uio.ifs.mybluehost.mecpcontacts.uio.ifs.mybluehost.memail.allergypacific.commail.uio.ifs.mybluehost.meuio.ifs.mybluehost.mewebdisk.uio.ifs.mybluehost.mewebmail.uio.ifs.mybluehost.mewww.allergypacific.comwww.uio.ifs.mybluehost.me
autodiscover.karenjadams.netcpanel.karenjadams.netcpcalendars.karenjadams.netcpcontacts.karenjadams.netkarenjadams.netmail.karenjadams.netmail.penprojects.compenprojects.comwebdisk.karenjadams.netwebmail.karenjadams.netwww.karenjadams.netwww.penprojects.com
autodiscover.cpapostolichub.orgcpanel.cpapostolichub.orgcpapostolichub.orgcpcalendars.cpapostolichub.orgcpcontacts.cpapostolichub.orgmail.cpapostolichub.orgwebdisk.cpapostolichub.orgwebmail.cpapostolichub.orgwebsite-e336fcc6.uuq.xxm.mybluehost.mewww.cpapostolichub.orgwww.website-e336fcc6.uuq.xxm.mybluehost.me
autodiscover.barnesmailftw.combarnesmailftw.comcpanel.barnesmailftw.comcpcalendars.barnesmailftw.comcpcontacts.barnesmailftw.commail.barnesmailftw.comwebdisk.barnesmailftw.comwebmail.barnesmailftw.comwww.barnesmailftw.com
autodiscover.badgesoffraud.combadgesoffraud.comcpanel.badgesoffraud.comcpcalendars.badgesoffraud.comcpcontacts.badgesoffraud.commail.badgesoffraud.comwebdisk.badgesoffraud.comwebmail.badgesoffraud.comwww.badgesoffraud.com
autodiscover.pon.lgu.mybluehost.mecpanel.pon.lgu.mybluehost.mecpcalendars.pon.lgu.mybluehost.mecpcontacts.pon.lgu.mybluehost.memail.pon.lgu.mybluehost.memail.supermarket2amigosgmail.compon.lgu.mybluehost.mesupermarket2amigosgmail.comwebdisk.pon.lgu.mybluehost.mewebmail.pon.lgu.mybluehost.mewww.pon.lgu.mybluehost.mewww.supermarket2amigosgmail.com
autodiscover.theax.netcpanel.theax.netcpcalendars.theax.netcpcontacts.theax.netmail.qhs.kdq.mybluehost.meqhs.kdq.mybluehost.metheax.netwebdisk.theax.netwebmail.theax.netwww.qhs.kdq.mybluehost.mewww.theax.net
abe.oqk.mybluehost.meautodiscover.abe.oqk.mybluehost.mecpanel.abe.oqk.mybluehost.mecpcalendars.abe.oqk.mybluehost.mecpcontacts.abe.oqk.mybluehost.mecurlyhairproducts.commail.abe.oqk.mybluehost.mewebdisk.abe.oqk.mybluehost.mewebmail.abe.oqk.mybluehost.mewww.abe.oqk.mybluehost.mewww.curlyhairproducts.com
website-bd5878c6.harmonywithtruenature.comwww.website-bd5878c6.harmonywithtruenature.com
autodiscover.tribewoman.comcpanel.tribewoman.comcpcalendars.tribewoman.comcpcontacts.tribewoman.commail.tribewoman.comtribewoman.comwebdisk.tribewoman.comwebmail.tribewoman.comwww.tribewoman.com
autodiscover.codeflex.cocodeflex.cocpanel.codeflex.cocpcalendars.codeflex.cocpcontacts.codeflex.comail.codeflex.cowebdisk.codeflex.cowebmail.codeflex.cowww.codeflex.co
autodiscover.georgiaparis.netcpanel.georgiaparis.netcpcalendars.georgiaparis.netcpcontacts.georgiaparis.netgeorgiaparis.netmail.georgiaparis.netwebdisk.georgiaparis.netwebmail.georgiaparis.netwebsite-6079b47d.wqb.fgc.mybluehost.mewww.georgiaparis.netwww.website-6079b47d.wqb.fgc.mybluehost.me
autodiscover.ngt.mje.mybluehost.mecpanel.ngt.mje.mybluehost.mecpcalendars.ngt.mje.mybluehost.mecpcontacts.ngt.mje.mybluehost.mehosnakalantar.commail.hosnakalantar.commail.ngt.mje.mybluehost.mengt.mje.mybluehost.mewebdisk.ngt.mje.mybluehost.mewebmail.ngt.mje.mybluehost.mewww.hosnakalantar.comwww.ngt.mje.mybluehost.me
autodiscover.us-scientific.comcpanel.us-scientific.comcpcalendars.us-scientific.comcpcontacts.us-scientific.commail.us-scientific.comus-scientific.comwebdisk.us-scientific.comwebmail.us-scientific.comwww.us-scientific.com
autodiscover.ypk.abf.mybluehost.mecascadesignaturephotography.comcpanel.ypk.abf.mybluehost.mecpcalendars.ypk.abf.mybluehost.mecpcontacts.ypk.abf.mybluehost.memail.cascadesignaturephotography.commail.ypk.abf.mybluehost.mewebdisk.ypk.abf.mybluehost.mewebmail.ypk.abf.mybluehost.mewww.cascadesignaturephotography.comwww.ypk.abf.mybluehost.meypk.abf.mybluehost.me
autodiscover.laasool.comcpanel.laasool.comcpcalendars.laasool.comcpcontacts.laasool.comlaasool.commail.laasool.comwebdisk.laasool.comwebmail.laasool.comwww.laasool.com
autodiscover.theressomuchgood.comcpanel.theressomuchgood.comcpcalendars.theressomuchgood.comcpcontacts.theressomuchgood.commail.theressomuchgood.comtheressomuchgood.comwebdisk.theressomuchgood.comwebmail.theressomuchgood.comwww.theressomuchgood.com
autodiscover.ttw.nqg.mybluehost.mecpanel.ttw.nqg.mybluehost.mecpcalendars.ttw.nqg.mybluehost.mecpcontacts.ttw.nqg.mybluehost.memail.ttw.nqg.mybluehost.mettw.nqg.mybluehost.mewebdisk.ttw.nqg.mybluehost.mewebmail.ttw.nqg.mybluehost.mewww.ttw.nqg.mybluehost.me
andyrobinetguitar.androidrobotproductions.comandyrobinetguitar.comandyrobinetmusic.androidrobotproductions.comandyrobinetmusic.comautodiscover.andyrobinetguitar.comautodiscover.andyrobinetmusic.comcpanel.andyrobinetguitar.comcpanel.andyrobinetmusic.comcpcalendars.andyrobinetguitar.comcpcalendars.andyrobinetmusic.comcpcontacts.andyrobinetguitar.comcpcontacts.andyrobinetmusic.commail.andyrobinetguitar.commail.andyrobinetmusic.comwebdisk.andyrobinetguitar.comwebdisk.andyrobinetmusic.comwebmail.andyrobinetguitar.comwebmail.andyrobinetmusic.comwww.andyrobinetguitar.androidrobotproductions.comwww.andyrobinetguitar.comwww.andyrobinetmusic.androidrobotproductions.comwww.andyrobinetmusic.com
autodiscover.mindyourownbirth.cacpanel.mindyourownbirth.cacpcalendars.mindyourownbirth.cacpcontacts.mindyourownbirth.camail.mindyourownbirth.camindyourownbirth-ca.mindyourown.lifemindyourownbirth.cawebdisk.mindyourownbirth.cawebmail.mindyourownbirth.cawww.mindyourownbirth-ca.mindyourown.lifewww.mindyourownbirth.ca
autodiscover.doulosapologetics.comcpanel.doulosapologetics.comcpcalendars.doulosapologetics.comcpcontacts.doulosapologetics.comdoulosapologetics.commail.doulosapologetics.comwebdisk.doulosapologetics.comwebmail.doulosapologetics.comwww.doulosapologetics.com
autodiscover.ljs.hzh.mybluehost.mecpanel.ljs.hzh.mybluehost.mecpcalendars.ljs.hzh.mybluehost.mecpcontacts.ljs.hzh.mybluehost.meljs.hzh.mybluehost.memail.ljs.hzh.mybluehost.memail.roamtobreathe.comroamtobreathe.comwebdisk.ljs.hzh.mybluehost.mewebmail.ljs.hzh.mybluehost.mewww.ljs.hzh.mybluehost.mewww.roamtobreathe.com
autodiscover.soullightguidance.comcpanel.soullightguidance.comcpcalendars.soullightguidance.comcpcontacts.soullightguidance.commail.soullightguidance.comsoullightguidance.comwebdisk.soullightguidance.comwebmail.soullightguidance.comwww.soullightguidance.com
autodiscover.dgk.rts.mybluehost.mecpanel.dgk.rts.mybluehost.mecpcalendars.dgk.rts.mybluehost.mecpcontacts.dgk.rts.mybluehost.medgk.rts.mybluehost.memail.dgk.rts.mybluehost.mesandiparkhurst.comwebdisk.dgk.rts.mybluehost.mewebmail.dgk.rts.mybluehost.mewww.dgk.rts.mybluehost.mewww.sandiparkhurst.com
autodiscover.wyh.ylh.mybluehost.mecpanel.wyh.ylh.mybluehost.mecpcalendars.wyh.ylh.mybluehost.mecpcontacts.wyh.ylh.mybluehost.memail.wyh.ylh.mybluehost.mewebdisk.wyh.ylh.mybluehost.mewebmail.wyh.ylh.mybluehost.mewww.wyh.ylh.mybluehost.mewyh.ylh.mybluehost.me
autodiscover.pezlogic.comcpanel.pezlogic.comcpcalendars.pezlogic.comcpcontacts.pezlogic.commail.pezlogic.compezlogic.comwebdisk.pezlogic.comwebmail.pezlogic.comwww.pezlogic.com
autodiscover.sph.zca.mybluehost.mecpanel.sph.zca.mybluehost.mecpcalendars.sph.zca.mybluehost.mecpcontacts.sph.zca.mybluehost.memail.sph.zca.mybluehost.mesph.zca.mybluehost.mewebdisk.sph.zca.mybluehost.mewebmail.sph.zca.mybluehost.mewww.sph.zca.mybluehost.me
autodiscover.yrp.vhl.mybluehost.mecpanel.yrp.vhl.mybluehost.mecpcalendars.yrp.vhl.mybluehost.mecpcontacts.yrp.vhl.mybluehost.meglobaltechdist.co.ukmail.yrp.vhl.mybluehost.mewebdisk.yrp.vhl.mybluehost.mewebmail.yrp.vhl.mybluehost.mewww.globaltechdist.co.ukwww.yrp.vhl.mybluehost.meyrp.vhl.mybluehost.me
autodiscover.liketheholiday.comcpanel.liketheholiday.comcpcalendars.liketheholiday.comcpcontacts.liketheholiday.comliketheholiday.commail.liketheholiday.comwebdisk.liketheholiday.comwebmail.liketheholiday.comwww.liketheholiday.com
autodiscover.sgp.zaz.mybluehost.mebookowlebooks.comcpanel.sgp.zaz.mybluehost.mecpcalendars.sgp.zaz.mybluehost.mecpcontacts.sgp.zaz.mybluehost.memail.bookowlebooks.commail.sgp.zaz.mybluehost.mesgp.zaz.mybluehost.mewebdisk.sgp.zaz.mybluehost.mewebmail.sgp.zaz.mybluehost.mewww.bookowlebooks.comwww.sgp.zaz.mybluehost.me
autodiscover.cdr.rgy.mybluehost.mecdr.rgy.mybluehost.mecpanel.cdr.rgy.mybluehost.mecpcalendars.cdr.rgy.mybluehost.mecpcontacts.cdr.rgy.mybluehost.memail.cdr.rgy.mybluehost.memail.unowhomarketing.comunowhomarketing.comwebdisk.cdr.rgy.mybluehost.mewebmail.cdr.rgy.mybluehost.mewww.cdr.rgy.mybluehost.mewww.unowhomarketing.com
autodiscover.ecg.abf.mybluehost.mecpanel.ecg.abf.mybluehost.mecpcalendars.ecg.abf.mybluehost.mecpcontacts.ecg.abf.mybluehost.meecg.abf.mybluehost.memail.ecg.abf.mybluehost.mewebdisk.ecg.abf.mybluehost.mewebmail.ecg.abf.mybluehost.mewww.ecg.abf.mybluehost.me
anisumakenya.co.keanisumatraders.comautodiscover.anisumakenya.co.keautodiscover.anisumatraders.comcpanel.anisumakenya.co.kecpanel.anisumatraders.comcpcalendars.anisumakenya.co.kecpcalendars.anisumatraders.comcpcontacts.anisumakenya.co.kecpcontacts.anisumatraders.commail.anisumakenya.co.kemail.anisumatraders.commail.wpr.bwk.mybluehost.mewebdisk.anisumakenya.co.kewebdisk.anisumatraders.comwebmail.anisumakenya.co.kewebmail.anisumatraders.comwebsite-d7854ecc.anisumakenya.co.kewpr.bwk.mybluehost.mewww.anisumakenya.co.kewww.anisumatraders.comwww.website-d7854ecc.anisumakenya.co.kewww.wpr.bwk.mybluehost.me
autodiscover.makemeupmiki.comcpanel.makemeupmiki.comcpcalendars.makemeupmiki.comcpcontacts.makemeupmiki.commail.makemeupmiki.commakemeupmiki.comwebdisk.makemeupmiki.comwebmail.makemeupmiki.comwww.makemeupmiki.com
autodiscover.mgp.zyv.mybluehost.mecpanel.mgp.zyv.mybluehost.mecpcalendars.mgp.zyv.mybluehost.mecpcontacts.mgp.zyv.mybluehost.memail.mgp.zyv.mybluehost.memail.yanbenotmane.commgp.zyv.mybluehost.mewebdisk.mgp.zyv.mybluehost.mewebmail.mgp.zyv.mybluehost.mewww.mgp.zyv.mybluehost.mewww.yanbenotmane.comyanbenotmane.com
autodiscover.sbj.fih.mybluehost.mecpanel.sbj.fih.mybluehost.mecpcalendars.sbj.fih.mybluehost.mecpcontacts.sbj.fih.mybluehost.memail.sassy-frugal-mom-of-3.commail.sbj.fih.mybluehost.mesassy-frugal-mom-of-3.comsbj.fih.mybluehost.mewebdisk.sbj.fih.mybluehost.mewebmail.sbj.fih.mybluehost.mewww.sassy-frugal-mom-of-3.comwww.sbj.fih.mybluehost.me
autodiscover.ofg.mqz.mybluehost.mecpanel.ofg.mqz.mybluehost.mecpcalendars.ofg.mqz.mybluehost.mecpcontacts.ofg.mqz.mybluehost.memail.ofg.mqz.mybluehost.memail.studiobyzantium.spaceofg.mqz.mybluehost.mestudiobyzantium.spacewebdisk.ofg.mqz.mybluehost.mewebmail.ofg.mqz.mybluehost.mewww.ofg.mqz.mybluehost.mewww.studiobyzantium.space
autodiscover.silhouetteleah.comcpanel.silhouetteleah.comcpcalendars.silhouetteleah.comcpcontacts.silhouetteleah.comhairsolutions12.duyanebeauty.commail.silhouetteleah.comsilhouetteleah.comsilhouetteleah.duyanebeauty.comwebdisk.silhouetteleah.comwebmail.silhouetteleah.comwww.hairsolutions12.duyanebeauty.comwww.silhouetteleah.comwww.silhouetteleah.duyanebeauty.com
autodiscover.dietarycafe.comautodiscover.sunmul-gift.comcpanel.dietarycafe.comcpanel.sunmul-gift.comcpcalendars.dietarycafe.comcpcalendars.sunmul-gift.comcpcontacts.dietarycafe.comcpcontacts.sunmul-gift.comdietarycafe.comdietarycafe.sunmulgift.commail.dietarycafe.commail.sunmul-gift.comsunmul-gift.comsunmul-gift.sunmulgift.comwebdisk.dietarycafe.comwebdisk.sunmul-gift.comwebmail.dietarycafe.comwebmail.sunmul-gift.comwww.dietarycafe.comwww.dietarycafe.sunmulgift.comwww.sunmul-gift.comwww.sunmul-gift.sunmulgift.com
autodiscover.sunpring.comcpanel.sunpring.comcpcalendars.sunpring.comcpcontacts.sunpring.comfrkplant-net.sunpringextruder.comfrkplant.netmail.sunpring.comsunpring.comsunpring.sunpringextruder.comsunpringcom.sunpringextruder.comwebdisk.sunpring.comwebmail.sunpring.comwww.frkplant-net.sunpringextruder.comwww.frkplant.netwww.sunpring.comwww.sunpring.sunpringextruder.comwww.sunpringcom.sunpringextruder.com
autodiscover.fvb.bof.mybluehost.mecpanel.fvb.bof.mybluehost.mecpcalendars.fvb.bof.mybluehost.mecpcontacts.fvb.bof.mybluehost.mefvb.bof.mybluehost.memail.fvb.bof.mybluehost.mewebdisk.fvb.bof.mybluehost.mewebmail.fvb.bof.mybluehost.mewww.fvb.bof.mybluehost.me
autodiscover.mhsdebatealumni.comcpanel.mhsdebatealumni.comcpcalendars.mhsdebatealumni.comcpcontacts.mhsdebatealumni.commail.mhsdebatealumni.commhsdebatealumni.comwebdisk.mhsdebatealumni.comwebmail.mhsdebatealumni.comwww.mhsdebatealumni.com
autodiscover.foolersinc.comautodiscover.keyawagroup.comcpanel.foolersinc.comcpanel.keyawagroup.comcpcalendars.foolersinc.comcpcalendars.keyawagroup.comcpcontacts.foolersinc.comcpcontacts.keyawagroup.comfoolersinc.comfoolersinc.keyawagroup.comgustordonez.keyawagroup.comkeyawagroup.comkeyawagroup.keyawagroup.commail.foolersinc.commail.keyawagroup.comwebdisk.foolersinc.comwebdisk.keyawagroup.comwebmail.foolersinc.comwebmail.keyawagroup.comwww.foolersinc.comwww.foolersinc.keyawagroup.comwww.gustordonez.keyawagroup.comwww.keyawagroup.comwww.keyawagroup.keyawagroup.com
autodiscover.charbonneaugreenshoa.orgcharbonneaugreenhoa.orgcharbonneaugreenshoa.orgcpanel.charbonneaugreenshoa.orgcpcalendars.charbonneaugreenshoa.orgcpcontacts.charbonneaugreenshoa.orgmail.charbonneaugreenhoa.orgmail.charbonneaugreenshoa.orgwebdisk.charbonneaugreenshoa.orgwebmail.charbonneaugreenshoa.orgwww.charbonneaugreenhoa.orgwww.charbonneaugreenshoa.org
autodiscover.rgt.uqp.mybluehost.mecpanel.rgt.uqp.mybluehost.mecpcalendars.rgt.uqp.mybluehost.mecpcontacts.rgt.uqp.mybluehost.memail.rgt.uqp.mybluehost.memail.zerononsensebeauty.comrgt.uqp.mybluehost.mewebdisk.rgt.uqp.mybluehost.mewebmail.rgt.uqp.mybluehost.mewww.rgt.uqp.mybluehost.mewww.zerononsensebeauty.comzerononsensebeauty.com
akq.rfn.mybluehost.meautodiscover.akq.rfn.mybluehost.mecpanel.akq.rfn.mybluehost.mecpcalendars.akq.rfn.mybluehost.mecpcontacts.akq.rfn.mybluehost.memail.akq.rfn.mybluehost.mewebdisk.akq.rfn.mybluehost.mewebmail.akq.rfn.mybluehost.mewww.akq.rfn.mybluehost.me
autodiscover.britishseabuckthorn.combritishseabuckthorn.comcpanel.britishseabuckthorn.comcpcalendars.britishseabuckthorn.comcpcontacts.britishseabuckthorn.commail.britishseabuckthorn.comwebdisk.britishseabuckthorn.comwebmail.britishseabuckthorn.comwww.britishseabuckthorn.com
autodiscover.mql.ghe.mybluehost.mecpanel.mql.ghe.mybluehost.mecpcalendars.mql.ghe.mybluehost.mecpcontacts.mql.ghe.mybluehost.mekudenservice200.commail.kudenservice200.commail.mql.ghe.mybluehost.memql.ghe.mybluehost.mewebdisk.mql.ghe.mybluehost.mewebmail.mql.ghe.mybluehost.mewww.kudenservice200.comwww.mql.ghe.mybluehost.me
autodiscover.themodevents.comcpanel.themodevents.comcpcalendars.themodevents.comcpcontacts.themodevents.commail.themodevents.comthemodevents.comthemodevents.iib.jso.mybluehost.mewebdisk.themodevents.comwebmail.themodevents.comwww.themodevents.comwww.themodevents.iib.jso.mybluehost.me
autodiscover.wordfortress.comcpanel.wordfortress.comcpcalendars.wordfortress.comcpcontacts.wordfortress.commail.wordfortress.comwebdisk.wordfortress.comwebmail.wordfortress.comwordfortress.comwordfortress.justingolding.comwww.wordfortress.comwww.wordfortress.justingolding.com
cpanel.doabatruck.comcpcalendars.doabatruck.comdoabatruck.comwww.doabatruck.com
exterior.uprcwichita.comwww.exterior.uprcwichita.com
autodiscover.prepperstool.comcpanel.prepperstool.comcpcalendars.prepperstool.comcpcontacts.prepperstool.commail.prepperstool.comprepperstool.comprepperstool.hza.chb.mybluehost.mewebdisk.prepperstool.comwebmail.prepperstool.comwww.prepperstool.comwww.prepperstool.hza.chb.mybluehost.me
autodiscover.kidzcomics.comcpanel.kidzcomics.comcpcalendars.kidzcomics.comcpcontacts.kidzcomics.comkidzcomics.comkidzcomics.sunmulgift.commail.kidzcomics.comwebdisk.kidzcomics.comwebmail.kidzcomics.comwww.kidzcomics.comwww.kidzcomics.sunmulgift.com
autodiscover.createwebsiteseasily.comautodiscover.ennvisionn.comcpanel.createwebsiteseasily.comcpanel.ennvisionn.comcpcalendars.createwebsiteseasily.comcpcalendars.ennvisionn.comcpcontacts.createwebsiteseasily.comcpcontacts.ennvisionn.comcreatewebsiteseasily.comennvisionn.comennvisionn.createwebsiteseasily.commail.createwebsiteseasily.commail.ennvisionn.comwebdisk.createwebsiteseasily.comwebdisk.ennvisionn.comwebmail.createwebsiteseasily.comwebmail.ennvisionn.comwww.createwebsiteseasily.comwww.ennvisionn.comwww.ennvisionn.createwebsiteseasily.com
autodiscover.henryjoseph.comcpanel.henryjoseph.comcpcalendars.henryjoseph.comcpcontacts.henryjoseph.comhenryjoseph.comhenryjoseph.spokespersonagency.commail.henryjoseph.comwebdisk.henryjoseph.comwebmail.henryjoseph.comwww.henryjoseph.comwww.henryjoseph.spokespersonagency.com
archenergygroup.comarchenergygroup.hydrocarbonexchange.comcpanel.archenergygroup.comcpcalendars.archenergygroup.comcpcontacts.archenergygroup.commail.archenergygroup.comwebdisk.archenergygroup.comwebmail.archenergygroup.comwww.archenergygroup.comwww.archenergygroup.hydrocarbonexchange.com
autodiscover.kfarringtondesigns.comcpanel.kfarringtondesigns.comcpcalendars.kfarringtondesigns.comcpcontacts.kfarringtondesigns.comkfarringtondesigns.commail.kfarringtondesigns.comwebdisk.kfarringtondesigns.comwebmail.kfarringtondesigns.comwww.kfarringtondesigns.com
autodiscover.fqy.bsv.mybluehost.mecpanel.fqy.bsv.mybluehost.mecpcalendars.fqy.bsv.mybluehost.mecpcontacts.fqy.bsv.mybluehost.mefoundartfactory-net.fqy.bsv.mybluehost.mefoundartfactory.netfqy.bsv.mybluehost.memail.foundartfactory.netmail.fqy.bsv.mybluehost.mewebdisk.fqy.bsv.mybluehost.mewebmail.fqy.bsv.mybluehost.mewww.foundartfactory-net.fqy.bsv.mybluehost.mewww.foundartfactory.netwww.fqy.bsv.mybluehost.me
autodiscover.evd.zcr.mybluehost.mecpanel.evd.zcr.mybluehost.mecpcalendars.evd.zcr.mybluehost.mecpcontacts.evd.zcr.mybluehost.mecrefemme.comevd.zcr.mybluehost.memail.crefemme.commail.evd.zcr.mybluehost.mewebdisk.evd.zcr.mybluehost.mewebmail.evd.zcr.mybluehost.mewww.crefemme.comwww.evd.zcr.mybluehost.me
autodiscover.cisosecsolutions.comcisosecsolutions.comcpanel.cisosecsolutions.comcpcalendars.cisosecsolutions.comcpcontacts.cisosecsolutions.commail.cisosecsolutions.comwebdisk.cisosecsolutions.comwebmail.cisosecsolutions.comwww.cisosecsolutions.com
autodiscover.wiq.jru.mybluehost.mecpanel.wiq.jru.mybluehost.mecpcalendars.wiq.jru.mybluehost.mecpcontacts.wiq.jru.mybluehost.memail.wiq.jru.mybluehost.mewebdisk.wiq.jru.mybluehost.mewebmail.wiq.jru.mybluehost.mewiq.jru.mybluehost.mewww.wiq.jru.mybluehost.me
autodiscover.forensicpocketguide.comcpanel.forensicpocketguide.comcpcalendars.forensicpocketguide.comcpcontacts.forensicpocketguide.comforensicpocketguide.comine.rdx.mybluehost.memail.forensicpocketguide.commail.ine.rdx.mybluehost.mewebdisk.forensicpocketguide.comwebmail.forensicpocketguide.comwww.forensicpocketguide.comwww.ine.rdx.mybluehost.me
autodiscover.modernafencela.comautodiscover.modernafencesolutions.comcpanel.modernafencela.comcpanel.modernafencesolutions.comcpcalendars.modernafencela.comcpcalendars.modernafencesolutions.comcpcontacts.modernafencela.comcpcontacts.modernafencesolutions.commail.modernafencela.commail.modernafencesolutions.commodernafencela.commodernafencesolutions.commodernafencesolutions.modernafencela.comwebdisk.modernafencela.comwebdisk.modernafencesolutions.comwebmail.modernafencela.comwebmail.modernafencesolutions.comwww.modernafencela.comwww.modernafencesolutions.comwww.modernafencesolutions.modernafencela.com
autodiscover.btw.slw.mybluehost.mebtw.slw.mybluehost.mecpanel.btw.slw.mybluehost.mecpcalendars.btw.slw.mybluehost.mecpcontacts.btw.slw.mybluehost.memail.btw.slw.mybluehost.mewebdisk.btw.slw.mybluehost.mewebmail.btw.slw.mybluehost.mewww.btw.slw.mybluehost.me
autodiscover.generalcontractorcapemay.comautodiscover.southjerseyhomeadditions.comcpanel.generalcontractorcapemay.comcpanel.southjerseyhomeadditions.comcpcalendars.generalcontractorcapemay.comcpcalendars.southjerseyhomeadditions.comcpcontacts.generalcontractorcapemay.comcpcontacts.southjerseyhomeadditions.comgeneralcontractorcapemay.commail.generalcontractorcapemay.commail.southjerseyhomeadditions.comsouthjerseyhomeadditions.comwebdisk.generalcontractorcapemay.comwebdisk.southjerseyhomeadditions.comwebmail.generalcontractorcapemay.comwebmail.southjerseyhomeadditions.comwebsite-9fc6149c.ygo.bsd.mybluehost.mewebsite-e8fb4000.ygo.bsd.mybluehost.mewww.generalcontractorcapemay.comwww.southjerseyhomeadditions.comwww.website-9fc6149c.ygo.bsd.mybluehost.mewww.website-e8fb4000.ygo.bsd.mybluehost.me
autodiscover.gnsenterprises.com.pkcpanel.gnsenterprises.com.pkcpcalendars.gnsenterprises.com.pkcpcontacts.gnsenterprises.com.pkgnsenterprises.com.pkmail.gnsenterprises.com.pkwebdisk.gnsenterprises.com.pkwebmail.gnsenterprises.com.pkwebsite-4d30039e.xlr.kdb.mybluehost.mewww.gnsenterprises.com.pkwww.website-4d30039e.xlr.kdb.mybluehost.me
cpanel.pcproblems.comcpcalendars.pcproblems.comcpcontacts.pcproblems.commail.pcproblems.commail.ryw.etw.mybluehost.mepcproblems.comryw.etw.mybluehost.mewebdisk.pcproblems.comwebmail.pcproblems.comwww.pcproblems.comwww.ryw.etw.mybluehost.me
autodiscover.happyhollowchildcare.comcpanel.happyhollowchildcare.comcpcalendars.happyhollowchildcare.comcpcontacts.happyhollowchildcare.comhappyhollowchildcare.commail.happyhollowchildcare.comwebdisk.happyhollowchildcare.comwebmail.happyhollowchildcare.comwww.happyhollowchildcare.com
autodiscover.whooi.comcpanel.whooi.comcpcalendars.whooi.comcpcontacts.whooi.commail.whooi.comwebdisk.whooi.comwebmail.whooi.comwhooi.comwhooi.mwz.rrh.mybluehost.mewww.whooi.comwww.whooi.mwz.rrh.mybluehost.me
autodiscover.shrmehdi.comchangeskills.comchangeskills.thementoringprogram.comcpanel.changeskills.comcpanel.shrmehdi.comcpcalendars.changeskills.comcpcalendars.shrmehdi.comcpcontacts.changeskills.comcpcontacts.shrmehdi.commail.shrmehdi.comshrmehdi.comshrmehdi.thementoringprogram.comwebdisk.changeskills.comwebdisk.shrmehdi.comwebmail.changeskills.comwebmail.shrmehdi.comwww.changeskills.comwww.changeskills.thementoringprogram.comwww.shrmehdi.comwww.shrmehdi.thementoringprogram.com
autodiscover.zelayasconstruction.comcpanel.zelayasconstruction.comcpcalendars.zelayasconstruction.comcpcontacts.zelayasconstruction.comeqy.nmb.mybluehost.memail.eqy.nmb.mybluehost.memail.zelayasconstruction.comwebdisk.zelayasconstruction.comwebmail.zelayasconstruction.comwww.eqy.nmb.mybluehost.mewww.zelayasconstruction.comzelayasconstruction.com
cpanel.doxentrics.comcpcalendars.doxentrics.comcpcontacts.doxentrics.comdoxentrics.commail.doxentrics.comwebdisk.doxentrics.comwebmail.doxentrics.comwww.doxentrics.com
autodiscover.eidegames.comcpanel.eidegames.comcpcalendars.eidegames.comcpcontacts.eidegames.comeidegames.comeidegames.eoj.xmy.mybluehost.memail.eidegames.comwebdisk.eidegames.comwebmail.eidegames.comwww.eidegames.comwww.eidegames.eoj.xmy.mybluehost.me
artaffairs.galleryautodiscover.artaffairs.gallerycpanel.artaffairs.gallerycpcalendars.artaffairs.gallerycpcontacts.artaffairs.gallerymail.artaffairs.gallerywebdisk.artaffairs.gallerywebmail.artaffairs.gallerywww.artaffairs.gallery
autodiscover.nourishedwithlia.comcpanel.nourishedwithlia.comcpcalendars.nourishedwithlia.comcpcontacts.nourishedwithlia.commail.nourishedwithlia.comnourishedwithlia.comwebdisk.nourishedwithlia.comwebmail.nourishedwithlia.comwww.nourishedwithlia.com
autodiscover.bsv.kdq.mybluehost.mebsv.kdq.mybluehost.mecpanel.bsv.kdq.mybluehost.mecpcalendars.bsv.kdq.mybluehost.mecpcontacts.bsv.kdq.mybluehost.memail.bsv.kdq.mybluehost.memail.mossbayhall.commossbayhall.comwebdisk.bsv.kdq.mybluehost.mewebmail.bsv.kdq.mybluehost.mewww.bsv.kdq.mybluehost.mewww.mossbayhall.com
mail.xcu.qtc.mybluehost.mewww.xcu.qtc.mybluehost.mexcu.qtc.mybluehost.me
autodiscover.badge3641detroit.combadge3641detroit.comcpanel.badge3641detroit.comcpcalendars.badge3641detroit.comcpcontacts.badge3641detroit.commail.badge3641detroit.comwebdisk.badge3641detroit.comwebmail.badge3641detroit.comwww.badge3641detroit.com
autodiscover.vjo.hgs.mybluehost.mecpanel.vjo.hgs.mybluehost.mecpcalendars.vjo.hgs.mybluehost.mecpcontacts.vjo.hgs.mybluehost.meindispensabilitypro.commail.vjo.hgs.mybluehost.mevjo.hgs.mybluehost.mewebdisk.vjo.hgs.mybluehost.mewebmail.vjo.hgs.mybluehost.mewww.indispensabilitypro.comwww.vjo.hgs.mybluehost.me
autodiscover.yorktownday.comcpanel.yorktownday.comcpcalendars.yorktownday.comcpcontacts.yorktownday.commail.yorktownday.comwebdisk.yorktownday.comwebmail.yorktownday.comwww.yorktownday.comwww.yorktownday.ypsva.orgyorktownday.comyorktownday.ypsva.org
autodiscover.christiansolidfood.comchristiansolidfood.comchristiansolidfood.duyanebeauty.comcpanel.christiansolidfood.comcpcalendars.christiansolidfood.comcpcontacts.christiansolidfood.commail.christiansolidfood.comsoarto7.duyanebeauty.comwebdisk.christiansolidfood.comwebmail.christiansolidfood.comwww.christiansolidfood.comwww.christiansolidfood.duyanebeauty.comwww.soarto7.duyanebeauty.com
autodiscover.szw.tui.mybluehost.mecpanel.szw.tui.mybluehost.mecpcalendars.szw.tui.mybluehost.mecpcontacts.szw.tui.mybluehost.memail.qatv4k.commail.szw.tui.mybluehost.meqatv4k.comszw.tui.mybluehost.mewebdisk.szw.tui.mybluehost.mewebmail.szw.tui.mybluehost.mewww.qatv4k.comwww.szw.tui.mybluehost.me
autodiscover.gpe.rsl.mybluehost.mecpanel.gpe.rsl.mybluehost.mecpcalendars.gpe.rsl.mybluehost.mecpcontacts.gpe.rsl.mybluehost.megpe.rsl.mybluehost.memail.gpe.rsl.mybluehost.memail.thelatenotes.commail.thelatenotesband.com.authelatenotes.comthelatenotesband.com.auwebdisk.gpe.rsl.mybluehost.mewebmail.gpe.rsl.mybluehost.mewww.gpe.rsl.mybluehost.mewww.thelatenotes.comwww.thelatenotesband.com.au
autodiscover.uhm.zca.mybluehost.mecpanel.uhm.zca.mybluehost.mecpcalendars.uhm.zca.mybluehost.mecpcontacts.uhm.zca.mybluehost.mejosefinarecruitment.commail.uhm.zca.mybluehost.meuhm.zca.mybluehost.mewebdisk.uhm.zca.mybluehost.mewebmail.uhm.zca.mybluehost.mewww.josefinarecruitment.comwww.uhm.zca.mybluehost.me
alisongifford.comalisongifford.yourstudydoctor.comautodiscover.alisongifford.comautodiscover.personalconfidencecode.comcpanel.alisongifford.comcpanel.personalconfidencecode.comcpcalendars.alisongifford.comcpcalendars.personalconfidencecode.comcpcontacts.alisongifford.comcpcontacts.personalconfidencecode.commail.alisongifford.commail.personalconfidencecode.compersonalconfidencecode.compersonalconfidencecode.yourstudydoctor.comwebdisk.alisongifford.comwebdisk.personalconfidencecode.comwebmail.alisongifford.comwebmail.personalconfidencecode.comwww.alisongifford.comwww.alisongifford.yourstudydoctor.comwww.personalconfidencecode.comwww.personalconfidencecode.yourstudydoctor.com
autodiscover.suncoastbaptistchurch.infocpanel.suncoastbaptistchurch.infocpcalendars.suncoastbaptistchurch.infocpcontacts.suncoastbaptistchurch.infomail.suncoastbaptistchurch.infosuncoastbaptistchurch.infowebdisk.suncoastbaptistchurch.infowebmail.suncoastbaptistchurch.infowww.suncoastbaptistchurch.info
autodiscover.jyk.com.gtcpanel.jyk.com.gtcpcalendars.jyk.com.gtcpcontacts.jyk.com.gtjyk.com.gtmail.jyk.com.gtwebdisk.jyk.com.gtwebmail.jyk.com.gtwww.jyk.com.gt
website-c04e6967.anc.xfn.mybluehost.mewww.website-c04e6967.anc.xfn.mybluehost.me
autodiscover.reverse-globalwarming.netcpanel.reverse-globalwarming.netcpcalendars.reverse-globalwarming.netcpcontacts.reverse-globalwarming.netmail.reverse-globalwarming.netreverse-globalwarming.netwebdisk.reverse-globalwarming.netwebmail.reverse-globalwarming.netwww.reverse-globalwarming.net
website-3840dcb4.qdc.vhl.mybluehost.mewww.website-3840dcb4.qdc.vhl.mybluehost.me
autodiscover.pixelscott.comcpanel.pixelscott.comcpcalendars.pixelscott.comcpcontacts.pixelscott.commail.pixelscott.compixelscott.comwebdisk.pixelscott.comwebmail.pixelscott.comwebsite-84d10498.qmd.bzx.mybluehost.mewww.pixelscott.comwww.website-84d10498.qmd.bzx.mybluehost.me
autodiscover.dynamic-rr.comcpanel.dynamic-rr.comcpcalendars.dynamic-rr.comcpcontacts.dynamic-rr.comdynamic-rr.commail.dynamic-rr.comroofestimator.dynamic-rr.comwebdisk.dynamic-rr.comwebmail.dynamic-rr.comwww.dynamic-rr.comwww.roofestimator.dynamic-rr.com
autodiscover.ygo.bsd.mybluehost.mecpanel.ygo.bsd.mybluehost.mecpcalendars.ygo.bsd.mybluehost.mecpcontacts.ygo.bsd.mybluehost.medeckbuilderofsouthjersey.commail.deckbuilderofsouthjersey.commail.ygo.bsd.mybluehost.mewebdisk.ygo.bsd.mybluehost.mewebmail.ygo.bsd.mybluehost.mewww.deckbuilderofsouthjersey.comwww.ygo.bsd.mybluehost.meygo.bsd.mybluehost.me
autodiscover.michaeljcordell.comcpanel.michaeljcordell.comcpcalendars.michaeljcordell.comcpcontacts.michaeljcordell.commail.michaeljcordell.commichaeljcordell.comwebdisk.michaeljcordell.comwebmail.michaeljcordell.comwww.michaeljcordell.com
autodiscover.lyy.wev.mybluehost.mecpanel.lyy.wev.mybluehost.mecpcalendars.lyy.wev.mybluehost.mecpcontacts.lyy.wev.mybluehost.melyy.wev.mybluehost.memail.lyy.wev.mybluehost.memail.trendzforlesslb.comtrendzforlesslb.comwebdisk.lyy.wev.mybluehost.mewebmail.lyy.wev.mybluehost.mewww.lyy.wev.mybluehost.mewww.trendzforlesslb.com
autodiscover.magneticminstrel.netcpanel.magneticminstrel.netcpcalendars.magneticminstrel.netcpcontacts.magneticminstrel.netmagneticminstrel.netmail.magneticminstrel.netwebdisk.magneticminstrel.netwebmail.magneticminstrel.netwebsite-0fe27fd5.wqb.fgc.mybluehost.mewww.magneticminstrel.netwww.website-0fe27fd5.wqb.fgc.mybluehost.me
autodiscover.ozr.duj.mybluehost.mecpanel.ozr.duj.mybluehost.mecpcalendars.ozr.duj.mybluehost.mecpcontacts.ozr.duj.mybluehost.memail.ozr.duj.mybluehost.memail.reverieparfums.comozr.duj.mybluehost.mereverieparfums.comwebdisk.ozr.duj.mybluehost.mewebmail.ozr.duj.mybluehost.mewww.ozr.duj.mybluehost.mewww.reverieparfums.com
autodiscover.thegaldamezlandscaping.comcpanel.thegaldamezlandscaping.comcpcalendars.thegaldamezlandscaping.comcpcontacts.thegaldamezlandscaping.commail.thegaldamezlandscaping.comthegaldamezlandscaping.comwebdisk.thegaldamezlandscaping.comwebmail.thegaldamezlandscaping.comwww.thegaldamezlandscaping.com
888lockuup.comautodiscover.888lockuup.comcpanel.888lockuup.comcpcalendars.888lockuup.comcpcontacts.888lockuup.commail.888lockuup.comwebdisk.888lockuup.comwebmail.888lockuup.comwww.888lockuup.com
autodiscover.smptheatre.ukcpanel.smptheatre.ukcpcalendars.smptheatre.ukcpcontacts.smptheatre.ukmail.smptheatre.uksmptheatre.ukwebdisk.smptheatre.ukwebmail.smptheatre.ukwww.smptheatre.uk
autodiscover.mygeotokens.comcpanel.mygeotokens.comcpcalendars.mygeotokens.comcpcontacts.mygeotokens.commail.mygeotokens.commygeotokens.commygeotokens.mindyourown.lifewebdisk.mygeotokens.comwebmail.mygeotokens.comwww.mygeotokens.comwww.mygeotokens.mindyourown.life
autodiscover.embassyofniger.orgcpanel.embassyofniger.orgcpcalendars.embassyofniger.orgcpcontacts.embassyofniger.orgembassyofniger.orglql.lqx.mybluehost.memail.embassyofniger.orgmail.lql.lqx.mybluehost.mewebdisk.embassyofniger.orgwebmail.embassyofniger.orgwww.embassyofniger.orgwww.lql.lqx.mybluehost.me
autodiscover.yvv.sup.mybluehost.mecpanel.yvv.sup.mybluehost.mecpcalendars.yvv.sup.mybluehost.mecpcontacts.yvv.sup.mybluehost.meekaktech.commail.yvv.sup.mybluehost.mewebdisk.yvv.sup.mybluehost.mewebmail.yvv.sup.mybluehost.mewww.ekaktech.comwww.yvv.sup.mybluehost.meyvv.sup.mybluehost.me
autodiscover.avaoliviaunlimited.comavaoliviaunlimited.comcpanel.avaoliviaunlimited.comcpcalendars.avaoliviaunlimited.comcpcontacts.avaoliviaunlimited.commail.avaoliviaunlimited.comwebdisk.avaoliviaunlimited.comwebmail.avaoliviaunlimited.comwww.avaoliviaunlimited.com
autodiscover.jenamartin.netcpanel.jenamartin.netcpcalendars.jenamartin.netcpcontacts.jenamartin.netjenamartin.netmail.jenamartin.netwebdisk.jenamartin.netwebmail.jenamartin.netwww.jenamartin.net
autodiscover.dgm.lnr.mybluehost.mecpanel.dgm.lnr.mybluehost.mecpcalendars.dgm.lnr.mybluehost.mecpcontacts.dgm.lnr.mybluehost.medgm.lnr.mybluehost.meliaholden.commail.dgm.lnr.mybluehost.mewebdisk.dgm.lnr.mybluehost.mewebmail.dgm.lnr.mybluehost.mewww.dgm.lnr.mybluehost.mewww.liaholden.com
autodiscover.hillts.comcpanel.hillts.comcpcalendars.hillts.comcpcontacts.hillts.comhillts.commail.hillts.comwebdisk.hillts.comwebmail.hillts.comwebsite-0bcb091d.tks.duj.mybluehost.mewww.hillts.comwww.website-0bcb091d.tks.duj.mybluehost.me
autodiscover.capeofdreams.comcapeofdreams.comcpanel.capeofdreams.comcpcalendars.capeofdreams.comcpcontacts.capeofdreams.commail.capeofdreams.comwebdisk.capeofdreams.comwebmail.capeofdreams.comwww.capeofdreams.com
frkextruder.comfrkextruder.sunpringextruder.comwww.frkextruder.comwww.frkextruder.sunpringextruder.com
wiredss.aewww.wiredss.ae
autodiscover.projectweekley.comcpanel.projectweekley.comcpcalendars.projectweekley.comcpcontacts.projectweekley.commail.projectweekley.comprojectweekley.comwebdisk.projectweekley.comwebmail.projectweekley.comwww.projectweekley.com
autodiscover.pxq.lnl.mybluehost.mecpanel.pxq.lnl.mybluehost.mecpcalendars.pxq.lnl.mybluehost.mecpcontacts.pxq.lnl.mybluehost.memail.pxq.lnl.mybluehost.mepxq.lnl.mybluehost.mewebdisk.pxq.lnl.mybluehost.mewebmail.pxq.lnl.mybluehost.mewww.pxq.lnl.mybluehost.me
autodiscover.tgw.jxc.mybluehost.mecpanel.tgw.jxc.mybluehost.mecpcalendars.tgw.jxc.mybluehost.mecpcontacts.tgw.jxc.mybluehost.memail.naturnorge.onlinemail.tgw.jxc.mybluehost.menaturnorge.onlinetgw.jxc.mybluehost.mewebdisk.tgw.jxc.mybluehost.mewebmail.tgw.jxc.mybluehost.mewww.naturnorge.onlinewww.tgw.jxc.mybluehost.me
centralvalleyliftpros.comcpanel.centralvalleyliftpros.comcpcalendars.centralvalleyliftpros.comcpcontacts.centralvalleyliftpros.commail.centralvalleyliftpros.comwebdisk.centralvalleyliftpros.comwebmail.centralvalleyliftpros.comwww.centralvalleyliftpros.com
autodiscover.ramenmom.comcpanel.ramenmom.comcpcalendars.ramenmom.comcpcontacts.ramenmom.commail.ramenmom.comramenmom.comwebdisk.ramenmom.comwebmail.ramenmom.comwww.ramenmom.com
autodiscover.julietafumberg.combalancedvirtually.combalancedvirtually.iib.jso.mybluehost.mecpanel.balancedvirtually.comcpanel.julietafumberg.comcpcalendars.balancedvirtually.comcpcalendars.julietafumberg.comcpcontacts.balancedvirtually.comcpcontacts.julietafumberg.comjulietafumberg.comjulietafumberg.iib.jso.mybluehost.memail.balancedvirtually.commail.julietafumberg.comwebdisk.balancedvirtually.comwebdisk.julietafumberg.comwebmail.balancedvirtually.comwebmail.julietafumberg.comwww.balancedvirtually.comwww.balancedvirtually.iib.jso.mybluehost.mewww.julietafumberg.comwww.julietafumberg.iib.jso.mybluehost.me
autodiscover.intgtech.comcpanel.intgtech.comcpcalendars.intgtech.comcpcontacts.intgtech.comintgtech.commail.intgtech.comwebdisk.intgtech.comwebmail.intgtech.comwww.intgtech.com
autodiscover.tcbuilderli.comcpanel.tcbuilderli.comcpcalendars.tcbuilderli.comcpcontacts.tcbuilderli.commail.tcbuilderli.comtcbuilderli.comwebdisk.tcbuilderli.comwebmail.tcbuilderli.comwww.tcbuilderli.com
thesilvergym.booktipper.comwww.thesilvergym.booktipper.com
autodiscover.tlk.rfl.mybluehost.mecpanel.tlk.rfl.mybluehost.mecpcalendars.tlk.rfl.mybluehost.mecpcontacts.tlk.rfl.mybluehost.megeogroupcorrections.commail.tlk.rfl.mybluehost.metlk.rfl.mybluehost.mewebdisk.tlk.rfl.mybluehost.mewebmail.tlk.rfl.mybluehost.mewww.geogroupcorrections.comwww.tlk.rfl.mybluehost.me
staging2020.stowetrails.orgwww.staging2020.stowetrails.org
autodiscover.oor.ylh.mybluehost.mecoachthomastech.comcpanel.oor.ylh.mybluehost.mecpcalendars.oor.ylh.mybluehost.mecpcontacts.oor.ylh.mybluehost.memail.coachthomastech.commail.oor.ylh.mybluehost.meoor.ylh.mybluehost.mewebdisk.oor.ylh.mybluehost.mewebmail.oor.ylh.mybluehost.mewww.coachthomastech.comwww.oor.ylh.mybluehost.me
cpanel.jehidalgorealestate.comcpcalendars.jehidalgorealestate.comcpcontacts.jehidalgorealestate.comjehidalgorealestate.commail.jehidalgorealestate.comwebdisk.jehidalgorealestate.comwebmail.jehidalgorealestate.comwww.jehidalgorealestate.com
autodiscover.rbgbank.comcpanel.rbgbank.comcpcalendars.rbgbank.comcpcontacts.rbgbank.commail.rbgbank.comrbgbank.comwebdisk.rbgbank.comwebmail.rbgbank.comwww.rbgbank.com
alvinwayneweiss.comautodiscover.alvinwayneweiss.comcpanel.alvinwayneweiss.comcpcalendars.alvinwayneweiss.comcpcontacts.alvinwayneweiss.commail.alvinwayneweiss.comwebdisk.alvinwayneweiss.comwebmail.alvinwayneweiss.comwww.alvinwayneweiss.com
autodiscover.choicesolutions.serviceschoicesolutions.servicescpanel.choicesolutions.servicescpcalendars.choicesolutions.servicescpcontacts.choicesolutions.servicesmail.choicesolutions.serviceswebdisk.choicesolutions.serviceswebmail.choicesolutions.serviceswww.choicesolutions.services
autodiscover.stowetrails.comcpanel.stowetrails.comcpanel.stowetrails.orgcpcalendars.stowetrails.comcpcalendars.stowetrails.orgcpcontacts.stowetrails.comcpcontacts.stowetrails.orgmail.stowetrails.commail.stowetrails.orgstowetrails-org.stowe-trails.comstowetrails.comstowetrails.orgstowetrails.stowe-trails.comwebdisk.stowetrails.comwebdisk.stowetrails.orgwebmail.stowetrails.comwebmail.stowetrails.orgwww.stowetrails-org.stowe-trails.comwww.stowetrails.comwww.stowetrails.orgwww.stowetrails.stowe-trails.com
autodiscover.ottawallpaper.comcpanel.ottawallpaper.comcpcalendars.ottawallpaper.comcpcontacts.ottawallpaper.commail.ottawallpaper.comottawallpaper.comwebdisk.ottawallpaper.comwebmail.ottawallpaper.comwww.ottawallpaper.com
autodiscover.canada-shogi.comcanada-shogi.comcpanel.canada-shogi.comcpcalendars.canada-shogi.comcpcontacts.canada-shogi.commail.canada-shogi.comwebdisk.canada-shogi.comwebmail.canada-shogi.comwww.canada-shogi.com
autodiscover.texassigningservices.comcpanel.texassigningservices.comcpcalendars.texassigningservices.comcpcontacts.texassigningservices.commail.texassigningservices.comtexassigningservices.comwebdisk.texassigningservices.comwebmail.texassigningservices.comwebsite-ef326f66.nqf.egd.mybluehost.mewww.texassigningservices.comwww.website-ef326f66.nqf.egd.mybluehost.me
supermartt.xlr.kdb.mybluehost.mewww.supermartt.xlr.kdb.mybluehost.me
autodiscover.childled.comautodiscover.zut.ilc.mybluehost.mechildled.comchildled.zut.ilc.mybluehost.mecpanel.childled.comcpanel.zut.ilc.mybluehost.mecpcalendars.childled.comcpcalendars.zut.ilc.mybluehost.mecpcontacts.childled.comcpcontacts.zut.ilc.mybluehost.memail.childled.commail.zut.ilc.mybluehost.mewebdisk.childled.comwebdisk.zut.ilc.mybluehost.mewebmail.childled.comwebmail.zut.ilc.mybluehost.mewww.childled.comwww.childled.zut.ilc.mybluehost.mewww.zut.ilc.mybluehost.mezut.ilc.mybluehost.me
autodiscover.ebq.rdx.mybluehost.mecpanel.ebq.rdx.mybluehost.mecpcalendars.ebq.rdx.mybluehost.mecpcontacts.ebq.rdx.mybluehost.meebq.rdx.mybluehost.memail.ebq.rdx.mybluehost.memail.yeseveryoneeats.comwebdisk.ebq.rdx.mybluehost.mewebmail.ebq.rdx.mybluehost.mewww.ebq.rdx.mybluehost.mewww.yeseveryoneeats.comyeseveryoneeats.com
autodiscover.childrensfrenchbookcorner.comchildrensfrenchbookcorner.comcpanel.childrensfrenchbookcorner.comcpcalendars.childrensfrenchbookcorner.comcpcontacts.childrensfrenchbookcorner.comwebdisk.childrensfrenchbookcorner.comwebmail.childrensfrenchbookcorner.comwww.childrensfrenchbookcorner.com
autodiscover.boulderwild.coautodiscover.ericaellis.coboulderwild.cocpanel.boulderwild.cocpanel.ericaellis.cocpcalendars.boulderwild.cocpcalendars.ericaellis.cocpcontacts.boulderwild.cocpcontacts.ericaellis.coericaellis-co.boulderwild.coericaellis.comail.boulderwild.comail.ericaellis.cowebdisk.boulderwild.cowebdisk.ericaellis.cowebmail.boulderwild.cowebmail.ericaellis.cowww.boulderwild.cowww.ericaellis-co.boulderwild.cowww.ericaellis.co
autodiscover.gtg.cun.mybluehost.mecpanel.gtg.cun.mybluehost.mecpcalendars.gtg.cun.mybluehost.mecpcontacts.gtg.cun.mybluehost.megtg.cun.mybluehost.memail.gtg.cun.mybluehost.memail.nilsencorp.comnilsencorp.comwebdisk.gtg.cun.mybluehost.mewebmail.gtg.cun.mybluehost.mewww.gtg.cun.mybluehost.mewww.nilsencorp.com
autodiscover.centenarynow.comcentenarynow.comcpanel.centenarynow.comcpcalendars.centenarynow.comcpcontacts.centenarynow.commail.centenarynow.comwebdisk.centenarynow.comwebmail.centenarynow.comwww.centenarynow.com
autodiscover.visionzpsis.comcpanel.visionzpsis.comcpcalendars.visionzpsis.comcpcontacts.visionzpsis.commail.visionzpsis.comvisionzpsis.comwebdisk.visionzpsis.comwebmail.visionzpsis.comwww.visionzpsis.com
autodiscover.marksolomon.netcpanel.marksolomon.netcpcalendars.marksolomon.netcpcontacts.marksolomon.netmail.yiy.rfl.mybluehost.memarksolomon.netwebdisk.marksolomon.netwebmail.marksolomon.netwww.marksolomon.netwww.yiy.rfl.mybluehost.meyiy.rfl.mybluehost.me
autodiscover.cotapult.comcotapult.comcotapult.wewalkwithyou.comcpanel.cotapult.comcpcalendars.cotapult.comcpcontacts.cotapult.comwebdisk.cotapult.comwebmail.cotapult.comwww.cotapult.comwww.cotapult.wewalkwithyou.com
autodiscover.ccl-us.orgccl-us.orgcpanel.ccl-us.orgcpcalendars.ccl-us.orgcpcontacts.ccl-us.orgmail.ccl-us.orgmail.mxv.rew.mybluehost.memxv.rew.mybluehost.mewebdisk.ccl-us.orgwebmail.ccl-us.orgwebsite-32b76e56.ccl-us.orgwww.ccl-us.orgwww.mxv.rew.mybluehost.mewww.website-32b76e56.ccl-us.org
autodiscover.neverhadaboss.comcpanel.neverhadaboss.comcpcalendars.neverhadaboss.comcpcontacts.neverhadaboss.commail.neverhadaboss.comneverhadaboss.comwebdisk.neverhadaboss.comwebmail.neverhadaboss.comwww.neverhadaboss.com
autodiscover.mlu.koc.mybluehost.mecpanel.mlu.koc.mybluehost.mecpcalendars.mlu.koc.mybluehost.mecpcontacts.mlu.koc.mybluehost.mefitsumberhe.commail.fitsumberhe.commail.mlu.koc.mybluehost.memlu.koc.mybluehost.mewebdisk.mlu.koc.mybluehost.mewebmail.mlu.koc.mybluehost.mewww.fitsumberhe.comwww.mlu.koc.mybluehost.me
autodiscover.uuq.xxm.mybluehost.mecpanel.uuq.xxm.mybluehost.mecpcalendars.uuq.xxm.mybluehost.mecpcontacts.uuq.xxm.mybluehost.memail.uuq.xxm.mybluehost.meuuq.xxm.mybluehost.mewebdisk.uuq.xxm.mybluehost.mewebmail.uuq.xxm.mybluehost.mewww.uuq.xxm.mybluehost.me
autodiscover.ett.nce.mybluehost.mecpanel.ett.nce.mybluehost.mecpcalendars.ett.nce.mybluehost.mecpcontacts.ett.nce.mybluehost.meett.nce.mybluehost.memail.ett.nce.mybluehost.mewebdisk.ett.nce.mybluehost.mewebmail.ett.nce.mybluehost.mewww.ett.nce.mybluehost.me
autodiscover.everydayisfrench.comcpanel.everydayisfrench.comcpcalendars.everydayisfrench.comcpcontacts.everydayisfrench.comeverydayisfrench.commail.everydayisfrench.comwebdisk.everydayisfrench.comwebmail.everydayisfrench.comwww.everydayisfrench.com
autodiscover.dyw.uel.mybluehost.mecpanel.dyw.uel.mybluehost.mecpcalendars.dyw.uel.mybluehost.mecpcontacts.dyw.uel.mybluehost.medyw.uel.mybluehost.memail.dyw.uel.mybluehost.metoharborlife.comwebdisk.dyw.uel.mybluehost.mewebmail.dyw.uel.mybluehost.mewww.dyw.uel.mybluehost.mewww.toharborlife.com
autodiscover.partnersdigitalmarketing.comcpanel.partnersdigitalmarketing.comcpcalendars.partnersdigitalmarketing.comcpcontacts.partnersdigitalmarketing.comlkk.shn.mybluehost.memail.lkk.shn.mybluehost.memail.partnersdigitalmarketing.compartnersdigitalmarketing.comwebdisk.partnersdigitalmarketing.comwebmail.partnersdigitalmarketing.comwww.lkk.shn.mybluehost.mewww.partnersdigitalmarketing.com
cpanel.theobriencollective.comcpcalendars.theobriencollective.comcpcontacts.theobriencollective.commail.theobriencollective.comtheobriencollective.comwebdisk.theobriencollective.comwebmail.theobriencollective.comwww.theobriencollective.com
autodiscover.stowe-trails.comcpanel.stowe-trails.comcpcalendars.stowe-trails.comcpcontacts.stowe-trails.commail.stowe-trails.comstowemountainbike.stowe-trails.comwebdisk.stowe-trails.comwebmail.stowe-trails.comwww.stowemountainbike.stowe-trails.com
bravoheatingcooling.comwww.bravoheatingcooling.com
autodiscover.osbornevillage.churchcpanel.osbornevillage.churchcpcalendars.osbornevillage.churchcpcontacts.osbornevillage.churchdwg.sro.mybluehost.memail.dwg.sro.mybluehost.memail.osbornevillage.churchosbornevillage.churchwebdisk.osbornevillage.churchwebmail.osbornevillage.churchwww.dwg.sro.mybluehost.mewww.osbornevillage.church
autodiscover.ykj.enu.mybluehost.mecpanel.ykj.enu.mybluehost.mecpcalendars.ykj.enu.mybluehost.mecpcontacts.ykj.enu.mybluehost.memail.sizzlesalsyoutube.commail.ykj.enu.mybluehost.mesizzlesalsyoutube.comwebdisk.ykj.enu.mybluehost.mewebmail.ykj.enu.mybluehost.mewww.sizzlesalsyoutube.comwww.ykj.enu.mybluehost.meykj.enu.mybluehost.me
autodiscover.focalpointcowork.comautodiscover.fortressbilliards.comcpanel.focalpointcowork.comcpanel.fortressbilliards.comcpcalendars.focalpointcowork.comcpcalendars.fortressbilliards.comcpcontacts.focalpointcowork.comcpcontacts.fortressbilliards.comfocalpointcowork.comfocalpointcowork.iib.jso.mybluehost.mefortressbilliards.comfortressbilliards.iib.jso.mybluehost.memail.focalpointcowork.commail.fortressbilliards.comwebdisk.focalpointcowork.comwebdisk.fortressbilliards.comwebmail.focalpointcowork.comwebmail.fortressbilliards.comwww.focalpointcowork.comwww.focalpointcowork.iib.jso.mybluehost.mewww.fortressbilliards.comwww.fortressbilliards.iib.jso.mybluehost.me
autodiscover.juniorscourt.comcpanel.juniorscourt.comcpcalendars.juniorscourt.comcpcontacts.juniorscourt.comjuniorscourt.comjuniorscourt.juniorscourt.commail.juniorscourt.comretail.juniorscourt.comwebdisk.juniorscourt.comwebmail.juniorscourt.comwww.juniorscourt.comwww.juniorscourt.juniorscourt.comwww.retail.juniorscourt.com
efsmi.comwww.efsmi.com
cpanel.mobiushome.commail.mobiushome.commobiushome.comwebmail.mobiushome.comwww.mobiushome.com
autodiscover.stamenandpistilpt.comcpanel.stamenandpistilpt.comcpcalendars.stamenandpistilpt.comcpcontacts.stamenandpistilpt.commail.stamenandpistilpt.comstamenandpistilpt.comwebdisk.stamenandpistilpt.comwebmail.stamenandpistilpt.comwww.stamenandpistilpt.com
aeroventuresllc.comaeroventuresusa.aeroventuresllc.comaeroventuresusa.comalliedinternationalgroup.aeroventuresllc.comalliesinternationalgroup.aeroventuresllc.comautodiscover.aeroventuresllc.combeehiveflower.orgcpanel.aeroventuresllc.comcpcalendars.aeroventuresllc.comcpcontacts.aeroventuresllc.commail.aeroventuresllc.commail.beehiveflower.orgmail.xwk.lnl.mybluehost.mewebdisk.aeroventuresllc.comwebmail.aeroventuresllc.comwww.aeroventuresllc.comwww.aeroventuresusa.aeroventuresllc.comwww.aeroventuresusa.comwww.alliedinternationalgroup.aeroventuresllc.comwww.alliesinternationalgroup.aeroventuresllc.comwww.beehiveflower.orgwww.xwk.lnl.mybluehost.mexwk.lnl.mybluehost.me
autodiscover.waterpurifierrental.comcpanel.waterpurifierrental.comcpcalendars.waterpurifierrental.comcpcontacts.waterpurifierrental.commail.waterpurifierrental.comwaterpurifierrental-com.sunmulgift.comwaterpurifierrental.comwebdisk.waterpurifierrental.comwebmail.waterpurifierrental.comwww.waterpurifierrental-com.sunmulgift.comwww.waterpurifierrental.com
autodiscover.ozwineinternational.comcpanel.ozwineinternational.comcpcalendars.ozwineinternational.comcpcontacts.ozwineinternational.commail.ozwineinternational.comozwineinternational.comwebdisk.ozwineinternational.comwebmail.ozwineinternational.comwww.ozwineinternational.com
blueboxsoftware.netcpanel.blueboxsoftware.netcpcalendars.blueboxsoftware.netcpcontacts.blueboxsoftware.netmail.blueboxsoftware.netwebdisk.blueboxsoftware.netwebmail.blueboxsoftware.netwww.blueboxsoftware.net
autodiscover.irbf.co.ukcpanel.irbf.co.ukcpcalendars.irbf.co.ukcpcontacts.irbf.co.ukirbf.co.ukmail.irbf.co.ukwebdisk.irbf.co.ukwebmail.irbf.co.ukwww.irbf.co.uk
alshidi.comautodiscover.alshidi.comcpanel.alshidi.comcpcalendars.alshidi.comcpcontacts.alshidi.commail.alshidi.commustbeoman.alshidi.comwebdisk.alshidi.comwebmail.alshidi.comwww.alshidi.comwww.mustbeoman.alshidi.com
autodiscover.socialjones.comcpanel.socialjones.comcpcalendars.socialjones.comcpcontacts.socialjones.commail.mythmagick.commail.socialjones.comsocialjones.comwebdisk.socialjones.comwebmail.socialjones.com
autodiscover.way.tdd.mybluehost.mecpanel.way.tdd.mybluehost.mecpcalendars.way.tdd.mybluehost.mecpcontacts.way.tdd.mybluehost.mefieldrosaries.orgmail.fieldrosaries.orgmail.way.tdd.mybluehost.meway.tdd.mybluehost.mewebdisk.way.tdd.mybluehost.mewebmail.way.tdd.mybluehost.mewww.fieldrosaries.orgwww.way.tdd.mybluehost.me
autodiscover.yxo.gqj.mybluehost.mecpanel.yxo.gqj.mybluehost.mecpcalendars.yxo.gqj.mybluehost.mecpcontacts.yxo.gqj.mybluehost.memail.yxo.gqj.mybluehost.mewebdisk.yxo.gqj.mybluehost.mewebmail.yxo.gqj.mybluehost.mewww.yxo.gqj.mybluehost.meyxo.gqj.mybluehost.me
autodiscover.kgq.wyy.mybluehost.mecpanel.kgq.wyy.mybluehost.mecpcalendars.kgq.wyy.mybluehost.mecpcontacts.kgq.wyy.mybluehost.mehealthy-queen.comkgq.wyy.mybluehost.memail.healthy-queen.commail.kgq.wyy.mybluehost.mewebdisk.kgq.wyy.mybluehost.mewebmail.kgq.wyy.mybluehost.mewww.healthy-queen.comwww.kgq.wyy.mybluehost.me
autodiscover.loapioneers.comautodiscover.romkay.comcpanel.loapioneers.comcpanel.romkay.comcpcalendars.loapioneers.comcpcalendars.romkay.comcpcontacts.loapioneers.comcpcontacts.romkay.comloapioneers.comloapioneers.romkay.commail.loapioneers.commail.romkay.comromkay.comwebdisk.loapioneers.comwebdisk.romkay.comwebmail.loapioneers.comwebmail.romkay.comwww.loapioneers.comwww.loapioneers.romkay.comwww.romkay.com
airlinehotelcreditcards.comautodiscover.airlinehotelcreditcards.comcpanel.airlinehotelcreditcards.comcpcalendars.airlinehotelcreditcards.comcpcontacts.airlinehotelcreditcards.commail.airlinehotelcreditcards.comwebdisk.airlinehotelcreditcards.comwebmail.airlinehotelcreditcards.comwww.airlinehotelcreditcards.com
australiatozimbabwe.comautodiscover.australiatozimbabwe.comcpanel.australiatozimbabwe.comcpcalendars.australiatozimbabwe.comcpcontacts.australiatozimbabwe.commail.australiatozimbabwe.comwebdisk.australiatozimbabwe.comwebmail.australiatozimbabwe.comwww.australiatozimbabwe.com
autodiscover.ybk.goc.mybluehost.mecpanel.ybk.goc.mybluehost.mecpcalendars.ybk.goc.mybluehost.mecpcontacts.ybk.goc.mybluehost.memail.townofkelfordnc.govmail.ybk.goc.mybluehost.metownofkelfordnc.govwebdisk.ybk.goc.mybluehost.mewebmail.ybk.goc.mybluehost.mewww.townofkelfordnc.govwww.ybk.goc.mybluehost.meybk.goc.mybluehost.me
autodiscover.thinkdigitalmatter.comcpanel.thinkdigitalmatter.comcpcalendars.thinkdigitalmatter.comcpcontacts.thinkdigitalmatter.comhbc.mlg.mybluehost.memail.hbc.mlg.mybluehost.memail.thinkdigitalmatter.comthinkdigitalmatter.comwebdisk.thinkdigitalmatter.comwebmail.thinkdigitalmatter.comwww.hbc.mlg.mybluehost.mewww.thinkdigitalmatter.com
autodiscover.lazygeniusmom.comcpanel.lazygeniusmom.comcpcalendars.lazygeniusmom.comcpcontacts.lazygeniusmom.comlazygeniusmom.commail.lazygeniusmom.comwebdisk.lazygeniusmom.comwebmail.lazygeniusmom.comwww.lazygeniusmom.com
autodiscover.yrh.nmb.mybluehost.mecpanel.yrh.nmb.mybluehost.mecpcalendars.yrh.nmb.mybluehost.mecpcontacts.yrh.nmb.mybluehost.memail.samicherkaouipublishings.commail.yrh.nmb.mybluehost.mesamicherkaouipublishings.comwebdisk.yrh.nmb.mybluehost.mewebmail.yrh.nmb.mybluehost.mewww.samicherkaouipublishings.comwww.yrh.nmb.mybluehost.meyrh.nmb.mybluehost.me
autodiscover.ibfafoundation.comcpanel.ibfafoundation.comcpcalendars.ibfafoundation.comcpcontacts.ibfafoundation.comibfafoundation.commail.ibfafoundation.comwebdisk.ibfafoundation.comwebmail.ibfafoundation.comwww.ibfafoundation.com
autodiscover.nrk.hsk.mybluehost.meclasswings.netcpanel.nrk.hsk.mybluehost.mecpcalendars.nrk.hsk.mybluehost.mecpcontacts.nrk.hsk.mybluehost.memail.classwings.netmail.nrk.hsk.mybluehost.menrk.hsk.mybluehost.mewebdisk.nrk.hsk.mybluehost.mewebmail.nrk.hsk.mybluehost.mewww.classwings.netwww.nrk.hsk.mybluehost.me
autodiscover.formydiet.comcpanel.formydiet.comcpcalendars.formydiet.comcpcontacts.formydiet.comformydiet-com.sunmulgift.comformydiet.commail.formydiet.comwebdisk.formydiet.comwebmail.formydiet.comwww.formydiet-com.sunmulgift.comwww.formydiet.com
autodiscover.jtt.okl.mybluehost.mecpanel.jtt.okl.mybluehost.mecpcalendars.jtt.okl.mybluehost.mecpcontacts.jtt.okl.mybluehost.mejtt.okl.mybluehost.memail.jtt.okl.mybluehost.memail.motherhoodlaborandlove.commotherhoodlaborandlove.comwebdisk.jtt.okl.mybluehost.mewebmail.jtt.okl.mybluehost.mewww.jtt.okl.mybluehost.mewww.motherhoodlaborandlove.com
autodiscover.bkt.tvd.mybluehost.mebkt.tvd.mybluehost.mecpanel.bkt.tvd.mybluehost.mecpcalendars.bkt.tvd.mybluehost.mecpcontacts.bkt.tvd.mybluehost.memagnolianae.commail.bkt.tvd.mybluehost.memail.magnolianae.comwebdisk.bkt.tvd.mybluehost.mewebmail.bkt.tvd.mybluehost.mewww.bkt.tvd.mybluehost.mewww.magnolianae.com
autodiscover.hkr.vcj.mybluehost.mecpanel.hkr.vcj.mybluehost.mecpcalendars.hkr.vcj.mybluehost.mecpcontacts.hkr.vcj.mybluehost.mehkr.vcj.mybluehost.memail.hkr.vcj.mybluehost.memail.preachfromthehousetops.compreachfromthehousetops.comwebdisk.hkr.vcj.mybluehost.mewebmail.hkr.vcj.mybluehost.mewww.hkr.vcj.mybluehost.mewww.preachfromthehousetops.com
spleelogistics.comwww.spleelogistics.com
autodiscover.efectoresponsable.pecpanel.efectoresponsable.pecpcalendars.efectoresponsable.pecpcontacts.efectoresponsable.peefectoresponsable.pemail.efectoresponsable.pewebdisk.efectoresponsable.pewebmail.efectoresponsable.pewww.efectoresponsable.pe
autodiscover.qbc.bma.mybluehost.mecpanel.qbc.bma.mybluehost.mecpcalendars.qbc.bma.mybluehost.mecpcontacts.qbc.bma.mybluehost.mejaycrouch.commail.qbc.bma.mybluehost.meqbc.bma.mybluehost.mewebdisk.qbc.bma.mybluehost.mewebmail.qbc.bma.mybluehost.mewww.jaycrouch.comwww.qbc.bma.mybluehost.me
autodiscover.inspireintegrativehealth.comcpanel.inspireintegrativehealth.comcpcalendars.inspireintegrativehealth.comcpcontacts.inspireintegrativehealth.cominspireintegrativehealth.commail.inspireintegrativehealth.comwebdisk.inspireintegrativehealth.comwebmail.inspireintegrativehealth.comwebsite-fde254bc.harmonywithtruenature.comwww.inspireintegrativehealth.comwww.website-fde254bc.harmonywithtruenature.com
autodiscover.lfn.uel.mybluehost.mecpanel.lfn.uel.mybluehost.mecpcalendars.lfn.uel.mybluehost.mecpcontacts.lfn.uel.mybluehost.mekevinflynnmusic.comlfn.uel.mybluehost.memail.kevinflynnmusic.commail.lfn.uel.mybluehost.mewebdisk.lfn.uel.mybluehost.mewebmail.lfn.uel.mybluehost.mewww.kevinflynnmusic.comwww.lfn.uel.mybluehost.me
autodiscover.logical-insanity.comcpanel.logical-insanity.comcpcalendars.logical-insanity.comcpcontacts.logical-insanity.comkkn.jpm.mybluehost.melogical-insanity.commail.kkn.jpm.mybluehost.memail.logical-insanity.comoan.logical-insanity.comwebdisk.logical-insanity.comwebmail.logical-insanity.comwww.kkn.jpm.mybluehost.mewww.logical-insanity.comwww.oan.logical-insanity.com
afaqadmin.dynamicsmachines.comlittleocean.dynamicsmachines.comwww.afaqadmin.dynamicsmachines.comwww.littleocean.dynamicsmachines.com
autodiscover.earthlycleaning.comcpanel.earthlycleaning.comcpcalendars.earthlycleaning.comcpcontacts.earthlycleaning.comearthlycleaning.comearthlycleaning.hza.chb.mybluehost.memail.earthlycleaning.comwebdisk.earthlycleaning.comwebmail.earthlycleaning.comwww.earthlycleaning.comwww.earthlycleaning.hza.chb.mybluehost.me
offer.partnersdigitalmarketing.comwww.offer.partnersdigitalmarketing.com
autodiscover.zba.mvv.mybluehost.mecpanel.zba.mvv.mybluehost.mecpcalendars.zba.mvv.mybluehost.mecpcontacts.zba.mvv.mybluehost.meheartsforschools.orgmail.heartsforschools.orgmail.zba.mvv.mybluehost.mewebdisk.zba.mvv.mybluehost.mewebmail.zba.mvv.mybluehost.mewww.heartsforschools.orgwww.zba.mvv.mybluehost.mezba.mvv.mybluehost.me
a2hdesignstudio-ca.tzr.dhy.mybluehost.mea2hdesignstudio.caautodiscover.a2hdesignstudio.cacpanel.a2hdesignstudio.cacpcalendars.a2hdesignstudio.cacpcontacts.a2hdesignstudio.camail.a2hdesignstudio.cawebdisk.a2hdesignstudio.cawebmail.a2hdesignstudio.cawww.a2hdesignstudio-ca.tzr.dhy.mybluehost.mewww.a2hdesignstudio.ca
autodiscover.daphneybongo.comcpanel.daphneybongo.comcpcalendars.daphneybongo.comcpcontacts.daphneybongo.comdaphneybongo.comdaphneybongo.slickprepper.commail.daphneybongo.comwebdisk.daphneybongo.comwebmail.daphneybongo.comwww.daphneybongo.comwww.daphneybongo.slickprepper.com
autodiscover.ofa.ano.mybluehost.mecpanel.ofa.ano.mybluehost.mecpcalendars.ofa.ano.mybluehost.mecpcontacts.ofa.ano.mybluehost.medominicmattioli.commail.dominicmattioli.commail.ofa.ano.mybluehost.meofa.ano.mybluehost.mewebdisk.ofa.ano.mybluehost.mewebmail.ofa.ano.mybluehost.mewebsite-2e139346.ofa.ano.mybluehost.mewww.dominicmattioli.comwww.ofa.ano.mybluehost.mewww.website-2e139346.ofa.ano.mybluehost.me
autodiscover.vbp.pmc.mybluehost.mecpanel.vbp.pmc.mybluehost.mecpcalendars.vbp.pmc.mybluehost.mecpcontacts.vbp.pmc.mybluehost.memail.vbp.pmc.mybluehost.mevbp.pmc.mybluehost.mewebdisk.vbp.pmc.mybluehost.mewebmail.vbp.pmc.mybluehost.mewww.vbp.pmc.mybluehost.me
autodiscover.edn.lef.mybluehost.mecpanel.edn.lef.mybluehost.mecpcalendars.edn.lef.mybluehost.mecpcontacts.edn.lef.mybluehost.meedn.lef.mybluehost.megrettabevis.commail.edn.lef.mybluehost.memail.grettabevis.comwebdisk.edn.lef.mybluehost.mewebmail.edn.lef.mybluehost.mewww.edn.lef.mybluehost.mewww.grettabevis.com
autodiscover.ofo.hzw.mybluehost.mecpanel.ofo.hzw.mybluehost.mecpcalendars.ofo.hzw.mybluehost.mecpcontacts.ofo.hzw.mybluehost.memail.ofo.hzw.mybluehost.meofo.hzw.mybluehost.mewebdisk.ofo.hzw.mybluehost.mewebmail.ofo.hzw.mybluehost.mewww.ofo.hzw.mybluehost.me
autodiscover.knv.wyd.mybluehost.mecpanel.knv.wyd.mybluehost.mecpcalendars.knv.wyd.mybluehost.mecpcontacts.knv.wyd.mybluehost.meem-art-d.comknv.wyd.mybluehost.memail.em-art-d.commail.knv.wyd.mybluehost.mewebdisk.knv.wyd.mybluehost.mewebmail.knv.wyd.mybluehost.mewww.em-art-d.comwww.knv.wyd.mybluehost.me
autodiscover.znu.sgg.mybluehost.mecpanel.znu.sgg.mybluehost.mecpcalendars.znu.sgg.mybluehost.mecpcontacts.znu.sgg.mybluehost.memail.metstudies.commail.znu.sgg.mybluehost.memetstudies.comwebdisk.znu.sgg.mybluehost.mewebmail.znu.sgg.mybluehost.mewww.metstudies.comwww.znu.sgg.mybluehost.meznu.sgg.mybluehost.me
autodiscover.weleadglobal.comcpanel.weleadglobal.comcpcalendars.weleadglobal.comcpcontacts.weleadglobal.commail.weleadglobal.comwebdisk.weleadglobal.comwebmail.weleadglobal.comweleadglobal.comwww.weleadglobal.com
autodiscover.geckographix.caautodiscover.ozeim.comcpanel.geckographix.cacpanel.ozeim.comcpcalendars.geckographix.cacpcalendars.ozeim.comcpcontacts.geckographix.cacpcontacts.ozeim.comgeckographix.camail.geckographix.camail.ozeim.commail.pzk.mvv.mybluehost.meozeim.compzk.mvv.mybluehost.mewebdisk.geckographix.cawebdisk.ozeim.comwebmail.geckographix.cawebmail.ozeim.comwebsite-5fd726fe.geckographix.cawww.geckographix.cawww.ozeim.comwww.pzk.mvv.mybluehost.mewww.website-5fd726fe.geckographix.ca
autodiscover.qbj.swq.mybluehost.mecpanel.qbj.swq.mybluehost.mecpcalendars.qbj.swq.mybluehost.mecpcontacts.qbj.swq.mybluehost.memail.precisionpropertymiami.commail.qbj.swq.mybluehost.meprecisionpropertymiami.comqbj.swq.mybluehost.mewebdisk.qbj.swq.mybluehost.mewebmail.qbj.swq.mybluehost.mewww.precisionpropertymiami.comwww.qbj.swq.mybluehost.me
autodiscover.pigarispa.comcpanel.pigarispa.comcpcalendars.pigarispa.comcpcontacts.pigarispa.commail.pigarispa.compigarispa.comwebdisk.pigarispa.comwebmail.pigarispa.comwww.pigarispa.com
autodiscover.islandaircontrol.comcpanel.islandaircontrol.comcpcalendars.islandaircontrol.comcpcontacts.islandaircontrol.comislandaircontrol.commail.islandaircontrol.comwebdisk.islandaircontrol.comwebmail.islandaircontrol.comwww.islandaircontrol.com
autodiscover.sharingmyvanlife.comcpanel.sharingmyvanlife.comcpcalendars.sharingmyvanlife.comcpcontacts.sharingmyvanlife.commail.sharingmytrip.commail.sharingmyvanlife.comsharingmytrip.comsharingmyvanlife.comwebdisk.sharingmyvanlife.comwebmail.sharingmyvanlife.comwww.sharingmytrip.comwww.sharingmyvanlife.com
autodiscover.bader.imbader.imcpanel.bader.imcpcalendars.bader.imcpcontacts.bader.immail.bader.immail.uva.xng.mybluehost.meuva.xng.mybluehost.mewebdisk.bader.imwebmail.bader.imwww.bader.imwww.uva.xng.mybluehost.me
autodiscover.uxn.hgs.mybluehost.mecpanel.uxn.hgs.mybluehost.mecpcalendars.uxn.hgs.mybluehost.mecpcontacts.uxn.hgs.mybluehost.memail.uxn.hgs.mybluehost.meuxn.hgs.mybluehost.mewebdisk.uxn.hgs.mybluehost.mewebmail.uxn.hgs.mybluehost.mewww.uxn.hgs.mybluehost.me
autodiscover.onsitefabricarecleaning.comcpanel.onsitefabricarecleaning.comcpcalendars.onsitefabricarecleaning.comcpcontacts.onsitefabricarecleaning.commail.onsitefabricarecleaning.comonsitefabricarecleaning.comwebdisk.onsitefabricarecleaning.comwebmail.onsitefabricarecleaning.comwww.onsitefabricarecleaning.com
autodiscover.hfo.yhy.mybluehost.mebalancebusinesssolution.netcpanel.hfo.yhy.mybluehost.mecpcalendars.hfo.yhy.mybluehost.mecpcontacts.hfo.yhy.mybluehost.mehfo.yhy.mybluehost.memail.balancebusinesssolution.netmail.hfo.yhy.mybluehost.mewebdisk.hfo.yhy.mybluehost.mewebmail.hfo.yhy.mybluehost.mewww.balancebusinesssolution.netwww.hfo.yhy.mybluehost.me
autodiscover.corpopack.comcorpopack.comcpanel.corpopack.comcpcalendars.corpopack.comcpcontacts.corpopack.commail.corpopack.comwebdisk.corpopack.comwebmail.corpopack.comwww.corpopack.com
autodiscover.uprcwichita.comcpanel.uprcwichita.comcpcalendars.uprcwichita.comcpcontacts.uprcwichita.commail.uprcwichita.comuprcwichita.comwebdisk.uprcwichita.comwebmail.uprcwichita.comwww.uprcwichita.com
autodiscover.llk.kum.mybluehost.mecpanel.llk.kum.mybluehost.mecpcalendars.llk.kum.mybluehost.mecpcontacts.llk.kum.mybluehost.mellk.kum.mybluehost.memail.llk.kum.mybluehost.mesmccapitalgrp.comwebdisk.llk.kum.mybluehost.mewebmail.llk.kum.mybluehost.mewww.llk.kum.mybluehost.mewww.smccapitalgrp.com
aiw.chh.mybluehost.meautodiscover.bf4wardfitness.comautodiscover.bfftestprep.combf4wardfitness.combfftestprep.comcpanel.bf4wardfitness.comcpanel.bfftestprep.comcpcalendars.bf4wardfitness.comcpcalendars.bfftestprep.comcpcontacts.bf4wardfitness.comcpcontacts.bfftestprep.commail.aiw.chh.mybluehost.memail.bf4wardfitness.commail.bfftestprep.comwebdisk.bf4wardfitness.comwebdisk.bfftestprep.comwebmail.bf4wardfitness.comwebmail.bfftestprep.comwebsite-1edacc48.bfftestprep.comwww.aiw.chh.mybluehost.mewww.bf4wardfitness.comwww.bfftestprep.comwww.website-1edacc48.bfftestprep.com
autodiscover.eup.sbv.mybluehost.mecpanel.eup.sbv.mybluehost.mecpcalendars.eup.sbv.mybluehost.mecpcontacts.eup.sbv.mybluehost.meetherealbeauty.blogeup.sbv.mybluehost.memail.etherealbeauty.blogmail.eup.sbv.mybluehost.mewebdisk.eup.sbv.mybluehost.mewebmail.eup.sbv.mybluehost.mewww.etherealbeauty.blogwww.eup.sbv.mybluehost.me
website-0736747f.umh.sgg.mybluehost.mewww.website-0736747f.umh.sgg.mybluehost.me
website-5fb62e2d.szw.tui.mybluehost.mewww.website-5fb62e2d.szw.tui.mybluehost.me
autodiscover.ludkaslanguagelounge.comcpanel.ludkaslanguagelounge.comcpcalendars.ludkaslanguagelounge.comcpcontacts.ludkaslanguagelounge.comludkaslanguagelounge.commail.ludkaslanguagelounge.comwebdisk.ludkaslanguagelounge.comwebmail.ludkaslanguagelounge.comwww.ludkaslanguagelounge.com
autodiscover.avisofitness.comautodiscover.schnoodledesign.comavisofitness.booktipper.comavisofitness.comcpanel.avisofitness.comcpanel.schnoodledesign.comcpcalendars.avisofitness.comcpcalendars.schnoodledesign.comcpcontacts.avisofitness.comcpcontacts.schnoodledesign.commail.avisofitness.commail.schnoodledesign.comschnoodledesign.booktipper.comschnoodledesign.comwebdisk.avisofitness.comwebdisk.schnoodledesign.comwebmail.avisofitness.comwebmail.schnoodledesign.comwww.avisofitness.booktipper.comwww.avisofitness.comwww.schnoodledesign.booktipper.comwww.schnoodledesign.comwww.your-fitness-guru.booktipper.comyour-fitness-guru.booktipper.com
apu.grq.mybluehost.meautodiscover.apu.grq.mybluehost.mecpanel.apu.grq.mybluehost.mecpcalendars.apu.grq.mybluehost.mecpcontacts.apu.grq.mybluehost.memail.apu.grq.mybluehost.memail.theplayfulminds.comtheplayfulminds.comwebdisk.apu.grq.mybluehost.mewebmail.apu.grq.mybluehost.mewww.apu.grq.mybluehost.mewww.theplayfulminds.com
autodiscover.zentaingenieria.comcpanel.zentaingenieria.comcpcalendars.zentaingenieria.comcpcontacts.zentaingenieria.commail.zentaingenieria.comwebdisk.zentaingenieria.comwebmail.zentaingenieria.comwww.zentaingenieria.comzentaingenieria.com
autodiscover.jcmagazine.comcpanel.jcmagazine.comcpcalendars.jcmagazine.comcpcontacts.jcmagazine.comjcmagazine.commail.jcmagazine.comwebdisk.jcmagazine.comwebmail.jcmagazine.comwww.jcmagazine.com
autodiscover.oxal.co.ukcpanel.oxal.co.ukcpcalendars.oxal.co.ukcpcontacts.oxal.co.ukmail.oxal.co.ukoxal.co.ukoxalusa.oxal.co.ukwebdisk.oxal.co.ukwebmail.oxal.co.ukwww.oxal.co.ukwww.oxalusa.oxal.co.uk
autodiscover.hdi.bqv.mybluehost.mecpanel.hdi.bqv.mybluehost.mecpcalendars.hdi.bqv.mybluehost.mecpcontacts.hdi.bqv.mybluehost.medagrarril.comhdi.bqv.mybluehost.memail.dagrarril.commail.hdi.bqv.mybluehost.mewebdisk.hdi.bqv.mybluehost.mewebmail.hdi.bqv.mybluehost.mewww.dagrarril.comwww.hdi.bqv.mybluehost.me
autodiscover.fak.rwl.mybluehost.mecpanel.fak.rwl.mybluehost.mecpcalendars.fak.rwl.mybluehost.mecpcontacts.fak.rwl.mybluehost.mefak.rwl.mybluehost.memail.fak.rwl.mybluehost.memail.omaafricancuisine.comomaafricancuisine.comwebdisk.fak.rwl.mybluehost.mewebmail.fak.rwl.mybluehost.mewww.fak.rwl.mybluehost.mewww.omaafricancuisine.com
autodiscover.friendsofhorseshoebendanimals.comcpanel.friendsofhorseshoebendanimals.comcpcalendars.friendsofhorseshoebendanimals.comcpcontacts.friendsofhorseshoebendanimals.comfriendsofhorseshoebendanimals.commail.friendsofhorseshoebendanimals.comwebdisk.friendsofhorseshoebendanimals.comwebmail.friendsofhorseshoebendanimals.comwww.friendsofhorseshoebendanimals.com
autodiscover.urbanheropoodles.comcpanel.urbanheropoodles.comcpcalendars.urbanheropoodles.comcpcontacts.urbanheropoodles.commail.urbanheropoodles.comurbanheropoodles.comurbanheropoodles.veterinarybootcampce.comwebdisk.urbanheropoodles.comwebmail.urbanheropoodles.comwww.urbanheropoodles.comwww.urbanheropoodles.veterinarybootcampce.com
clarivatepublicationsusus.zbo.pfi.mybluehost.medissertationshark-co-uk.zbo.pfi.mybluehost.metrustcaptain-co-uk.zbo.pfi.mybluehost.mewww.clarivatepublicationsusus.zbo.pfi.mybluehost.mewww.dissertationshark-co-uk.zbo.pfi.mybluehost.mewww.trustcaptain-co-uk.zbo.pfi.mybluehost.me
autodiscover.nqf.egd.mybluehost.mecpanel.nqf.egd.mybluehost.mecpcalendars.nqf.egd.mybluehost.mecpcontacts.nqf.egd.mybluehost.memail.nqf.egd.mybluehost.menqf.egd.mybluehost.mewebdisk.nqf.egd.mybluehost.mewebmail.nqf.egd.mybluehost.mewww.nqf.egd.mybluehost.me
autodiscover.colombiainpeace.orgautodiscover.usi.jso.mybluehost.mecolombiainpeace-org.usi.jso.mybluehost.mecolombiainpeace.orgcpanel.colombiainpeace.orgcpanel.usi.jso.mybluehost.mecpcalendars.colombiainpeace.orgcpcalendars.usi.jso.mybluehost.mecpcontacts.colombiainpeace.orgcpcontacts.usi.jso.mybluehost.mecvyfinancial-net.usi.jso.mybluehost.mecvygroup-company.usi.jso.mybluehost.memail.colombiainpeace.orgmail.usi.jso.mybluehost.meusi.jso.mybluehost.mewebdisk.colombiainpeace.orgwebdisk.usi.jso.mybluehost.mewebmail.colombiainpeace.orgwebmail.usi.jso.mybluehost.mewww.colombiainpeace-org.usi.jso.mybluehost.mewww.colombiainpeace.orgwww.cvyfinancial-net.usi.jso.mybluehost.mewww.cvygroup-company.usi.jso.mybluehost.mewww.usi.jso.mybluehost.me
autodiscover.rofaendurance.comcpanel.rofaendurance.comcpcalendars.rofaendurance.comcpcontacts.rofaendurance.commail.rofaendurance.comrofaendurance.comrofaendurance.td2travelsandadventures.comwebdisk.rofaendurance.comwebmail.rofaendurance.comwww.rofaendurance.comwww.rofaendurance.td2travelsandadventures.com
autodiscover.hmbll.comcpanel.hmbll.comcpcalendars.hmbll.comcpcontacts.hmbll.comhmbll.commail.hmbll.comwebdisk.hmbll.comwebmail.hmbll.comwebsite-00475774.ane.pzr.mybluehost.mewww.hmbll.comwww.website-00475774.ane.pzr.mybluehost.me
practicas.zelayasconstruction.comwww.practicas.zelayasconstruction.com
autodiscover.ltv.pdu.mybluehost.mecpanel.ltv.pdu.mybluehost.mecpcalendars.ltv.pdu.mybluehost.mecpcontacts.ltv.pdu.mybluehost.mehoneybeehunnieglobal.comltv.pdu.mybluehost.memail.honeybeehunnieglobal.commail.ltv.pdu.mybluehost.mewebdisk.ltv.pdu.mybluehost.mewebmail.ltv.pdu.mybluehost.mewww.honeybeehunnieglobal.comwww.ltv.pdu.mybluehost.me
autodiscover.qfl.bma.mybluehost.mecpanel.qfl.bma.mybluehost.mecpcalendars.qfl.bma.mybluehost.mecpcontacts.qfl.bma.mybluehost.memail.qfl.bma.mybluehost.meprimeraiglesiaed.comqfl.bma.mybluehost.mewebdisk.qfl.bma.mybluehost.mewebmail.qfl.bma.mybluehost.mewww.qfl.bma.mybluehost.me
autodiscover.bentplyword.comautodiscover.patrickcheatham.combentplyword.combentplyword.fqy.bsv.mybluehost.mecpanel.bentplyword.comcpanel.patrickcheatham.comcpcalendars.bentplyword.comcpcalendars.patrickcheatham.comcpcontacts.bentplyword.comcpcontacts.patrickcheatham.commail.bentplyword.commail.patrickcheatham.compatrickcheatham.compatrickcheatham.fqy.bsv.mybluehost.mewebdisk.bentplyword.comwebdisk.patrickcheatham.comwebmail.bentplyword.comwebmail.patrickcheatham.comwww.bentplyword.comwww.bentplyword.fqy.bsv.mybluehost.mewww.patrickcheatham.comwww.patrickcheatham.fqy.bsv.mybluehost.me
autodiscover.danwarleather.comcpanel.danwarleather.comcpcalendars.danwarleather.comcpcontacts.danwarleather.comdanwarleather.commail.danwarleather.comwebdisk.danwarleather.comwebmail.danwarleather.comwebsite-85dcd0be.pzq.kei.mybluehost.mewww.danwarleather.comwww.website-85dcd0be.pzq.kei.mybluehost.me
altaseadsconservancy.orgautodiscover.altaseadsconservancy.orgcpanel.altaseadsconservancy.orgcpcalendars.altaseadsconservancy.orgcpcontacts.altaseadsconservancy.orgcqg.pgm.mybluehost.mekelp-ark.orgmail.cqg.pgm.mybluehost.memail.kelp-ark.orgwebdisk.altaseadsconservancy.orgwebmail.altaseadsconservancy.orgwebsite-bc2f9a8b.altaseadsconservancy.orgwww.altaseadsconservancy.orgwww.cqg.pgm.mybluehost.mewww.kelp-ark.orgwww.website-bc2f9a8b.altaseadsconservancy.org
autodiscover.kpb.goj.mybluehost.mecpanel.kpb.goj.mybluehost.mecpcalendars.kpb.goj.mybluehost.mecpcontacts.kpb.goj.mybluehost.mekpb.goj.mybluehost.memail.kpb.goj.mybluehost.mewebdisk.kpb.goj.mybluehost.mewebmail.kpb.goj.mybluehost.mewww.kpb.goj.mybluehost.me
autodiscover.paquettedesign.comcpcontacts.paquettedesign.comwebdisk.paquettedesign.com
autodiscover.foodmarketgypsy.comcpanel.foodmarketgypsy.comcpcalendars.foodmarketgypsy.comcpcontacts.foodmarketgypsy.comfoodmarketgypsy.commail.foodmarketgypsy.comold.foodmarketgypsy.comwebdisk.foodmarketgypsy.comwebmail.foodmarketgypsy.comwww.foodmarketgypsy.comwww.old.foodmarketgypsy.com
autodiscover.lakehillsgs.orgcpanel.lakehillsgs.orgcpcalendars.lakehillsgs.orgcpcontacts.lakehillsgs.orglakehillsgs.orgmail.lakehillsgs.orgwebdisk.lakehillsgs.orgwebmail.lakehillsgs.orgwww.lakehillsgs.org
autodiscover.kplptrust.comcpanel.kplptrust.comcpcalendars.kplptrust.comcpcontacts.kplptrust.comkplptrust.commail.kplptrust.comwebdisk.kplptrust.comwebmail.kplptrust.comwww.kplptrust.com
jeancarlosstudio.jeancarlosartist.comwww.jeancarlosstudio.jeancarlosartist.com
autodiscover.qfp.ths.mybluehost.mecpanel.qfp.ths.mybluehost.mecpcalendars.qfp.ths.mybluehost.mecpcontacts.qfp.ths.mybluehost.memail.qfp.ths.mybluehost.meqfp.ths.mybluehost.mewebdisk.qfp.ths.mybluehost.mewebmail.qfp.ths.mybluehost.mewww.qfp.ths.mybluehost.me
silverfitnessfocus.booktipper.comwww.silverfitnessfocus.booktipper.com
autodiscover.kxw.oxd.mybluehost.mecpanel.kxw.oxd.mybluehost.mecpcalendars.kxw.oxd.mybluehost.mecpcontacts.kxw.oxd.mybluehost.mekxw.oxd.mybluehost.memail.kxw.oxd.mybluehost.memail.smilesforadventure.comsmilesforadventure.comwebdisk.kxw.oxd.mybluehost.mewebmail.kxw.oxd.mybluehost.mewww.kxw.oxd.mybluehost.mewww.smilesforadventure.com
blkfairy.commail.blkfairy.comwww.blkfairy.com
autodiscover.tct.jwp.mybluehost.mecpanel.tct.jwp.mybluehost.mecpcalendars.tct.jwp.mybluehost.mecpcontacts.tct.jwp.mybluehost.memail.tct.jwp.mybluehost.memail.zachcomputerservice.commail.zachcomputerservices.comtct.jwp.mybluehost.mewebdisk.tct.jwp.mybluehost.mewebmail.tct.jwp.mybluehost.mewww.tct.jwp.mybluehost.mewww.zachcomputerservice.comwww.zachcomputerservices.comzachcomputerservice.comzachcomputerservices.com
autodiscover.tks.duj.mybluehost.mecpanel.tks.duj.mybluehost.mecpcalendars.tks.duj.mybluehost.mecpcontacts.tks.duj.mybluehost.memail.tks.duj.mybluehost.memail.willow.aetks.duj.mybluehost.mewebdisk.tks.duj.mybluehost.mewebmail.tks.duj.mybluehost.mewillow.aewww.tks.duj.mybluehost.mewww.willow.ae
autodiscover.ncn.ihj.mybluehost.mecpanel.ncn.ihj.mybluehost.mecpcalendars.ncn.ihj.mybluehost.mecpcontacts.ncn.ihj.mybluehost.memail.ncn.ihj.mybluehost.mencn.ihj.mybluehost.mewebdisk.ncn.ihj.mybluehost.mewebmail.ncn.ihj.mybluehost.mewww.ncn.ihj.mybluehost.me
autodiscover.glamourtradingco.comautodiscover.pearlscaffold.comcpanel.glamourtradingco.comcpanel.pearlscaffold.comcpcalendars.glamourtradingco.comcpcalendars.pearlscaffold.comcpcontacts.glamourtradingco.comcpcontacts.pearlscaffold.comglamourtradingco.comglamourtradingco.xlr.kdb.mybluehost.memail.glamourtradingco.commail.pearlscaffold.compearlscaffold.compearlscaffold.xlr.kdb.mybluehost.mewebdisk.glamourtradingco.comwebdisk.pearlscaffold.comwebmail.glamourtradingco.comwebmail.pearlscaffold.comwww.glamourtradingco.comwww.glamourtradingco.xlr.kdb.mybluehost.mewww.pearlscaffold.comwww.pearlscaffold.xlr.kdb.mybluehost.me
autodiscover.rln.bur.mybluehost.mecpanel.rln.bur.mybluehost.mecpcalendars.rln.bur.mybluehost.mecpcontacts.rln.bur.mybluehost.memail.rln.bur.mybluehost.mephoenixdpi.comrln.bur.mybluehost.mewebdisk.rln.bur.mybluehost.mewebmail.rln.bur.mybluehost.mewww.phoenixdpi.comwww.rln.bur.mybluehost.me
autodiscover.iig.ocl.mybluehost.mecpanel.iig.ocl.mybluehost.mecpcalendars.iig.ocl.mybluehost.mecpcontacts.iig.ocl.mybluehost.meiig.ocl.mybluehost.memail.iig.ocl.mybluehost.memail.wealthywallets.orgwealthywallets.orgwebdisk.iig.ocl.mybluehost.mewebmail.iig.ocl.mybluehost.mewww.iig.ocl.mybluehost.mewww.wealthywallets.org
autodiscover.lzw.sco.mybluehost.mecpanel.lzw.sco.mybluehost.mecpcalendars.lzw.sco.mybluehost.mecpcontacts.lzw.sco.mybluehost.melzw.sco.mybluehost.memail.lzw.sco.mybluehost.mewebdisk.lzw.sco.mybluehost.mewebmail.lzw.sco.mybluehost.mewww.lzw.sco.mybluehost.me
agriexotic.comautodiscover.vip.sfg.mybluehost.mecpanel.vip.sfg.mybluehost.mecpcalendars.vip.sfg.mybluehost.mecpcontacts.vip.sfg.mybluehost.memail.vip.sfg.mybluehost.mevip.sfg.mybluehost.mewebdisk.vip.sfg.mybluehost.mewebmail.vip.sfg.mybluehost.mewww.agriexotic.comwww.vip.sfg.mybluehost.me
autodiscover.wamlblog.netcpanel.wamlblog.netcpcalendars.wamlblog.netcpcontacts.wamlblog.netfwv.viq.mybluehost.memail.fwv.viq.mybluehost.memail.wamlblog.netwamlblog.netwebdisk.wamlblog.netwebmail.wamlblog.netwww.fwv.viq.mybluehost.mewww.wamlblog.net
autodiscover.sunmulgift.comcpanel.sunmulgift.comcpcalendars.sunmulgift.comcpcontacts.sunmulgift.commail.sunmulgift.commail.wbm.vvg.mybluehost.mesunmulgift.comwbm.vvg.mybluehost.mewebdisk.sunmulgift.comwebmail.sunmulgift.comwww.sunmulgift.comwww.wbm.vvg.mybluehost.me
autodiscover.meandmytherapist.comcpanel.meandmytherapist.comcpcalendars.meandmytherapist.comcpcontacts.meandmytherapist.commeandmytherapist.comwebdisk.meandmytherapist.comwebmail.meandmytherapist.comwww.meandmytherapist.com
autodiscover.nje.ano.mybluehost.mecpanel.nje.ano.mybluehost.mecpcalendars.nje.ano.mybluehost.mecpcontacts.nje.ano.mybluehost.memail.nje.ano.mybluehost.memail.solitude310gkr.comnje.ano.mybluehost.mesolitude310gkr.comwebdisk.nje.ano.mybluehost.mewebmail.nje.ano.mybluehost.mewww.nje.ano.mybluehost.mewww.solitude310gkr.com
autodiscover.fmatkd.comcpanel.fmatkd.comcpcalendars.fmatkd.comcpcontacts.fmatkd.comfmatkd.commail.fmatkd.comwebdisk.fmatkd.comwebmail.fmatkd.comwww.fmatkd.com
autodiscover.nataliegrayfoundation.orgcpanel.nataliegrayfoundation.orgcpcalendars.nataliegrayfoundation.orgcpcontacts.nataliegrayfoundation.orgmail.nataliegrayfoundation.orgnataliegrayfoundation.orgwebdisk.nataliegrayfoundation.orgwebmail.nataliegrayfoundation.orgwww.nataliegrayfoundation.org
autodiscover.pok.tqd.mybluehost.mecpanel.pok.tqd.mybluehost.mecpcalendars.pok.tqd.mybluehost.mecpcontacts.pok.tqd.mybluehost.melumie.sitemail.lumie.sitemail.pok.tqd.mybluehost.mepok.tqd.mybluehost.mewebdisk.pok.tqd.mybluehost.mewebmail.pok.tqd.mybluehost.mewww.lumie.sitewww.pok.tqd.mybluehost.me
autodiscover.wqb.fgc.mybluehost.mecpanel.wqb.fgc.mybluehost.mecpcalendars.wqb.fgc.mybluehost.mecpcontacts.wqb.fgc.mybluehost.memail.starofalbion.commail.wqb.fgc.mybluehost.mestarofalbion.comwebdisk.wqb.fgc.mybluehost.mewebmail.wqb.fgc.mybluehost.mewqb.fgc.mybluehost.mewww.starofalbion.comwww.wqb.fgc.mybluehost.me
autodiscover.littlemermaidglassbottomboat.comcpanel.littlemermaidglassbottomboat.comcpcalendars.littlemermaidglassbottomboat.comcpcontacts.littlemermaidglassbottomboat.comlittlemermaidglassbottomboat.commail.littlemermaidglassbottomboat.comwebdisk.littlemermaidglassbottomboat.comwebmail.littlemermaidglassbottomboat.comwww.littlemermaidglassbottomboat.com
autodiscover.mxx.xng.mybluehost.mecpanel.mxx.xng.mybluehost.mecpcalendars.mxx.xng.mybluehost.mecpcontacts.mxx.xng.mybluehost.memail.mayaelchuco.commail.mxx.xng.mybluehost.memayaelchuco.commxx.xng.mybluehost.mewebdisk.mxx.xng.mybluehost.mewebmail.mxx.xng.mybluehost.mewww.mayaelchuco.comwww.mxx.xng.mybluehost.me
autodiscover.blueandgrayfinancial.comblueandgrayfinancial.comcpanel.blueandgrayfinancial.comcpcalendars.blueandgrayfinancial.comcpcontacts.blueandgrayfinancial.commail.blueandgrayfinancial.commail.nln.pvh.mybluehost.menln.pvh.mybluehost.mepatriotfederal.comwebdisk.blueandgrayfinancial.comwebmail.blueandgrayfinancial.comwww.blueandgrayfinancial.comwww.nln.pvh.mybluehost.mewww.patriotfederal.com
autodiscover.jesicaciriofit.comcpanel.jesicaciriofit.comcpcalendars.jesicaciriofit.comcpcontacts.jesicaciriofit.comjesicaciriofit.commail.jesicaciriofit.comwebdisk.jesicaciriofit.comwebmail.jesicaciriofit.comwww.jesicaciriofit.com
autodiscover.gsb.ekr.mybluehost.mecpanel.gsb.ekr.mybluehost.mecpcalendars.gsb.ekr.mybluehost.mecpcontacts.gsb.ekr.mybluehost.mefloridagirltravels.comgsb.ekr.mybluehost.memail.floridagirltravels.commail.gsb.ekr.mybluehost.mewebdisk.gsb.ekr.mybluehost.mewebmail.gsb.ekr.mybluehost.mewww.floridagirltravels.comwww.gsb.ekr.mybluehost.me
autodiscover.rms.uqp.mybluehost.mecpanel.rms.uqp.mybluehost.mecpcalendars.rms.uqp.mybluehost.mecpcontacts.rms.uqp.mybluehost.memail.rms.uqp.mybluehost.merms.uqp.mybluehost.mewebdisk.rms.uqp.mybluehost.mewebmail.rms.uqp.mybluehost.mewww.rms.uqp.mybluehost.me
autodiscover.gebuilds.comcpanel.gebuilds.comcpcalendars.gebuilds.comcpcontacts.gebuilds.comgebuilds.commail.gebuilds.commail.shitibuilt.comshitibuilt.comwebdisk.gebuilds.comwebmail.gebuilds.comwww.gebuilds.comwww.shitibuilt.com
autodiscover.sovereigncapitalnyc.comcpanel.sovereigncapitalnyc.comcpcalendars.sovereigncapitalnyc.comcpcontacts.sovereigncapitalnyc.commail.sovereigncapitalnyc.comsovereigncapitalnyc.comwebdisk.sovereigncapitalnyc.comwebmail.sovereigncapitalnyc.comwww.sovereigncapitalnyc.com
autodiscover.happysoulwhotravels.comautodiscover.wewalkwithyou.comcpanel.happysoulwhotravels.comcpanel.wewalkwithyou.comcpcalendars.happysoulwhotravels.comcpcalendars.wewalkwithyou.comcpcontacts.happysoulwhotravels.comcpcontacts.wewalkwithyou.comhappysoulwhotravels.comhappysoulwhotravels.wewalkwithyou.commail.happysoulwhotravels.comwebdisk.happysoulwhotravels.comwebdisk.wewalkwithyou.comwebmail.happysoulwhotravels.comwebmail.wewalkwithyou.comwewalkwithyou.comwww.happysoulwhotravels.wewalkwithyou.comwww.wewalkwithyou.com
autodiscover.elderlyhelps.comautodiscover.track.projectsmind.comcpanel.elderlyhelps.comcpanel.track.projectsmind.comcpcalendars.elderlyhelps.comcpcalendars.track.projectsmind.comcpcontacts.elderlyhelps.comcpcontacts.track.projectsmind.comelderlyhelps.comelderlyhelps.projectsmind.commail.elderlyhelps.commail.track.projectsmind.comtrack.projectsmind.comwebdisk.elderlyhelps.comwebdisk.track.projectsmind.comwebmail.elderlyhelps.comwebmail.track.projectsmind.comwebsite-a4347e21.projectsmind.comwww.elderlyhelps.comwww.elderlyhelps.projectsmind.comwww.track.projectsmind.comwww.website-a4347e21.projectsmind.com
cpanel.digitalstar.cacpcalendars.digitalstar.cacpcontacts.digitalstar.cadigitalstar.camail.digitalstar.cawebdisk.digitalstar.cawebmail.digitalstar.cawww.digitalstar.ca
autodiscover.outofoffice.com.cocpanel.outofoffice.com.cocpcalendars.outofoffice.com.cocpcontacts.outofoffice.com.comail.outofoffice.com.cooutofoffice.com.cowebdisk.outofoffice.com.cowebmail.outofoffice.com.cowebsite-dcb9f1ad.aps.fts.mybluehost.mewww.outofoffice.com.cowww.website-dcb9f1ad.aps.fts.mybluehost.me
abundantlovechildrenshome.comautodiscover.abundantlovechildrenshome.comcpanel.abundantlovechildrenshome.comcpcalendars.abundantlovechildrenshome.comcpcontacts.abundantlovechildrenshome.commail.abundantlovechildrenshome.comwebdisk.abundantlovechildrenshome.comwebmail.abundantlovechildrenshome.comwww.abundantlovechildrenshome.com
autodiscover.galenacomic.comcpanel.galenacomic.comcpcalendars.galenacomic.comcpcontacts.galenacomic.comgalenacomic.commail.galenacomic.comwebdisk.galenacomic.comwebmail.galenacomic.comwww.galenacomic.com
autodiscover.sammysexports.comcpanel.sammysexports.comcpcalendars.sammysexports.comcpcontacts.sammysexports.commail.sammysexports.comsammysexports.comsammysexports.juniorscourt.comwebdisk.sammysexports.comwebmail.sammysexports.comwww.sammysexports.comwww.sammysexports.juniorscourt.com
autodiscover.carlarenata.comcarlarenata.comcpanel.carlarenata.comcpcalendars.carlarenata.comcpcontacts.carlarenata.commail.carlarenata.comwebdisk.carlarenata.comwebmail.carlarenata.comwww.carlarenata.com
androidrobotproductions.comandroidrobotstudios.androidrobotproductions.comandroidrobotstudios.comautodiscover.androidrobotproductions.comautodiscover.androidrobotstudios.comcpanel.androidrobotproductions.comcpanel.androidrobotstudios.comcpcalendars.androidrobotproductions.comcpcalendars.androidrobotstudios.comcpcontacts.androidrobotproductions.comcpcontacts.androidrobotstudios.commail.androidrobotproductions.commail.androidrobotstudios.comwebdisk.androidrobotproductions.comwebdisk.androidrobotstudios.comwebmail.androidrobotproductions.comwebmail.androidrobotstudios.comwww.androidrobotproductions.comwww.androidrobotstudios.androidrobotproductions.comwww.androidrobotstudios.com
autodiscover.strengthmekaniks.comcpanel.strengthmekaniks.comcpcalendars.strengthmekaniks.comcpcontacts.strengthmekaniks.commail.strengthmekaniks.comstrengthmekaniks.comwebdisk.strengthmekaniks.comwebmail.strengthmekaniks.comwebsite-4162e9bf.mindyourown.lifewww.strengthmekaniks.comwww.website-4162e9bf.mindyourown.life
abatementsolutionslacrosse.comautodiscover.abatementsolutionslacrosse.comcpanel.abatementsolutionslacrosse.comcpcalendars.abatementsolutionslacrosse.comcpcontacts.abatementsolutionslacrosse.commail.abatementsolutionslacrosse.comwebdisk.abatementsolutionslacrosse.comwebmail.abatementsolutionslacrosse.comwww.abatementsolutionslacrosse.com
autodiscover.mnj.rgl.mybluehost.mecpanel.mnj.rgl.mybluehost.mecpcalendars.mnj.rgl.mybluehost.mecpcontacts.mnj.rgl.mybluehost.memail.mnj.rgl.mybluehost.memnj.rgl.mybluehost.mewebdisk.mnj.rgl.mybluehost.mewebmail.mnj.rgl.mybluehost.mewww.mnj.rgl.mybluehost.me
advancedhairalternatives.comadvancedhairalternatives.iib.jso.mybluehost.meautodiscover.advancedhairalternatives.comautodiscover.iib.jso.mybluehost.mecpanel.advancedhairalternatives.comcpanel.iib.jso.mybluehost.mecpcalendars.advancedhairalternatives.comcpcalendars.iib.jso.mybluehost.mecpcontacts.advancedhairalternatives.comcpcontacts.iib.jso.mybluehost.meiib.jso.mybluehost.memail.advancedhairalternatives.commail.iib.jso.mybluehost.mewebdisk.advancedhairalternatives.comwebdisk.iib.jso.mybluehost.mewebmail.advancedhairalternatives.comwebmail.iib.jso.mybluehost.mewww.advancedhairalternatives.comwww.advancedhairalternatives.iib.jso.mybluehost.mewww.iib.jso.mybluehost.me
autodiscover.kqv.zzt.mybluehost.mecpanel.kqv.zzt.mybluehost.mecpcalendars.kqv.zzt.mybluehost.mecpcontacts.kqv.zzt.mybluehost.mekqv.zzt.mybluehost.memail.kqv.zzt.mybluehost.mewebdisk.kqv.zzt.mybluehost.mewebmail.kqv.zzt.mybluehost.mewww.kqv.zzt.mybluehost.me
autodiscover.kidsdeal.uscpanel.kidsdeal.uscpcalendars.kidsdeal.uscpcontacts.kidsdeal.uskidsdeal.usmail.kidsdeal.uswebdisk.kidsdeal.uswebmail.kidsdeal.uswww.kidsdeal.us
autodiscover.uwg.ewp.mybluehost.mecpanel.uwg.ewp.mybluehost.mecpcalendars.uwg.ewp.mybluehost.mecpcontacts.uwg.ewp.mybluehost.memail.realtornathaliebay.commail.uwg.ewp.mybluehost.merealtornathaliebay.comuwg.ewp.mybluehost.mewebdisk.uwg.ewp.mybluehost.mewebmail.uwg.ewp.mybluehost.mewww.realtornathaliebay.comwww.uwg.ewp.mybluehost.me
autodiscover.zyf.rnz.mybluehost.mecpanel.zyf.rnz.mybluehost.mecpcalendars.zyf.rnz.mybluehost.mecpcontacts.zyf.rnz.mybluehost.memail.zyf.rnz.mybluehost.mewebdisk.zyf.rnz.mybluehost.mewebmail.zyf.rnz.mybluehost.mewww.zyf.rnz.mybluehost.mezyf.rnz.mybluehost.me
autodiscover.tpy.wbq.mybluehost.mecpanel.tpy.wbq.mybluehost.mecpcalendars.tpy.wbq.mybluehost.mecpcontacts.tpy.wbq.mybluehost.memail.nextnewdeal.blogmail.tpy.wbq.mybluehost.menextnewdeal.blogtpy.wbq.mybluehost.mewebdisk.tpy.wbq.mybluehost.mewebmail.tpy.wbq.mybluehost.mewww.nextnewdeal.blogwww.tpy.wbq.mybluehost.me
mail.ope.vsb.mybluehost.meope.vsb.mybluehost.mewww.ope.vsb.mybluehost.me
acoolroom.comautodiscover.acoolroom.comcpanel.acoolroom.comcpcalendars.acoolroom.comcpcontacts.acoolroom.commail.acoolroom.comwebdisk.acoolroom.comwebmail.acoolroom.comwebsite-9eb510d8.ttr.bqv.mybluehost.mewww.acoolroom.comwww.website-9eb510d8.ttr.bqv.mybluehost.me
aps.fts.mybluehost.meautodiscover.aps.fts.mybluehost.mecpanel.aps.fts.mybluehost.mecpcalendars.aps.fts.mybluehost.mecpcontacts.aps.fts.mybluehost.memail.aps.fts.mybluehost.memail.thejedipath.storethejedipath.storewebdisk.aps.fts.mybluehost.mewebmail.aps.fts.mybluehost.mewww.aps.fts.mybluehost.mewww.thejedipath.store
autodiscover.blackdotcorporation.comblackdotcorporation.comcpanel.blackdotcorporation.comcpcalendars.blackdotcorporation.comcpcontacts.blackdotcorporation.commail.blackdotcorporation.comwebdisk.blackdotcorporation.comwebmail.blackdotcorporation.comwebsite-bcf4fd6a.cib.rfn.mybluehost.mewww.blackdotcorporation.comwww.website-bcf4fd6a.cib.rfn.mybluehost.me
autodiscover.cib.rfn.mybluehost.mecib.rfn.mybluehost.mecpanel.cib.rfn.mybluehost.mecpcalendars.cib.rfn.mybluehost.mecpcontacts.cib.rfn.mybluehost.memail.cib.rfn.mybluehost.memail.styleinternational.onlinestyleinternational.onlinewebdisk.cib.rfn.mybluehost.mewebmail.cib.rfn.mybluehost.mewww.cib.rfn.mybluehost.mewww.styleinternational.online
autodiscover.muk.fyd.mybluehost.mecpanel.muk.fyd.mybluehost.mecpcalendars.muk.fyd.mybluehost.mecpcontacts.muk.fyd.mybluehost.megetlostwithsk.commail.getlostwithsk.commail.muk.fyd.mybluehost.memuk.fyd.mybluehost.mewebdisk.muk.fyd.mybluehost.mewebmail.muk.fyd.mybluehost.mewww.getlostwithsk.comwww.muk.fyd.mybluehost.me
autodiscover.naa.ixy.mybluehost.meautodiscover.socialcarepeople.com.aucpanel.naa.ixy.mybluehost.mecpanel.socialcarepeople.com.aucpcalendars.naa.ixy.mybluehost.mecpcalendars.socialcarepeople.com.aucpcontacts.naa.ixy.mybluehost.mecpcontacts.socialcarepeople.com.aumail.naa.ixy.mybluehost.memail.socialcarepeople.com.aunaa.ixy.mybluehost.mephoenixcareers-com-au.naa.ixy.mybluehost.mesocialcarepeople-com-au.naa.ixy.mybluehost.mesocialcarepeople.com.auwebdisk.naa.ixy.mybluehost.mewebdisk.socialcarepeople.com.auwebmail.naa.ixy.mybluehost.mewebmail.socialcarepeople.com.auwww.naa.ixy.mybluehost.mewww.phoenixcareers-com-au.naa.ixy.mybluehost.mewww.socialcarepeople-com-au.naa.ixy.mybluehost.mewww.socialcarepeople.com.au
autodiscover.xvx.jwz.mybluehost.mecpanel.xvx.jwz.mybluehost.mecpcalendars.xvx.jwz.mybluehost.mecpcontacts.xvx.jwz.mybluehost.memail.xvx.jwz.mybluehost.mewebdisk.xvx.jwz.mybluehost.mewebmail.xvx.jwz.mybluehost.mewww.xvx.jwz.mybluehost.mexvx.jwz.mybluehost.me
aleeshaleadgenerationexpert.comautodiscover.xiv.pan.mybluehost.mecpanel.xiv.pan.mybluehost.mecpcalendars.xiv.pan.mybluehost.mecpcontacts.xiv.pan.mybluehost.memail.aleeshaleadgenerationexpert.commail.xiv.pan.mybluehost.mewebdisk.xiv.pan.mybluehost.mewebmail.xiv.pan.mybluehost.mewww.aleeshaleadgenerationexpert.comwww.xiv.pan.mybluehost.mexiv.pan.mybluehost.me
autodiscover.coronaregime.comcoronaregime.comcpanel.coronaregime.comcpcalendars.coronaregime.comcpcontacts.coronaregime.commail.coronaregime.comwebdisk.coronaregime.comwebmail.coronaregime.comwww.coronaregime.com
autodiscover.jpq.pan.mybluehost.mecpanel.jpq.pan.mybluehost.mecpcalendars.jpq.pan.mybluehost.mecpcontacts.jpq.pan.mybluehost.mejpq.pan.mybluehost.memail.jpq.pan.mybluehost.mewebdisk.jpq.pan.mybluehost.mewebmail.jpq.pan.mybluehost.mewww.jpq.pan.mybluehost.me
autodiscover.ujr.lef.mybluehost.mecpanel.ujr.lef.mybluehost.mecpcalendars.ujr.lef.mybluehost.mecpcontacts.ujr.lef.mybluehost.memail.ujr.lef.mybluehost.meujr.lef.mybluehost.mewebdisk.ujr.lef.mybluehost.mewebmail.ujr.lef.mybluehost.mewww.ujr.lef.mybluehost.me
new.ophandgwen.comsubdomain.ophandgwen.comwww.new.ophandgwen.comwww.subdomain.ophandgwen.com
nnhsclubs.continualflight.comwww.nnhsclubs.continualflight.com
autodiscover.theleadershiprx.comcpanel.theleadershiprx.comcpcalendars.theleadershiprx.comcpcontacts.theleadershiprx.commail.theleadershiprx.comtheleadershiprx.comwebdisk.theleadershiprx.comwebmail.theleadershiprx.comwww.theleadershiprx.com
autodiscover.venicedocumentationproject.comcpanel.venicedocumentationproject.comcpcalendars.venicedocumentationproject.comcpcontacts.venicedocumentationproject.commail.venicedocumentationproject.comvenicedocumentationproject.comwebdisk.venicedocumentationproject.comwebmail.venicedocumentationproject.comwebsite-1e353099.ujr.lef.mybluehost.mewww.venicedocumentationproject.comwww.website-1e353099.ujr.lef.mybluehost.me
renewyou.alvinwayneweiss.comwww.renewyou.alvinwayneweiss.com
allnaturalrepellent.comautodiscover.allnaturalrepellent.comcpanel.allnaturalrepellent.comcpcalendars.allnaturalrepellent.comcpcontacts.allnaturalrepellent.commail.allnaturalrepellent.comwebdisk.allnaturalrepellent.comwebmail.allnaturalrepellent.comwww.allnaturalrepellent.com
autodiscover.hookcommlink.comcpanel.hookcommlink.comcpcalendars.hookcommlink.comcpcontacts.hookcommlink.comhookcommlink.commail.hookcommlink.comwebdisk.hookcommlink.comwebmail.hookcommlink.comwww.hookcommlink.com
autodiscover.samuelecherubini.comcpanel.samuelecherubini.comcpcalendars.samuelecherubini.comcpcontacts.samuelecherubini.commail.samuelecherubini.comsamuelecherubini-com.ujr.lef.mybluehost.mesamuelecherubini.comwebdisk.samuelecherubini.comwebmail.samuelecherubini.comwww.samuelecherubini-com.ujr.lef.mybluehost.mewww.samuelecherubini.com
autodiscover.nws.iml.mybluehost.mecpanel.nws.iml.mybluehost.mecpcalendars.nws.iml.mybluehost.mecpcontacts.nws.iml.mybluehost.memail.nws.iml.mybluehost.menws.iml.mybluehost.mewebdisk.nws.iml.mybluehost.mewebmail.nws.iml.mybluehost.mewww.nws.iml.mybluehost.me
autodiscover.lcx.ssy.mybluehost.mecpanel.lcx.ssy.mybluehost.mecpcalendars.lcx.ssy.mybluehost.mecpcontacts.lcx.ssy.mybluehost.melcx.ssy.mybluehost.memail.lcx.ssy.mybluehost.memail.royallydigitalproducts.comroyallydigitalproducts.comwebdisk.lcx.ssy.mybluehost.mewebmail.lcx.ssy.mybluehost.mewww.lcx.ssy.mybluehost.mewww.royallydigitalproducts.com
autodiscover.ckg.ujd.mybluehost.meckg.ujd.mybluehost.mecpanel.ckg.ujd.mybluehost.mecpcalendars.ckg.ujd.mybluehost.mecpcontacts.ckg.ujd.mybluehost.medoanebaptistchurch.orgmail.ckg.ujd.mybluehost.memail.doanebaptistchurch.orgwebdisk.ckg.ujd.mybluehost.mewebmail.ckg.ujd.mybluehost.mewww.ckg.ujd.mybluehost.mewww.doanebaptistchurch.org
cpanel.lawnrangermi.comcpcalendars.lawnrangermi.comcpcontacts.lawnrangermi.comlawnrangermi.commail.lawnrangermi.comwebdisk.lawnrangermi.comwebmail.lawnrangermi.comwww.lawnrangermi.com
Domain summary
ehfs.health 16 www.ehfs.health 17 mail.ehfs.health 15 www.edu.alarshif.com 10 edu.alarshif.com 9 mail.stowetrails.org 8 stowetrails-org.stowe-trails.com 7 stowetrails.org 7 www.stowetrails.org 7 stowetrails.com 6 stowemountainbike.stowe-trails.com 6 www.stowemountainbike.stowe-trails.com 6 www.stowetrails.stowe-trails.com 6 www.stowetrails.com 5 www.stowetrails-org.stowe-trails.com 5 stowetrails.stowe-trails.com 4 mail.stowetrails.com 4 mail.wat2d.com 4 wat2d.com 4 www.wat2d.com 4 www.allnaturalrepellent.com 3 www.fresaj.com 3 allnaturalrepellent.com 3 www.journalpublisher-co-uk.zbo.pfi.mybluehost.me 3 www.journalpublisher.co.uk 3 admin.41bc.net 3 www.admin.41bc.net 3 mail.journalpublisher.co.uk 3 mail.francesdubreuil.com 3 fresaj.com 3 mail.fresaj.com 3 www.wat2d.alarshif.com 3 wat2d.alarshif.com 3 www.nontribaleconomics.com 2 mail.churchannouncementsolutions.com 2 www.francesdubreuil.com 2 mail.anisumakenya.co.ke 2 charbonneaugreenhoa.org 2 danwiley.com 2 www.danwiley.com 2 www.todayisthedaylifestyle.com 2 mail.todayisthedaylifestyle.com 2 todayisthedaylifestyle.com 2 www.revpatriciahart.net 2 revpatriciahart.net 2 mail.revpatriciahart.net 2 mail.leonardmcelveen.com 2 www.leonardmcelveen.com 2 leonardmcelveen.com 2 www.jetsetloves.com 2 anisumakenya.co.ke 2 mail.charbonneaugreenhoa.org 2 shopuvskinz.com 2 www.androidrobotproductions.com 2 churchannouncementsolutions.com 2 andyrobinetmusic.com 2 jetsetloves.com 2 mail.jetsetloves.com 2 www.agua.cordilleracentral.cl 2 www.churchannouncementsolutions.com 2 mail.nontribaleconomics.com 2 mail.shopuvskinz.com 2 www.orchardhillschristianacademy.com 2 www.clarivatepublications.co.uk 2 agua.cordilleracentral.cl 2 francesdubreuil.com 2 andyrobinetmusic.androidrobotproductions.com 2 www.andyrobinetguitar.androidrobotproductions.com 2 www.api-epaper.parichoy.com 2 mail.allnaturalrepellent.com 2 www.andyrobinetguitar.com 2 mail.charbonneaugreenshoa.org 2 androidrobotproductions.com 2 nontribaleconomics.com 2 tuukkablab.com 2 mail.andyrobinetmusic.com 2 marksolomon.net 2 mail.achronicentrepreneur.com 2 mail.portugalexperience.com 2 mail.andyrobinetguitar.com 2 www.anisumakenya.co.ke 2 andyrobinetguitar.com 2 www.clarivatepublications-co-uk.zbo.pfi.mybluehost.me 2 mail.ukhec.co.uk 2 www.portugalexperience.com 2 api-epaper.parichoy.com 2 www.ukhec-co-uk.zbo.pfi.mybluehost.me 2 andyrobinetguitar.androidrobotproductions.com 2 www.ukhec.co.uk 2 www.clarivate.zbo.pfi.mybluehost.me 2 mail.danwiley.com 2 mail.tuukkablab.com 2 sundayafternoonblog.com 2 mail.orchardhillschristianacademy.com 2 www.sundayafternoonblog.com 2 portugalexperience.com 2 ukhec-co-uk.zbo.pfi.mybluehost.me 2 www.shopuvskinz.com 2 www.andyrobinetmusic.androidrobotproductions.com 2 www.charbonneaugreenhoa.org 2 mail.sundayafternoonblog.com 2 ukhec.co.uk 2 mail.androidrobotproductions.com 2 www.andyrobinetmusic.com 2 orchardhillschristianacademy.com 2 www.charbonneaugreenshoa.org 2 www.marksolomon.net 2 www.tuukkablab.com 2 www.springerpublications.com 1 vbp.pmc.mybluehost.me 1 eliece.com 1 www.dissertationshark.co.uk 1 www.vbp.pmc.mybluehost.me 1 www.dissertationshark-co-uk.zbo.pfi.mybluehost.me 1 www.qru.jgb.mybluehost.me 1 wpr.bwk.mybluehost.me 1 clarivate.zbo.pfi.mybluehost.me 1 mail.wpr.bwk.mybluehost.me 1 www.eliece.com 1 mail.eliece.com 1 www.danqart.com 1 www.springerspublications.co.uk 1 www.scimagopublications.co.uk 1 www.clarivatepublicationsusus.zbo.pfi.mybluehost.me 1 mail.qru.jgb.mybluehost.me 1 badgesoffraud.com 1 www.premics.com 1 www.ecom.journalpublisher.co.uk 1 www.tyd.skj.mybluehost.me 1 qru.jgb.mybluehost.me 1 www.teals.journalpublisher.co.uk 1 tyd.skj.mybluehost.me 1 www.clarivatepublications.zbo.pfi.mybluehost.me 1 yiy.rfl.mybluehost.me 1 mail.premics.com 1 childrensfrenchbookcorner.com 1 premics.com 1 www.springerspublications-co-uk.zbo.pfi.mybluehost.me 1 danqart.com 1 charbonneaugreenshoa.org 1 www.scimagopublications-co-uk.zbo.pfi.mybluehost.me 1 www.clarivatepublications.com 1 mail.tyd.skj.mybluehost.me 1 www.wpr.bwk.mybluehost.me 1 www.clarivatepublicationsus.zbo.pfi.mybluehost.me 1 www.clarivatepublicationsuss.zbo.pfi.mybluehost.me 1 www.yiy.rfl.mybluehost.me 1 mail.badgesoffraud.com 1 www.badgesoffraud.com 1 www.springerpublications.zbo.pfi.mybluehost.me 1 ibfafoundation.com 1 mail.vbp.pmc.mybluehost.me 1 www.ibfafoundation.com 1 mail.ibfafoundation.com 1 journalpublisher.co.uk 1 mail.yiy.rfl.mybluehost.me 1 www.childrensfrenchbookcorner.com 2 journalpublisher-co-uk.zbo.pfi.mybluehost.me 1 www.uxn.hgs.mybluehost.me 0 mail.ncn.ihj.mybluehost.me 0 www.exterior.uprcwichita.com 0 www.prepperstool.com 0 mail.kidzcomics.com 0 ennvisionn.createwebsiteseasily.com 0 www.badgirlgoodfighter.com 0 www.henryjoseph.com 0 archenergygroup.hydrocarbonexchange.com 0 mail.phoenixdpi.com 0 www.kfarringtondesigns.com 0 foundartfactory.net 0 mail.evd.zcr.mybluehost.me 0 www.cisosecsolutions.com 0 mail.wiq.jru.mybluehost.me 0 forensicpocketguide.com 0 modernafencesolutions.modernafencela.com 0 nyashagonsalves.com 0 www.btw.slw.mybluehost.me 0 mail.wvw.ifs.mybluehost.me 0 mail.generalcontractorcapemay.com 0 btw.slw.mybluehost.me 0 www.maideaz.net 0 mail.gnsenterprises.com.pk 0 www.ryw.etw.mybluehost.me 0 www.happyhollowchildcare.com 0 www.whooi.com 0 changeskills.com 0 www.zelayasconstruction.com 0 ericaellis-co.boulderwild.co 0 www.doxentrics.com 0 www.eidegames.com 0 www.artaffairs.gallery 0 mail.nourishedwithlia.com 0 www.mossbayhall.com 0 xcu.qtc.mybluehost.me 0 www.badge3641detroit.com 0 mail.vjo.hgs.mybluehost.me 0 yorktownday.com 0 soarto7.duyanebeauty.com 0 www.qatv4k.com 0 website-e336fcc6.uuq.xxm.mybluehost.me 0 mail.uhm.zca.mybluehost.me 0 personalconfidencecode.com 0 suncoastbaptistchurch.info 0 jyk.com.gt 0 website-c04e6967.anc.xfn.mybluehost.me 0 reverse-globalwarming.net 0 www.website-3840dcb4.qdc.vhl.mybluehost.me 0 www.pixelscott.com 0 www.dynamic-rr.com 0 mail.ygo.bsd.mybluehost.me 0 makemeupmiki.com 0 mail.michaeljcordell.com 0 kidzcomics.com 0 mail.trendzforlesslb.com 0 mail.magneticminstrel.net 0 mail.thelatenotesband.com.au 0 www.ozr.duj.mybluehost.me 0 mail.maideaz.net 0 mail.thegaldamezlandscaping.com 0 www.website-9fc6149c.ygo.bsd.mybluehost.me 0 www.888lockuup.com 0 www.smptheatre.uk 0 mail.mygeotokens.com 0 mail.embassyofniger.org 0 mail.ekaktech.com 0 mail.avaoliviaunlimited.com 0 mail.jenamartin.net 0 mail.liaholden.com 0 spicedock.com 0 us-scientific.com 0 www.dhc.tvd.mybluehost.me 0 dynamicmarriagesolutions.com 0 www.website-0bcb091d.tks.duj.mybluehost.me 0 www.capeofdreams.com 0 frkextruder.sunpringextruder.com 0 wiredss.ae 0 mail.ffa.vhl.mybluehost.me 0 mail.projectweekley.com 0 pxq.lnl.mybluehost.me 0 naturnorge.online 0 centralvalleyliftpros.com 0 ramenmom.com 0 www.julietafumberg.com 0 intgtech.com 0 www.tcbuilderli.com 0 www.thesilvergym.booktipper.com 0 tlk.rfl.mybluehost.me 0 mail.centralvalleyliftpros.com 0 www.britishseabuckthorn.com 0 staging2020.stowetrails.org 0 www.ljs.hzh.mybluehost.me 0 mail.oor.ylh.mybluehost.me 0 mail.jehidalgorealestate.com 0 forensicsupervisorsuccess.forensicpocketguide.com 0 mail.rbgbank.com 0 www.alvinwayneweiss.com 0 www.mcp.haf.mybluehost.me 0 choicesolutions.services 0 www.wordfortress.justingolding.com 0 www.ottawallpaper.com 0 soil-engineering.com 0 canada-shogi.com 0 mail.whooi.com 0 mail.dgm.lnr.mybluehost.me 0 www.website-ef326f66.nqf.egd.mybluehost.me 0 supermartt.xlr.kdb.mybluehost.me 0 zut.ilc.mybluehost.me 0 yeseveryoneeats.com 0 www.themodevents.iib.jso.mybluehost.me 0 mail.ericaellis.co 0 mail.gtg.cun.mybluehost.me 0 mail.centenarynow.com 0 visionzpsis.com 0 www.hairsolutions12.duyanebeauty.com 0 mail.mql.ghe.mybluehost.me 0 cotapult.wewalkwithyou.com 0 www.website-32b76e56.ccl-us.org 0 mail.neverhadaboss.com 0 mail.mlu.koc.mybluehost.me 0 www.uuq.xxm.mybluehost.me 0 mail.ett.nce.mybluehost.me 0 everydayisfrench.com 0 mail.wwr.rbb.mybluehost.me 0 www.frkextruder.com 0 toharborlife.com 0 www.partnersdigitalmarketing.com 0 www.theobriencollective.com 0 www.projectweekley.com 0 mail.britishseabuckthorn.com 0 www.bravoheatingcooling.com 0 dwg.sro.mybluehost.me 0 mail.sizzlesalsyoutube.com 0 www.fortressbilliards.iib.jso.mybluehost.me 0 www.juniorscourt.com 0 www.efsmi.com 0 www.mygeotokens.mindyourown.life 0 mail.mobiushome.com 0 mail.stamenandpistilpt.com 0 mail.xwk.lnl.mybluehost.me 0 waterpurifierrental-com.sunmulgift.com 0 mail.ozwineinternational.com 0 www.blueboxsoftware.net 0 www.irbf.co.uk 0 mustbeoman.alshidi.com 0 sandiparkhurst.com 0 mail.socialjones.com 0 way.tdd.mybluehost.me 0 www.yxo.gqj.mybluehost.me 0 alicexinliu.com 0 www.healthy-queen.com 0 mail.loapioneers.com 0 www.airlinehotelcreditcards.com 0 www.australiatozimbabwe.com 0 www.ybk.goc.mybluehost.me 0 www.thinkdigitalmatter.com 0 www.lazygeniusmom.com 0 yrh.nmb.mybluehost.me 0 mail.internationalkenpokobudohakutsuruassociation.com 0 henryjoseph.spokespersonagency.com 0 nrk.hsk.mybluehost.me 0 www.theressomuchgood.com 0 mail.formydiet.com 0 www.jtt.okl.mybluehost.me 0 www.akq.rfn.mybluehost.me 0 bkt.tvd.mybluehost.me 0 hkr.vcj.mybluehost.me 0 www.spleelogistics.com 0 www.efectoresponsable-pe.karlosperu.com 0 www.jaycrouch.com 0 website-fde254bc.harmonywithtruenature.com 0 xwk.lnl.mybluehost.me 0 lfn.uel.mybluehost.me 0 www.icm.ano.mybluehost.me 0 www.kkn.jpm.mybluehost.me 0 www.littleocean.dynamicsmachines.com 0 earthlycleaning.com 0 mail.kkn.jpm.mybluehost.me 0 www.offer.partnersdigitalmarketing.com 0 zba.mvv.mybluehost.me 0 mail.a2hdesignstudio.ca 0 www.cine4m.com 0 wiq.jru.mybluehost.me 0 crefemme.com 0 mail.daphneybongo.com 0 dhc.tvd.mybluehost.me 0 mail.ofa.ano.mybluehost.me 0 ottawallpaper.com 0 www.intgtech.com 0 www.smileanddialconsulting.com 0 www.avaoliviaunlimited.com 0 mail.grettabevis.com 0 mail.ofo.hzw.mybluehost.me 0 mail.knv.wyd.mybluehost.me 0 www.changeskills.com 0 tcbuilderli.com 0 znu.sgg.mybluehost.me 0 weleadglobal.com 0 website-5fd726fe.geckographix.ca 1 www.qbj.swq.mybluehost.me 0 www.pigarispa.com 0 mail.islandaircontrol.com 0 mail.sharingmyvanlife.com 0 www.bader.im 0 shrmehdi.com 0 mail.tinitiatives.com 0 mail.inspireintegrativehealth.com 0 mail.pcproblems.com 0 mail.rgt.uqp.mybluehost.me 0 www.onsitefabricarecleaning.com 0 mail.balancebusinesssolution.net 0 mail.yorktownday.com 0 sunpring.sunpringextruder.com 0 www.mql.ghe.mybluehost.me 0 www.corpopack.com 0 www.uprcwichita.com 0 mail.llk.kum.mybluehost.me 0 savelamu.org 0 888lockuup.com 0 www.bfftestprep.com 0 etherealbeauty.blog 0 website-0736747f.umh.sgg.mybluehost.me 0 www.website-5fb62e2d.szw.tui.mybluehost.me 0 modernaexteriors.modernafencela.com 0 mail.ludkaslanguagelounge.com 0 cotapult.com 0 avisofitness.booktipper.com 0 theplayfulminds.com 0 zdk.sco.mybluehost.me 0 mail.zentaingenieria.com 0 animefreesite.com 0 jcmagazine.karlosperu.com 0 www.website-7a584425.partnersdigitalmarketing.com 0 mail.yanbenotmane.com 0 mail.oxal.co.uk 0 mail.hdi.bqv.mybluehost.me 0 www.omaafricancuisine.com 0 mail.friendsofhorseshoebendanimals.com 0 mail.urbanheropoodles.com 0 www.dbh.csv.mybluehost.me 0 irbf.co.uk 0 tablierbleu.com 0 trustcaptain-co-uk.zbo.pfi.mybluehost.me 0 nqf.egd.mybluehost.me 0 mail.usi.jso.mybluehost.me 0 www.visionzpsis.com 0 www.rofaendurance.com 0 website-00475774.ane.pzr.mybluehost.me 0 pureprecise.com 0 www.tremarin.co 0 zkh.ipd.mybluehost.me 0 www.zkh.ipd.mybluehost.me 0 mail.alwehdaclub.sa 0 practicas.zelayasconstruction.com 0 ltv.pdu.mybluehost.me 0 www.qfl.bma.mybluehost.me 0 patrickcheatham.com 0 mail.beu.qjv.mybluehost.me 0 website-85dcd0be.pzq.kei.mybluehost.me 0 www.modernaexteriors.com 0 edn.lef.mybluehost.me 0 www.cqg.pgm.mybluehost.me 0 mail.kpb.goj.mybluehost.me 0 dnp.tqp.mybluehost.me 0 paquettedesign.com 0 old.foodmarketgypsy.com 0 ptr.oui.mybluehost.me 0 mail.lakehillsgs.org 0 hly.ref.mybluehost.me 0 nextnewdeal.blog 0 www.sph.zca.mybluehost.me 0 spurwonder.elisamorse.com 0 www.alcyonespace.com 0 hjk.jdq.mybluehost.me 0 mail.kplptrust.com 0 website-ad3eed49.blueandgrayfinancial.com 0 jeancarlosstudio.jeancarlosartist.com 0 mail.qfp.ths.mybluehost.me 0 www.silverfitnessfocus.booktipper.com 0 www.kxw.oxd.mybluehost.me 0 mail.blkfairy.com 0 www.tct.jwp.mybluehost.me 0 www.tks.duj.mybluehost.me 0 forensicsupervisorsuccess.com 0 doabatruck.com 0 abpdgirlspoetryarchive.com 0 mail.vep.oxd.mybluehost.me 0 cleangirlglow.com 0 glamourtradingco.xlr.kdb.mybluehost.me 0 smilesforadventure.com 0 mail.rln.bur.mybluehost.me 0 www.website-0fe27fd5.wqb.fgc.mybluehost.me 0 mail.artaffairs.gallery 0 iig.ocl.mybluehost.me 0 tajdidsupport.com 0 lzw.sco.mybluehost.me 0 www.rbgbank.com 0 gustordonez.keyawagroup.com 0 www.julietafumberg.iib.jso.mybluehost.me 0 agriexotic.com 0 internationalkenpokobudohakutsuruassociation.com 0 mail.whi.oxd.mybluehost.me 0 fwv.viq.mybluehost.me 0 mail.btw.slw.mybluehost.me 0 wbm.vvg.mybluehost.me 0 www.priceprodc.com 0 ffa.vhl.mybluehost.me 0 www.fvb.bof.mybluehost.me 0 www.meandmytherapist.com 0 mail.solitude310gkr.com 0 doulosapologetics.com 0 mail.fmatkd.com 0 www.gpe.rsl.mybluehost.me 0 shrmehdi.thementoringprogram.com 0 mail.yap.ref.mybluehost.me 0 www.nataliegrayfoundation.org 0 mail.dotimpact.com 0 pok.tqd.mybluehost.me 0 starofalbion.com 0 www.littlemermaidglassbottomboat.com 0 cisosecsolutions.com 0 mail.uprcwichita.com 0 mail.fhg.plx.mybluehost.me 0 mayaelchuco.com 0 nln.pvh.mybluehost.me 0 jesicaciriofit.com 0 mail.floridagirltravels.com 0 mail.uxn.hgs.mybluehost.me 0 rms.uqp.mybluehost.me 0 nje.ano.mybluehost.me 0 mail.shitibuilt.com 0 mail.sovereigncapitalnyc.com 0 www.hillts.com 0 mail.happysoulwhotravels.com 0 website-a4347e21.projectsmind.com 0 www.wordfortress.com 0 mail.digitalstar.ca 0 www.magneticminstrel.net 0 gtg.cun.mybluehost.me 0 www.pureprecise.com 0 www.website-dcb9f1ad.aps.fts.mybluehost.me 0 www.cdr.rgy.mybluehost.me 0 mail.abundantlovechildrenshome.com 0 mail.yvv.sup.mybluehost.me 0 galenacomic.com 0 mail.gqg.lnr.mybluehost.me 0 www.website-08a5e277.siestasailing.com 0 www.sammysexports.com 0 www.carlarenata.com 0 mail.soil-engineering.com 0 mail.androidrobotstudios.com 0 www.strengthmekaniks.com 0 mail.ennvisionn.com 0 www.usi.jso.mybluehost.me 0 www.abatementsolutionslacrosse.com 0 mail.mnj.rgl.mybluehost.me 0 royallydigitalproducts.com 0 www.advancedhairalternatives.iib.jso.mybluehost.me 0 www.kqv.zzt.mybluehost.me 0 intermediateresolutions.com 0 mail.hgu.aqd.mybluehost.me 0 mail.kidsdeal.us 0 www.smccapitalgrp.com 0 www.ltv.pdu.mybluehost.me 0 www.knv.wyd.mybluehost.me 0 www.mindyourownbirth.ca 0 www.ksnartistry.com 0 www.trading.kismetmind.com 0 mail.uwg.ewp.mybluehost.me 0 simbaonlinestore.com 0 hosnakalantar.com 0 dietarycafe.com 0 llk.kum.mybluehost.me 0 website-423d9573.beu.qjv.mybluehost.me 0 www.zyf.rnz.mybluehost.me 0 mail.nextnewdeal.blog 0 www.tpy.wbq.mybluehost.me 0 ope.vsb.mybluehost.me 0 www.smilesforadventure.com 0 mail.lyy.wev.mybluehost.me 0 www.acoolroom.com 0 mail.thejedipath.store 0 website-e8fb4000.ygo.bsd.mybluehost.me 0 mail.drip420.com 0 website-bcf4fd6a.cib.rfn.mybluehost.me 0 onthehousetops.com 0 aispeechteacher.daphneybongo.com 0 www.tinitiatives.com 0 www.cib.rfn.mybluehost.me 0 mail.getlostwithsk.com 0 www.socialcarepeople.com.au 0 mhsdebatealumni.com 0 xvx.jwz.mybluehost.me 0 mail.townofkelfordnc.gov 0 mail.glamourtradingco.com 0 www.xiv.pan.mybluehost.me 0 gqg.lnr.mybluehost.me 0 aleeshaleadgenerationexpert.com 0 www.onthehousetops.com 0 mail.cib.rfn.mybluehost.me 0 cib.rfn.mybluehost.me 0 vcc.rgy.mybluehost.me 0 mail.ope.vsb.mybluehost.me 0 www.website-bcf4fd6a.cib.rfn.mybluehost.me 0 coronaregime.com 0 mail.jpq.pan.mybluehost.me 0 www.ujr.lef.mybluehost.me 0 mail.henryjoseph.com 0 mail.samuelecherubini.com 1 digitalstar.ca 0 subdomain.ophandgwen.com 0 nnhsclubs.com 0 www.theleadershiprx.com 0 www.website-1e353099.ujr.lef.mybluehost.me 0 renewyou.alvinwayneweiss.com 0 fvb.bof.mybluehost.me 0 mail.xiv.pan.mybluehost.me 0 kelp-ark.org 0 frkplant-net.sunpringextruder.com 0 mail.hookcommlink.com 0 samuelecherubini-com.ujr.lef.mybluehost.me 0 mail.mindyourownbirth.ca 0 nws.iml.mybluehost.me 0 www.bsv.kdq.mybluehost.me 0 mail.uscies.com 0 uscies.com 0 lcx.ssy.mybluehost.me 0 doanebaptistchurch.org 0 mail.doanebaptistchurch.org 0 lawnrangermi.com 0 mail.medigappeople.com 0 www.samuelecherubini-com.ujr.lef.mybluehost.me 0 www.sunmul-gift.sunmulgift.com 0 mail.silhouetteleah.com 0 studiobyzantium.space 0 scottpysher.com 0 www.sbj.fih.mybluehost.me 0 mail.qhs.kdq.mybluehost.me 0 www.mgv.tqd.mybluehost.me 0 mgv.tqd.mybluehost.me 0 tinitiatives.com 0 mail.mgp.zyv.mybluehost.me 0 www.makemeupmiki.com 0 mail.ecg.abf.mybluehost.me 0 mail.cdr.rgy.mybluehost.me 0 www.bookowlebooks.com 0 liketheholiday.com 0 mail.yrp.vhl.mybluehost.me 0 mail.dunestrailers.com 0 mail.sph.zca.mybluehost.me 0 mail.pezlogic.com 0 mail.wyh.ylh.mybluehost.me 0 jjohnsonpublishing.com 0 www.sandiparkhurst.com 0 mail.soullightguidance.com 0 www.roamtobreathe.com 0 www.doulosapologetics.com 0 www.mindyourownbirth-ca.mindyourown.life 0 ttw.nqg.mybluehost.me 0 theressomuchgood.com 0 www.laasool.com 0 www.cascadesignaturephotography.com 0 mail.us-scientific.com 0 www.ngt.mje.mybluehost.me 0 mail.georgiaparis.net 0 mail.codeflex.co 0 tribewoman.com 0 www.eagleeyewear-net.brandonolin.com 0 www.walkabouthills.paintedwolfmedia.com 0 www.website-bd5878c6.harmonywithtruenature.com 0 www.curlyhairproducts.com 0 qhs.kdq.mybluehost.me 0 temitrismarketinghelp.com 0 mail.supermarket2amigosgmail.com 0 mail.barnesmailftw.com 0 mail.cpapostolichub.org 0 mail.penprojects.com 0 mail.asilverliningcounseling.org 0 website-ff8c04c5.ond.emu.mybluehost.me 0 rodolfistasdecorazon.usi.jso.mybluehost.me 0 mail.tredemapping.com 0 mail.alicexinliu.com 0 mail.icm.ano.mybluehost.me 0 mathesisml.com 0 www.website-d8fc586a.hollytoscanini.com 0 www.kps.dei.mybluehost.me 0 www.jennayoungconsulting.com 0 mail.forensicsupervisorsuccess.com 0 www.wvw.ifs.mybluehost.me 0 www.vegas-x-tech.modernafencela.com 0 zlunasalon.com 0 yap.ref.mybluehost.me 0 mail.thebuildabetterman.com 0 www.website-1a89461e.ane.pzr.mybluehost.me 0 martinispickleball.com 1 www.soil-engineering.com 0 www.optimizevaservicesllc.com 0 www.lougheedband.paintedwolfmedia.com 0 www.elbds.com 1 yda.xrd.mybluehost.me 0 vegas-x-tech.modernafencela.com 1 mail.dbh.csv.mybluehost.me 0 www.ardsoftsolutions.com 0 www.riseupabove.com 0 mail.animefreesite.com 0 trading.kismetmind.com 0 www.uni.jvd.mybluehost.me 0 cine4m-com.sunmulgift.com 0 mail.spicedock.com 0 mail.wilmahollis.com 0 www.blubakery.ca 0 rxn.kdf.mybluehost.me 0 www.goodentllc.com 0 www.musicjazzg.com 0 www.texasdfwrealtor.com 0 mail.erinnkdaniel.com 0 mail.prx.doq.mybluehost.me 0 mail.paintedwolfmedia.com 0 frk-machine.sunpringextruder.com 0 www.internationalkenpokobudohakutsuruassociation.com 0 mail.spacemanmoving.com 0 mail.priceprova.com 0 mail.jennayoungconsulting.com 0 www.modernaexteriors.modernafencela.com 0 www.ffa.vhl.mybluehost.me 0 www.ooa.pvh.mybluehost.me 0 shop.wealthygen.com 0 www.qmd.bzx.mybluehost.me 0 mail.smileanddialconsulting.com 0 mail.bengonet.com 0 fie.dei.mybluehost.me 0 www.wwr.rbb.mybluehost.me 0 jrj.ygs.mybluehost.me 0 mail.egastar.com 0 walkabouthills.paintedwolfmedia.com 0 website-5cfeb70c.otr.tqp.mybluehost.me 0 www.apx.xfn.mybluehost.me 0 www.jjohnsonpublishing.com 0 perspectivesireland.com 0 jen.jdq.mybluehost.me 0 hbh.fyd.mybluehost.me 0 www.viigems.duyanebeauty.com 0 sabrinamtzart.mr-quackersartistry.com 0 mail.dnp.tqp.mybluehost.me 0 erinkdaniel.com 0 mail.mse.ihh.mybluehost.me 0 mail.nfi.qni.mybluehost.me 0 modernaexteriors.com 0 www.wilmahollis.com 0 mail.gallosbarbershop.com 0 mail.ljk.qzx.mybluehost.me 0 mail.natesonlinemarketing.com 0 www.alwehdaclub.sa 0 mail.brsmarthomeltd.co.uk 0 mail.wrc.kdq.mybluehost.me 0 hamiltonplumbingsc.com.au 0 bsv.kdq.mybluehost.me 0 mail.a3dp.com.au 0 mail.holistichealthbalancebycathey.com 0 www.jjv.ocl.mybluehost.me 0 insobeau-com.sunmulgift.com 0 www.a3dp.com.au 0 onyxeventsdesign.com 0 www.paracleteministriesinternational-org.duyanebeauty.com 0 thelatenotesband.com.au 1 www.recipesandplaces.com 0 www.philipalves.com 0 trevormusgrove.com 0 breakupglowupfight.com 0 byd.wyz.mybluehost.me 0 mail.allergypacific.com 1