Netlify
tcp/443 tcp/80
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6c0cbd686a893037614f19f4ad5f8a078eeb004d8
GraphQL introspection enabled at /api/graphql Types: 1722 (by kind: ENUM: 38, INPUT_OBJECT: 201, OBJECT: 1469, SCALAR: 8, UNION: 6) Operations: - Query: Query | fields: Page, Pages, countPages, docAccessPage, versionPage - Mutation: Mutation | fields: createPage, deletePage, duplicatePage, restoreVersionPage, updatePage Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d691220750ee7c31943740410b8aa0d35220baf32e
GraphQL introspection enabled at /api/graphql Types: 968 (by kind: ENUM: 22, INPUT_OBJECT: 153, OBJECT: 784, SCALAR: 8, UNION: 1) Operations: - Query: Query | fields: Post, Posts, countPosts, docAccessPost, versionPost - Mutation: Mutation | fields: createPost, deletePost, duplicatePost, restoreVersionPost, updatePost Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6fa5f38a9021fcc0b74bea54947b7787cb8b5b60c
GraphQL introspection enabled at /api/graphql Types: 822 (by kind: ENUM: 14, INPUT_OBJECT: 113, OBJECT: 684, SCALAR: 8, UNION: 3) Operations: - Query: Query | fields: User, Users, countUsers, docAccessUser, meUser - Mutation: Mutation | fields: createUser, deleteUser, logoutUser, refreshTokenUser, updateUser Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d65a7d758e3437bb7eb8300fc6cec0b2e5ceabfbb1
GraphQL introspection enabled at /api/graphql Types: 677 (by kind: ENUM: 30, INPUT_OBJECT: 107, OBJECT: 529, SCALAR: 8, UNION: 3) Operations: - Query: Query | fields: User, Users, countUsers, docAccessUser, meUser - Mutation: Mutation | fields: createUser, deleteUser, logoutUser, refreshTokenUser, updateUser Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d67cdc8bdaeaffbeca650c42c38339b1988498d4b8
GraphQL introspection enabled at /api/graphql Types: 987 (by kind: ENUM: 15, INPUT_OBJECT: 132, OBJECT: 828, SCALAR: 8, UNION: 4) Operations: - Query: Query | fields: Author, Authors, Post, countAuthors, docAccessAuthor - Mutation: Mutation | fields: createAuthor, createPost, deleteAuthor, duplicateAuthor, updateAuthor Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224a93ca8c
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://ajay.k: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@github.com/ajaykundnani/sneatetech.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [user] name = ajay.k email = ajaykundnani03@gmail.com
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65221e67bfc4
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/ajaykundnani/sneatetech.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [user] email = ajaykundnani03@gmail.com name = ajay.k
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb5971f94c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/JCRob84/hill-ranch-estates123.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652202657e25
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [user] name = peterkim676 email = peterkim676@users.noreply.github.com [remote "origin"] url = git@github.com:peterkim676/codenamepeterk.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43be2c0c5d94ef082a5d1a43c6213833b8ee434c8e
Public Swagger UI/API detected at path: /swagger.json - sample paths:
ANY /networktest-report/{id}
ANY /networktest/{id}
GET /assets
GET /assets/{assetId}
GET /ip-ranges
GET /qualityrtc/result/{id}
GET /testagents/{testAgentId}
GET /testagents/{testAgentId}/files
GET /testagents/{testAgentId}/screenshots
GET /testruns/{testRunId}
GET /tests
GET /tests/{testId}
POST /analyzertc/upload
POST /qualityrtc/invite
POST /testruns/externalValue/{session_name}
POST /tests/{testId}/run
POST /watchrtc/highlights
PUT /watchrtc/room/{roomId}/peer/{peerId}/keys
PUT /watchrtc/room/{rtcRoomId}/peer/{rtcPeerId}/user-rating
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff438af81bd6dc4687e473dc3cbe73dc3cbe73dc3cbe
Public Swagger UI/API detected at path: /swagger.json - sample paths: GET /api/assets GET /api/health POST /api/presign
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd12ec8532c2ec8532c2ec8532c2ec8532c2ec8532c2ec8532c
Public Swagger UI/API detected at path: /swagger/index.html
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43be2c0c5d94ef082a5d1a43c6213833b801dde8a9
Public Swagger UI/API detected at path: /swagger.json - sample paths:
ANY /networktest-report/{id}
ANY /networktest/{id}
GET /assets
GET /assets/{assetId}
GET /ip-ranges
GET /qualityrtc/result/{id}
GET /testagents/{testAgentId}
GET /testagents/{testAgentId}/files
GET /testagents/{testAgentId}/screenshots
GET /testruns/{testRunId}
GET /tests
GET /tests/{testId}
POST /qualityrtc/invite
POST /testruns/externalValue/{session_name}
POST /tests/{testId}/run
POST /watchrtc/highlights
PUT /watchrtc/room/{rtcRoomId}/peer/{rtcPeerId}/user-rating
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd110b5863c895e44e1f8868687f8868687f8868687f8868687
Public Swagger UI/API detected at path: /api-docs/swagger.json - sample paths: GET /api/ai-monitoring GET /api/recommend
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff432f369d770ba917da0f2149eceecf802119a62366
Public Swagger UI/API detected at path: /swagger.json - sample paths: GET /.netlify/functions/get-analysis GET /.netlify/functions/get-analysis-status GET /.netlify/functions/get-twitter-tweets GET /.netlify/functions/get-twitter-user POST /.netlify/functions/send-analysis-email POST /.netlify/functions/start-analysis
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1aad035490f76f5cb216ee5cd76b25901510d49773bdbe782
Public Swagger UI/API detected at path: /swagger/index.html - sample paths:
GET /api/registeredapps
GET /api/registeredapps/{id}
GET /{code}
POST /api/auth/login
POST /api/auth/signup
POST /api/feshorten
POST /api/register
POST /api/shorten
PUT /api/register/{id}
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1bf890109bf890109bf890109bf890109bf890109bf890109
Public Swagger UI/API detected at path: /api-docs/swagger.json
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd110b5863cad4fe6272e9cab827191ee7ad69978ea4d35f25d
Public Swagger UI/API detected at path: /api-docs/swagger.json - sample paths:
GET /api/v1/devices
GET /api/v1/devices/did/{did}
GET /api/v1/devices/landlord
GET /api/v1/devices/my
GET /api/v1/devices/online
GET /api/v1/devices/{id}
GET /api/v1/devices/{id}/stats
GET /api/v1/users/{id}
GET /api/v1/users/{user_id}/devices
POST /api/v1/auth/login
POST /api/v1/auth/logout
PUT /api/v1/devices/{id}/status
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43be2c0c5d94ef082a5d1a43c6213833b801dde8a9
Public Swagger UI/API detected at path: /swagger.json - sample paths:
ANY /networktest-report/{id}
ANY /networktest/{id}
GET /assets
GET /assets/{assetId}
GET /ip-ranges
GET /qualityrtc/result/{id}
GET /testagents/{testAgentId}
GET /testagents/{testAgentId}/files
GET /testagents/{testAgentId}/screenshots
GET /testruns/{testRunId}
GET /tests
GET /tests/{testId}
POST /qualityrtc/invite
POST /testruns/externalValue/{session_name}
POST /tests/{testId}/run
POST /watchrtc/highlights
PUT /watchrtc/room/{rtcRoomId}/peer/{rtcPeerId}/user-rating
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd110b5863c1ec8f0c5479e8010479e8010479e8010479e8010
Public Swagger UI/API detected at path: /api-docs/swagger.json - sample paths:
GET /projects
GET /projects/{id}
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff4394bd50e494bd50e494bd50e494bd50e494bd50e4
Public Swagger UI/API detected at path: /swagger.json - sample paths: GET /api/AvailableTimeslots
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1f3d88d60878454ae7ba4c31c21108cefc753b45e89bacb07
Public Swagger UI/API detected at path: /swagger/v1/swagger.json - sample paths:
GET /{code}
POST /api/auth/login
POST /api/auth/signup
POST /api/register
POST /api/shorten
Severity: info
Fingerprint: 5733ddf49ff49cd1aad035497acc1b657785b503263768221aa30c9b7b9e6554
Public Swagger UI/API detected at path: /swagger/index.html - sample paths:
GET /{code}
POST /api/auth/login
POST /api/auth/signup
POST /api/register
POST /api/shorten
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43f090a68e7b41ed0bf7cc30ea004c38631c6360a6
Public Swagger UI/API detected at path: /swagger.json - sample paths:
DELETE /api/referral/{referralId}/client
DELETE /api/referral/{referralId}/referrer
GET /api/authorizedping
GET /api/client-search/{query}
GET /api/client/{clientId}
GET /api/client/{clientId}/contact-notes
GET /api/client/{clientId}/referrals
GET /api/confirmPasswordResetToken/{tokenId}
GET /api/diagnostic
GET /api/exception-ping
GET /api/ping
GET /api/referrals/{referralId}
GET /api/referrer-search/{query}
GET /api/referrer/{referrerId}
GET /api/search/{query}
GET /api/staff
GET /api/staff/{staffId}
GET /api/user/current
POST /api/clients/{clientId}/similar
POST /api/login
POST /api/loginTwoStep
POST /api/logout
POST /api/my_referrals
POST /api/referral/{referralId}
POST /api/referral/{referralId}/anonymous/
POST /api/referral/{referralId}/assign-referrer/{referrerId}
POST /api/referral/{referralId}/client/{clientId}
POST /api/referral/{referralId}/completion
POST /api/referral/{referralId}/date
POST /api/referral/{referralId}/followUp/{followUpId}
POST /api/referral/{referralId}/info
POST /api/referral/{referralId}/referredTo/{referredToId}
POST /api/referrals
POST /api/referrals/reassign
POST /api/referrals_export
POST /api/referrals_export_detail
POST /api/referrals_export_notes
POST /api/referrals_export_report/{reportYear}
POST /api/refresh
POST /api/requestForgotPassword
POST /api/resendTwoFaEmail
POST /api/resetPassword
POST /api/staff/{staffId}/reset-password
PUT /api/referral/{referralId}/call_consent
PUT /api/referral/{referralId}/contact-note/{contactNoteId}
PUT /api/referral/{referralId}/followup-actions
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd12ec8532c2ec8532c2ec8532c2ec8532c2ec8532c2ec8532c
Public Swagger UI/API detected at path: /swagger/index.html
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43fb740631a28d8c1ca7e661c6a7e661c6a7e661c6
Public Swagger UI/API detected at path: /swagger.json - sample paths:
GET /exercise/opensections/{orgin}
GET /v1/boost/classes/date/{date}
GET /v1/boost/classes/week/{weekNumber}
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b6e67656b6e67656b6e67656b6e67656b6e67656b6e67656
Public Swagger UI/API detected at path: /swagger-ui.html
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff4309b00103c4d93543c075faab19d2daa1d5f0259f
Public Swagger UI/API detected at path: /swagger.json - sample paths:
GET /company/{id}
GET /face_id
GET /face_id/{id}
GET /group_message/description/{description}
GET /group_message/{id}
GET /persons/company/{company}
GET /persons/{id}
GET /reports/company/{company_id}
GET /reports/{id}
GET /tests/company/{companyId}
GET /tests/registration/{registration}
GET /tests/{id}
GET /users/company/{company_id}
GET /users/{id}
POST /company
POST /group_message
POST /persons
POST /session
POST /users
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1f3d88d6069b6e0ae55b7a00fe1c22f6974fd34103f68aabb
Public Swagger UI/API detected at path: /swagger/v1/swagger.json - sample paths:
GET /registrar/registrars-details.json
GET /registrar/registrars.json
GET /root/db.json
GET /root/detail/{tldName}/{tldName}.json
GET /stats/{year}/{month}/{date}/stats.json
GET /tlds/tlds_list.json
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd12ec8532c2ec8532c2ec8532c2ec8532c2ec8532c2ec8532c
Public Swagger UI/API detected at path: /swagger/index.html
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1f5e22fb4122becd90e1a80dd3d1cfe788fcc627378936e40
Public Swagger UI/API detected at path: /api/swagger.json - sample paths:
GET /charges/
GET /currency/currencies
GET /lightning/invoice/payments
GET /lightning/invoice/qr/{id}
GET /lightning/invoice/status/{id}
GET /onchain/invoice/get_status/{id}
GET /onchain/invoice/qr-btc/{id}
GET /onchain/invoice/qr-ln/{id}
GET /onchain/invoice/qr-unified/{id}
GET /paycode/link/{id}
GET /paycode/links
GET /paycode/print/{id}
GET /subscription/bitcoin/qr/{invoice_id}
GET /subscription/bitcoin/status/{invoice_id}
GET /subscription/plans
GET /subscription/status/{user_id}
GET /webhooks/lightning
GET /webhooks/onchain
GET /webhooks/paycode
POST /auth/activate-wallet/{user_id}
POST /auth/bind-wallet-keys/{user_id}
POST /auth/login
POST /auth/setup-split-payment/{user_id}
POST /auth/signup
POST /lightning/invoice/
POST /onchain/invoice/
POST /subscription/activate-test/{user_id}
POST /subscription/bitcoin/checkout
POST /subscription/cancel/{user_id}
POST /subscription/checkout
PUT /auth/update-settings/{user_id}
Severity: info
Fingerprint: 5733ddf49ff49cd1f5e22fb4122becd90e1a80dd3d1cfe788fcc6273b292bb59
Public Swagger UI/API detected at path: /api/swagger.json - sample paths:
GET /charges/
GET /currency/currencies
GET /lightning/invoice/payments
GET /lightning/invoice/qr/{id}
GET /lightning/invoice/status/{id}
GET /onchain/invoice/get_status/{id}
GET /onchain/invoice/qr-btc/{id}
GET /onchain/invoice/qr-ln/{id}
GET /onchain/invoice/qr-unified/{id}
GET /paycode/link/{id}
GET /paycode/links
GET /paycode/print/{id}
GET /subscription/plans
GET /subscription/status/{user_id}
GET /webhooks/lightning
GET /webhooks/onchain
GET /webhooks/paycode
POST /auth/activate-wallet/{user_id}
POST /auth/bind-wallet-keys/{user_id}
POST /auth/login
POST /auth/setup-split-payment/{user_id}
POST /auth/signup
POST /lightning/invoice/
POST /onchain/invoice/
POST /subscription/activate-test/{user_id}
POST /subscription/cancel/{user_id}
POST /subscription/checkout
PUT /auth/update-settings/{user_id}
Severity: info
Fingerprint: 5733ddf49ff49cd1f5e22fb4122becd90e1a80dd3d1cfe788fcc62734e6f68e0
Public Swagger UI/API detected at path: /api/swagger.json - sample paths:
GET /charges/
GET /currency/currencies
GET /lightning/invoice/payments
GET /lightning/invoice/qr/{id}
GET /lightning/invoice/status/{id}
GET /onchain/invoice/get_status/{id}
GET /onchain/invoice/qr-btc/{id}
GET /onchain/invoice/qr-ln/{id}
GET /onchain/invoice/qr-unified/{id}
GET /paycode/link/{id}
GET /paycode/links
GET /paycode/print/{id}
GET /subscription/plans
GET /subscription/status/{user_id}
GET /webhooks/lightning
GET /webhooks/onchain
GET /webhooks/paycode
POST /auth/activate-wallet/{user_id}
POST /auth/bind-wallet-keys/{user_id}
POST /auth/login
POST /auth/signup
POST /lightning/invoice/
POST /onchain/invoice/
POST /subscription/activate-test/{user_id}
POST /subscription/cancel/{user_id}
POST /subscription/checkout
PUT /auth/update-settings/{user_id}
Severity: info
Fingerprint: 5733ddf49ff49cd1f5e22fb4122becd90e1a80dd3d1cfe788fcc62731fa5c747
Public Swagger UI/API detected at path: /api/swagger.json - sample paths:
GET /charges/
GET /currency/currencies
GET /lightning/invoice/payments
GET /lightning/invoice/qr/{id}
GET /lightning/invoice/status/{id}
GET /onchain/invoice/get_status/{id}
GET /onchain/invoice/qr-btc/{id}
GET /onchain/invoice/qr-ln/{id}
GET /onchain/invoice/qr-unified/{id}
GET /paycode/link/{id}
GET /paycode/links
GET /paycode/print/{id}
GET /webhooks/lightning
GET /webhooks/onchain
GET /webhooks/paycode
POST /lightning/invoice/
POST /onchain/invoice/
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff431fe0d7f7e38656ab11909d38cc538647cc538647
Public Swagger UI/API detected at path: /swagger.json - sample paths:
GET /gateways
GET /gateways/{id}
GET /health
POST /gateways/
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1f3d88d60878454ae7ba4c31c21108cefc753b45e89bacb07
Public Swagger UI/API detected at path: /swagger/v1/swagger.json - sample paths:
GET /{code}
POST /api/auth/login
POST /api/auth/signup
POST /api/register
POST /api/shorten
Severity: info
Fingerprint: 5733ddf49ff49cd1aad035497acc1b657785b503263768221aa30c9b7b9e6554
Public Swagger UI/API detected at path: /swagger/index.html - sample paths:
GET /{code}
POST /api/auth/login
POST /api/auth/signup
POST /api/register
POST /api/shorten
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff4322dae2b072952ca4f6035e53a4ddffe5a7b1c076
Public Swagger UI/API detected at path: /swagger.json - sample paths:
DELETE /delete-user
GET /component
GET /components
GET /settings
GET /user/{userId}
GET /users
POST /add-user
POST /edit-user
POST /login
POST /logout
POST /screenshot
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43fe4b59e1c747a82a5d8fbcd999e498250880da2e
Public Swagger UI/API detected at path: /swagger.json - sample paths:
DELETE /v1/bookings/{id}/unjoin
GET /v1/bookings
GET /v1/bookings/{id}
GET /v1/fields
GET /v1/fields/{id}
GET /v1/venues
GET /v1/venues/{id}
GET /v1/venues/{venue_id}/fields
POST /v1/bookings/{id}/join
POST /v1/login
POST /v1/register
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43cfe67a741200f7576024399c95456b151eee46fe
Public Swagger UI/API detected at path: /swagger.json - sample paths:
GET /api/auth/me
GET /api/auth/verify-email/{token}
GET /api/cheque
GET /api/cheque/{id}
GET /api/cheque/{id}/qr-code
GET /api/cheque/{id}/verify
GET /api/dono/campaigns
GET /api/dono/campaigns/ending-soon
GET /api/dono/campaigns/featured
GET /api/dono/campaigns/search
GET /api/dono/campaigns/trending
GET /api/dono/campaigns/user
GET /api/dono/campaigns/{id}
GET /api/dono/campaigns/{id}/contributors
GET /api/invoice
GET /api/invoice/health
GET /api/invoice/{id}
GET /api/payments/transaction/{reference}
GET /api/payments/transactions
GET /api/payments/verify/{referenceCode}
GET /api/payments/verify/{reference}
GET /api/payments/virtual-account/{accountNumber}/transactions
GET /api/payments/virtual-accounts
GET /api/xcrow/health
GET /api/xcrow/transactions
GET /api/xcrow/transactions/status/{status}
GET /api/xcrow/transactions/user/{phoneNumber}
GET /api/xcrow/transactions/{id}
PATCH /api/invoice/{id}/status
POST /api/auth/forgot-password
POST /api/auth/login
POST /api/auth/register
POST /api/cheque/claim-by-number
POST /api/cheques/{id}/claim
POST /api/dono/campaigns/{id}/contribute
POST /api/dono/campaigns/{id}/donate
POST /api/dono/campaigns/{id}/update
POST /api/dono/campaigns/{id}/verify-contribution
POST /api/payments/checkout-config
POST /api/payments/initialize
POST /api/payments/virtual-account
POST /api/payments/webhook
POST /api/xcrow/transactions/{id}/confirm-fulfillment
POST /api/xcrow/transactions/{id}/confirm-payment
POST /api/xcrow/transactions/{id}/dispute
POST /api/xcrow/transactions/{id}/release-funds
POST /api/xcrow/transactions/{id}/resolve-dispute
PUT /api/auth/reset-password/{token}
PUT /api/cheque/{id}/cancel
PUT /api/dono/campaigns/{id}/verify
PUT /api/xcrow/transactions/{id}/status
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43cfe67a741200f7576024399c95456b1584aa2ca2
Public Swagger UI/API detected at path: /swagger.json - sample paths:
GET /api/auth/me
GET /api/auth/verify-email/{token}
GET /api/cheque
GET /api/cheque/{id}
GET /api/cheque/{id}/qr-code
GET /api/cheque/{id}/verify
GET /api/dono/campaigns
GET /api/dono/campaigns/ending-soon
GET /api/dono/campaigns/featured
GET /api/dono/campaigns/search
GET /api/dono/campaigns/trending
GET /api/dono/campaigns/user
GET /api/dono/campaigns/{id}
GET /api/dono/campaigns/{id}/contributors
GET /api/payments/transaction/{reference}
GET /api/payments/transactions
GET /api/payments/verify/{referenceCode}
GET /api/payments/verify/{reference}
GET /api/payments/virtual-account/{accountNumber}/transactions
GET /api/payments/virtual-accounts
GET /api/xcrow/transactions
GET /api/xcrow/transactions/status/{status}
GET /api/xcrow/transactions/user/{phoneNumber}
GET /api/xcrow/transactions/{id}
POST /api/auth/forgot-password
POST /api/auth/login
POST /api/auth/register
POST /api/cheque/claim-by-number
POST /api/cheques/{id}/claim
POST /api/dono/campaigns/{id}/contribute
POST /api/dono/campaigns/{id}/donate
POST /api/dono/campaigns/{id}/update
POST /api/dono/campaigns/{id}/verify-contribution
POST /api/payments/checkout-config
POST /api/payments/initialize
POST /api/payments/virtual-account
POST /api/payments/webhook
POST /api/xcrow/transactions/{id}/confirm-fulfillment
POST /api/xcrow/transactions/{id}/confirm-payment
POST /api/xcrow/transactions/{id}/dispute
POST /api/xcrow/transactions/{id}/release-funds
POST /api/xcrow/transactions/{id}/resolve-dispute
PUT /api/auth/reset-password/{token}
PUT /api/cheque/{id}/cancel
PUT /api/dono/campaigns/{id}/verify
PUT /api/xcrow/transactions/{id}/status
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff43f64db88e64000a87b38db934a6d669333b684233
Public Swagger UI/API detected at path: /swagger.json - sample paths:
DELETE /api/{sid}/files/{id}
GET /api/oauth
GET /api/{sid}/conversations
GET /api/{sid}/conversations/latest
GET /api/{sid}/conversations/{id}/messages
GET /api/{sid}/custom-menus
GET /api/{sid}/events/appointments
GET /api/{sid}/events/calendars
GET /api/{sid}/files
GET /api/{sid}/metrics/opportunities
GET /api/{sid}/opportunities
GET /api/{sid}/posts
GET /api/{sid}/posts/{id}
POST /api/opportunities/webhook
POST /api/{sid}/posts/bulk-delete
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd18553ecf7f0bf9d390efdba3ef7d9b3513259cc84ce5134d7
Public Swagger UI/API detected at path: /swagger-ui.html - sample paths:
DELETE /vendor/addresses/{address_id}
GET /consignments
GET /consignments/{consignment_id}
GET /items
GET /items/{item_id}
GET /vendor
GET /vendor/addresses
POST /cancellations
POST /consignments/{consignment_id}/items
POST /token
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1b885ff4310c9394e7f0b9b6bfed55db2af759b2f7d8e10e8
Public Swagger UI/API detected at path: /swagger.json - sample paths: GET /convert/graph GET /convert/plain GET /convert/preview GET /convert/python GET /convert/raw
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbb3d9d3b4
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/MertGedik35/finatlassigorta-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6ce3b765f39bbcf6d5ddee373da4a22cf0acf5bcf
GraphQL introspection enabled at /api/graphql Types: 680 (by kind: ENUM: 46, INPUT_OBJECT: 142, INTERFACE: 18, OBJECT: 436, SCALAR: 11, UNION: 27) Operations: - Query: Query | fields: channel, customer, inventory, node, site - Mutation: Mutation | fields: cart, checkout, login, logout, wishlist Directives: cacheControl, deprecated, include, oneOf, shopperPreferences, skip (total: 6) Detected: Magento Readable stores: 2 channel (args: none) : entityId=1 store (args: none) : entityId=417723
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6d9ef58a0185e75a4f2af7414521dd9acf8505496
GraphQL introspection enabled at /api/graphql Types: 665 (by kind: ENUM: 46, INPUT_OBJECT: 140, INTERFACE: 18, OBJECT: 425, SCALAR: 11, UNION: 25) Operations: - Query: Query | fields: channel, customer, inventory, node, site - Mutation: Mutation | fields: cart, checkout, login, logout, wishlist Directives: cacheControl, deprecated, include, oneOf, shopperPreferences, skip (total: 6) Detected: Magento Readable stores: 2 channel (args: none) : entityId=1 store (args: none) : entityId=417723
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6e9f0b6e8126c344c0b64492ce96b1e44d99393ce
GraphQL introspection enabled at /api/graphql Types: 664 (by kind: ENUM: 46, INPUT_OBJECT: 140, INTERFACE: 18, OBJECT: 424, SCALAR: 11, UNION: 25) Operations: - Query: Query | fields: channel, customer, inventory, node, site - Mutation: Mutation | fields: cart, checkout, login, logout, wishlist Directives: cacheControl, deprecated, include, oneOf, shopperPreferences, skip (total: 6) Detected: Magento Readable stores: 2 channel (args: none) : entityId=1 store (args: none) : entityId=417723
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d677e566943ff25a5803355e5825558bd0563eadff
GraphQL introspection enabled at /api/graphql Types: 648 (by kind: ENUM: 46, INPUT_OBJECT: 135, INTERFACE: 18, OBJECT: 415, SCALAR: 11, UNION: 23) Operations: - Query: Query | fields: channel, customer, inventory, node, site - Mutation: Mutation | fields: cart, checkout, login, logout, wishlist Directives: cacheControl, deprecated, include, oneOf, shopperPreferences, skip (total: 6) Readable stores: 2 channel (args: none) : entityId=1 store (args: none) : entityId=417723
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d628aa618223682612ee2143baf5e61a8e0b1b8eb5
GraphQL introspection enabled at /api/graphql Types: 645 (by kind: ENUM: 46, INPUT_OBJECT: 135, INTERFACE: 18, OBJECT: 412, SCALAR: 11, UNION: 23) Operations: - Query: Query | fields: channel, customer, inventory, node, site - Mutation: Mutation | fields: cart, checkout, login, logout, wishlist Directives: cacheControl, deprecated, include, oneOf, shopperPreferences, skip (total: 6) Readable stores: 2 channel (args: none) : entityId=1 store (args: none) : entityId=417723
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6cbd5933ccbcabc002c0def30b913016836ef72c7
GraphQL introspection enabled at /api/graphql Types: 637 (by kind: ENUM: 45, INPUT_OBJECT: 134, INTERFACE: 18, OBJECT: 407, SCALAR: 11, UNION: 22) Operations: - Query: Query | fields: channel, customer, inventory, node, site - Mutation: Mutation | fields: cart, checkout, login, logout, wishlist Directives: cacheControl, deprecated, include, oneOf, shopperPreferences, skip (total: 6) Readable stores: 2 channel (args: none) : entityId=1 store (args: none) : entityId=417723
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbef2bad2b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/Chaitanya-Varma-Sykam/MS_Contractors-Builders.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e352d140
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/Leadflow-AI/mold-slayers-web.git fetch = +refs/heads/*:refs/remotes/origin/* [pull] rebase = false
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbb0e81001
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/Wanjiru-se/gtm-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb204385af
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Farjaadrizvi110/Ray-Design.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin vscode-merge-base = origin/main vscode-merge-base = origin/main merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb07547b30de73
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : limit=10 nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false Machines (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Components (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Menus (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 CatalogueCategories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 TopLevelCategories (args: optional/default) : pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 Categories (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Posts (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Docs (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Tags (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754a5232107
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 Machines (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Components (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Menus (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 CatalogueCategories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 TopLevelCategories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 Categories (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Posts (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Docs (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Tags (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754207108ff
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 Machines (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Components (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Menus (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 CatalogueCategories (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 TopLevelCategories (args: optional/default) : nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 Categories (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Posts (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Docs (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Tags (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754b2400b47
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 Machines (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Components (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Menus (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 CatalogueCategories (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 TopLevelCategories (args: optional/default) : nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 Categories (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Posts (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false Docs (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Tags (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754e0309363
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 Machines (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Components (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Menus (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 CatalogueCategories (args: optional/default) : limit=10 nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false TopLevelCategories (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 Categories (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false Posts (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Docs (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Tags (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754019e8f7b
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : limit=10 nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false Machines (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Components (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Menus (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 CatalogueCategories (args: optional/default) : pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 TopLevelCategories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 Categories (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Posts (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Docs (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Tags (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754e79b838b
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 Machines (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Components (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Menus (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 CatalogueCategories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 TopLevelCategories (args: optional/default) : pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 Categories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Posts (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Docs (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Tags (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754e972eb5b
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 Machines (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Components (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false Menus (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 CatalogueCategories (args: optional/default) : limit=10 nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false TopLevelCategories (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 Categories (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Posts (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Docs (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Tags (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb075478f50947
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 Machines (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Components (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Menus (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 CatalogueCategories (args: optional/default) : pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 TopLevelCategories (args: optional/default) : hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 hasNextPage=true Categories (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false Posts (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Docs (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Tags (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754f180fc9b
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 Machines (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false Components (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Menus (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 CatalogueCategories (args: optional/default) : nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 TopLevelCategories (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 Categories (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false Posts (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Docs (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Tags (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb075480910003
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 Machines (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Components (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Menus (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 CatalogueCategories (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 TopLevelCategories (args: optional/default) : hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 Categories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Posts (args: optional/default) : hasPrevPage=false limit=10 page=1 pagingCounter=1 hasNextPage=false Docs (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 Tags (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb0754e2ab637b
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 Machines (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Components (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Menus (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 CatalogueCategories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 TopLevelCategories (args: optional/default) : limit=10 nextPage=2 page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false Categories (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Posts (args: optional/default) : limit=10 page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false Docs (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Tags (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10
Severity: high
Fingerprint: c2db3a1c40d490db2337d3d6989fc4de0539844e4f63329a24cb07541c6b7c17
GraphQL introspection enabled at /api/graphql Types: 3931 (by kind: ENUM: 81, INPUT_OBJECT: 542, OBJECT: 3289, SCALAR: 8, UNION: 11) Operations: - Query: Query | fields: CatalogueEntries, CatalogueEntry, Machine, Machines, docAccessCatalogueEntry - Mutation: Mutation | fields: createCatalogueEntry, createMachine, deleteCatalogueEntry, updateCatalogueEntry, updateMachine Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 10 CatalogueEntries (args: optional/default) : pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 page=1 Machines (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Components (args: optional/default) : hasNextPage=false hasPrevPage=false limit=10 page=1 pagingCounter=1 Menus (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1 CatalogueCategories (args: optional/default) : hasPrevPage=false limit=10 nextPage=2 page=1 pagingCounter=1 hasNextPage=true TopLevelCategories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=true hasPrevPage=false limit=10 nextPage=2 Categories (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Posts (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Docs (args: optional/default) : page=1 pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 Tags (args: optional/default) : pagingCounter=1 hasNextPage=false hasPrevPage=false limit=10 page=1
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba0308a2c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/t-larruda/site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b61c1a67
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:danicode12/mm-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe1147f7d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/MMMurugan/jaunt.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [branch "development"] remote = origin merge = refs/heads/development vscode-merge-base = origin/development [user] email = mmm.muruganmca@gmail.com
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbfed1f90b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/HugoCDM/cosipometro-2.0.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbda53063f
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/HugoCDM/cosipometro.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb6a52e6aa
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/HugoCDM/cosipometro.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb22808d49
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/kalu667/nepal-history-timeline.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb734106a9
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://gitee.com/umore/umoretech-www.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb00dc7e6e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/jecobz/2127-little-fashion.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb9033aa9e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [user] email = highlight-pro@example.com name = Highlight Pro Team [remote "origin"] url = https://github.com/smilesolutionzz/highlight-pro.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1f9d3008
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/BenkyCH/AGIT.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652223310e10
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:rczms/mta-sts-datahelix.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa389aa2afc1fe827400c7d7b20b8150aabd5aab138
GraphQL introspection enabled at /graphql Types: 72 (by kind: ENUM: 8, INPUT_OBJECT: 17, OBJECT: 43, SCALAR: 4) Operations: - Query: Query | fields: Answer, Tag, User, ratingsCount, userCount - Mutation: Mutation | fields: AddTagQuestions, CreateTag, MergeTagQuestions, RemoveTagQuestions, upvote Directives: MutationMeta, additionalLabels, cypher, deprecated, include, neo4j_ignore, relation, skip (total: 8)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d67c42e5051478b6c78673ce64a40222378e03a4f1
GraphQL introspection enabled at /api/graphql Types: 231 (by kind: ENUM: 18, INPUT_OBJECT: 67, INTERFACE: 3, OBJECT: 136, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d621b35c04cb1a7648e53297137c50bc8cbe6651fc
GraphQL introspection enabled at /api/graphql Types: 228 (by kind: ENUM: 19, INPUT_OBJECT: 65, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6b051d5706ad22d74683d93e70e782bb076775b10
GraphQL introspection enabled at /api/graphql Types: 227 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6da3e8120aa5f0324aa57fdb7ac067fc0cc54fbe0
GraphQL introspection enabled at /api/graphql Types: 225 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 132, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d69569fc5d58370f3f2019b0215b4180963a1dc540
GraphQL introspection enabled at /api/graphql Types: 30 (by kind: ENUM: 3, INPUT_OBJECT: 9, OBJECT: 13, SCALAR: 5) Operations: - Query: Query | fields: Health, Me, Profile, User, Users - Mutation: Mutation | fields: DeleteUser, Login, Register, TwoFa, UpdateUser Directives: deprecated, include, skip, specifiedBy (total: 4)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf37558c4
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/franqupoficial/tdvagbneqiyzssaipmax fetch = +refs/heads/*:refs/remotes/origin/*
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d67390ccab7d3b4be97b9a50419fd171a7d0a9e07f
GraphQL introspection enabled at /api/graphql Types: 1295 (by kind: ENUM: 37, INPUT_OBJECT: 151, OBJECT: 1091, SCALAR: 8, UNION: 8) Operations: - Query: Query | fields: Zuberlin_page, Zuberlin_pages, countZuberlin_pages, docAccessZuberlin_page, versionZuberlin_page - Mutation: Mutation | fields: createZuberlin_page, deleteZuberlin_page, duplicateZuberlin_page, restoreVersionZuberlin_page, updateZuberlin_page Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa3b0e90583be4c4281bc371a9a4e20452021681572
GraphQL introspection enabled at /graphql Types: 39 (by kind: ENUM: 2, INPUT_OBJECT: 11, OBJECT: 19, SCALAR: 7) Operations: - Query: Query | fields: domains, events, liveUnique, maxDomains, maxPageViews - Mutation: Mutation | fields: cancelSubscription, createPasswordReset, createUser, resetPassword, subscribe Directives: deprecated, include, skip, specifiedBy (total: 4)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa312ee0a2e37a50ede28dfd07c93bcf2626e42c944
GraphQL introspection enabled at /graphql Types: 15 (by kind: ENUM: 2, OBJECT: 10, SCALAR: 3) Operations: - Query: Query | fields: giveMeAnError, links, sponsors, welcome - Mutation: Mutation | fields: hello Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 0
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6c8a82dd48bd0161879eaf58bc36adbda88d2f6a6
GraphQL introspection enabled at /api/graphql Types: 165 (by kind: ENUM: 28, INPUT_OBJECT: 38, OBJECT: 91, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, downloadEmployeeTemplate, employeePayoutData, employees - Mutation: Mutation | fields: archiveFinancialScorecard, cancelEmployeeUpload, confirmEmployeeUpload, createEducationContent, createEducationCourse Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d647892191df2fbc531f5736a6405c03b754080d0f
GraphQL introspection enabled at /api/graphql Types: 161 (by kind: ENUM: 27, INPUT_OBJECT: 38, OBJECT: 88, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, downloadEmployeeTemplate, employeePayoutData, employees - Mutation: Mutation | fields: archiveFinancialScorecard, cancelEmployeeUpload, confirmEmployeeUpload, createEducationContent, createEducationCourse Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6f863cb312264cd33faf39306499394973e68fa2f
GraphQL introspection enabled at /api/graphql Types: 160 (by kind: ENUM: 27, INPUT_OBJECT: 38, OBJECT: 87, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, downloadEmployeeTemplate, employeePayoutData, employees - Mutation: Mutation | fields: archiveFinancialScorecard, cancelEmployeeUpload, confirmEmployeeUpload, createEducationContent, createEducationCourse Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6732f0b30798a6ab4a5dc7c7f382e52e62411a942
GraphQL introspection enabled at /api/graphql Types: 157 (by kind: ENUM: 27, INPUT_OBJECT: 38, OBJECT: 84, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, downloadEmployeeTemplate, employeePayoutData, employees - Mutation: Mutation | fields: archiveFinancialScorecard, cancelEmployeeUpload, confirmEmployeeUpload, createEducationContent, createEducationCourse Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6978f73c4644fbe88ac86d85b6806730ae7c7c856
GraphQL introspection enabled at /api/graphql Types: 156 (by kind: ENUM: 27, INPUT_OBJECT: 38, OBJECT: 83, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, downloadEmployeeTemplate, employeePayoutData, employees - Mutation: Mutation | fields: archiveFinancialScorecard, cancelEmployeeUpload, confirmEmployeeUpload, createEducationContent, createEducationCourse Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6c6d60924619faea8cc5d86158c50ad6072b80390
GraphQL introspection enabled at /api/graphql Types: 144 (by kind: ENUM: 27, INPUT_OBJECT: 38, OBJECT: 71, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, employeePayoutData, employees, enrollmentBreakdownByCountryConnection - Mutation: Mutation | fields: archiveFinancialScorecard, createEducationContent, createEducationCourse, createHrisUpload, createMediaUpload Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6b132a9f8b4e4d91cd03897c1a491cb843e7692a4
GraphQL introspection enabled at /api/graphql Types: 143 (by kind: ENUM: 27, INPUT_OBJECT: 38, OBJECT: 70, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, employeePayoutData, employees, enrollmentBreakdownByCountryConnection - Mutation: Mutation | fields: archiveFinancialScorecard, createEducationContent, createEducationCourse, createHrisUpload, createMediaUpload Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6b132a9f8b4e4d91c9f01b931422950f4c858ba14
GraphQL introspection enabled at /api/graphql Types: 143 (by kind: ENUM: 27, INPUT_OBJECT: 38, OBJECT: 70, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, employeePayoutData, employees, enrollmentBreakdownByCountry - Mutation: Mutation | fields: archiveFinancialScorecard, createEducationContent, createEducationCourse, createHrisUpload, createMediaUpload Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d68d7e837edb49afae83c9765bab797bbae21a6846
GraphQL introspection enabled at /api/graphql Types: 138 (by kind: ENUM: 26, INPUT_OBJECT: 36, OBJECT: 68, SCALAR: 8) Operations: - Query: Query | fields: calculateSimulatedPayout, coaches, employeePayoutData, employees, enrollmentBreakdownByCountry - Mutation: Mutation | fields: archiveFinancialScorecard, createEducationContent, createEducationCourse, createHrisUpload, createMediaUpload Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb5df2f0f1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/IsaacOsah124/Nadel.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb15d3468f
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/technext/mark.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6c3f3e2229a6c09723c247c0dce0cb14daf795999
GraphQL introspection enabled at /api/graphql Types: 39 (by kind: ENUM: 5, INPUT_OBJECT: 11, OBJECT: 17, SCALAR: 6) Operations: - Query: Query | fields: babies, me, user, userCount, users - Mutation: Mutation | fields: changePassword, createBaby, createUser, deleteUser, updateUser Directives: deprecated, include, skip, specifiedBy (total: 4)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1372d2b2
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/albertzeqiri/step-studio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6d5e6ea65d5e6ea65d5e6ea65d5e6ea65d5e6ea65
GraphQL introspection enabled at /api/graphql Detected: Magento
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d63a4de5f9a0e00b9b64c86893d47a64a3870a0eb3
GraphQL introspection enabled at /api/graphql Types: 1194 (by kind: ENUM: 86, INPUT_OBJECT: 237, INTERFACE: 177, OBJECT: 688, SCALAR: 5, UNION: 1) Operations: - Query: RootQuery | fields: allPaColor, allPaSizeTest, allSettings, cart, cartFee - Mutation: RootMutation | fields: addCartItems, addFee, addToCart, applyCoupon, checkout Directives: deprecated, include, skip (total: 3)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312255be2cfcd
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : label=Organizations singular=Organization plural=Organizations path=organizations key=Organization name=Organization _CampaignsMeta (args: none) : plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign _ReferralTokensMeta (args: none) : singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312257561c969
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : path=users key=User name=User label=Users singular=User plural=Users _DonationsMeta (args: none) : name=Donation label=Donations singular=Donation plural=Donations path=donations key=Donation _CheckoutsMeta (args: none) : singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225d68ed3b1
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : path=users key=User name=User label=Users singular=User plural=Users _DonationsMeta (args: none) : plural=Donations path=donations key=Donation name=Donation label=Donations singular=Donation _CheckoutsMeta (args: none) : path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312252f33fa37
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312255cfce2ef
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : singular=User plural=Users path=users key=User name=User label=Users _DonationsMeta (args: none) : name=Donation label=Donations singular=Donation plural=Donations path=donations key=Donation _CheckoutsMeta (args: none) : path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns _ReferralTokensMeta (args: none) : singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens _ReferralEventsMeta (args: none) : key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312254ed29437
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : label=Organizations singular=Organization plural=Organizations path=organizations key=Organization name=Organization _CampaignsMeta (args: none) : plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e63122590f6200b
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : singular=User plural=Users path=users key=User name=User label=Users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts _OrganizationsMeta (args: none) : label=Organizations singular=Organization plural=Organizations path=organizations key=Organization name=Organization _CampaignsMeta (args: none) : path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns _ReferralTokensMeta (args: none) : singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens _ReferralEventsMeta (args: none) : plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225429a04f1
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e63122540dee1bf
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout _OrganizationsMeta (args: none) : path=organizations key=Organization name=Organization label=Organizations singular=Organization plural=Organizations _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312251819032f
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : singular=User plural=Users path=users key=User name=User label=Users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225a33a120d
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : singular=Donation plural=Donations path=donations key=Donation name=Donation label=Donations _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : path=organizations key=Organization name=Organization label=Organizations singular=Organization plural=Organizations _CampaignsMeta (args: none) : name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312254de203bd
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : singular=User plural=Users path=users key=User name=User label=Users _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225a8a2b11b
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e63122520eb0b61
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : label=Organizations singular=Organization plural=Organizations path=organizations key=Organization name=Organization _CampaignsMeta (args: none) : singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns _ReferralTokensMeta (args: none) : path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens _ReferralEventsMeta (args: none) : plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225697569dd
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e63122506e90f37
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : plural=Donations path=donations key=Donation name=Donation label=Donations singular=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312250a3940f1
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312250b477669
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : plural=Users path=users key=User name=User label=Users singular=User _DonationsMeta (args: none) : path=donations key=Donation name=Donation label=Donations singular=Donation plural=Donations _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312253d190743
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225cd3a1aed
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4a1aeb84
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/HsynAslan/Interpoint.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [lfs] repositoryformatversion = 0 [branch "interpoint_branch"] remote = origin merge = refs/heads/interpoint_branch vscode-merge-base = origin/interpoint_branch
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0b127ae7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [gui] wmstate = normal geometry = 1109x563+224+224 216 255 [remote "origin"] url = https://github.com/sajo-a/scm4all-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1a76293a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/V2patel007/Virajptl.com--Originial-.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d5dea97b
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/theflopfather/theflopfather.github.io.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb725e2c5c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/theodor961/questa-new.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb445a411c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/theodor961/questa-new.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522621d7ddf
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:BiggAlert/single-page-hair-braider.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65229dbcc7b7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [user] name = Antoine email = antoine@example.com [remote "origin"] url = https://github.com/antonasantoine-maker/chasseur-immobilier-site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224253a1e8
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/SarvaBharan/thechaigudi.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbac5a7f7a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/Jointic/inversiones.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0 [branch "navbar"] vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd4278d97
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/Sawood-Ahmed17/MASRIQ_Portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba0108a11
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/tommasodesantis/sco4_landing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbcecb8655
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Quadraticx9/BB_M.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb91f0389d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/albertzeqiri/menudigjitale.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbdb413b12
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/albertzeqiri/menu-digjitale.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbebc1fad2
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/Notimpresd/my-webpage.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65220c5d6c4a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/Krishang-dhar/hotel-vihsal-final-new.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb742a63bc
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/sbmp69/conneural-website-files-final-.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb72e2fde8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Mridul24agaga/cleaning.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d693a0fa24ea0fa9a87a5fedddfec54351eb8e99a5
GraphQL introspection enabled at /api/graphql Types: 2174 (by kind: ENUM: 52, INPUT_OBJECT: 394, OBJECT: 1715, SCALAR: 8, UNION: 5) Operations: - Query: Query | fields: Page, Pages, Post, Posts, docAccessPage - Mutation: Mutation | fields: createPage, createPost, deletePage, updatePage, updatePost Directives: deprecated, include, skip, specifiedBy (total: 4)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd22ee782
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/swayammedia/WeDigi-LandingPage.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd809d3f3
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/WeDigiStudio/WeDigiStudio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d38603ec238603ec238603ec238603ec2
Found 1 files trough .DS_Store spidering: /lovable-uploads
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7c29c69d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/webmasters-Team/Test.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] gk-last-accessed = 2025-12-28T13:23:58.899Z gk-last-modified = 2025-12-28T13:23:58.899Z
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb25b9607b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/webmasters-Team/Test.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd0dea5a1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://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@github.com/Zora123456/pwa_aceite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb2d000f95
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/kavish055/Portfolio-Ashar-Kavish.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224a0d226b
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/CalebLaurent509/portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbeb4d45d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/AscentIqTechno/AscentiqTechnoPvtLtd.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652251bdbfba
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/JeromeTana/ultherapy-prime.git fetch = +refs/heads/*:refs/remotes/origin/*
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e22cd2db
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/JeromeTana/ultherapy-prime.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "free-parking/add-image"] remote = origin merge = refs/heads/free-parking/add-image
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522197862fb
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/WEBCRAFTSMAN-CO/ultherapy-prime.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb03be8678
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/B3njiiii9/paksons-enterprises.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522f226e74d
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/imraniqbal786/kcal-ai-website.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbdc6002ef
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Paribeshlamsal/Portfolio-site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb99061d36
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ak0f/html.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652239b73d5a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/ajaykundnani/avitravels.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb043061cf
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/carmeldev/fram3it.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb73b65d6b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/codewithsadee/pixology.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb9e628b0b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/albertzeqiri/inteec-csg.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3ac19b03
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/mazentalsam/Personal-Portfolio-Website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4d79103e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "main"] url = https://github.com/MuhannadAlhero/spr.git fetch = +refs/heads/*:refs/remotes/main/* [branch "new"] vscode-merge-base = main/main remote = main merge = refs/heads/new github-pr-base-branch = "MuhannadAlhero#spr#main" github-pr-base-branch = "MuhannadAlhero#spr#main" [branch "main"] vscode-merge-base = main/main remote = origin merge = refs/heads/main github-pr-base-branch = "MuhannadAlhero#spr#new" github-pr-base-branch = "MuhannadAlhero#spr#new" github-pr-base-branch = "MuhannadAlhero#spr#new" [remote "origin"] url = https://github.com/MuhannadAlhero/spr.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652231e7c967
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/GeorgeVourkas/George-Vourkas-Portfolio-.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf9df1ddb
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/GeorgeVourkas/George-Vourkas-Portfolio-.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0985f277
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/JLCode619/TheWalkerCollective.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247259b6c86336bd33a8f80b49bd166b48e78
Found 9 files trough .DS_Store spidering: /assets /assets/font /assets/home /assets/katex@0.16.25 /cardcrafting /cardcrafting/data /cardcrafting/img /cardcrafting/img_2x /cardcrafting/lib
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392abdc1b177d3ba82689d0d591241968252c
Found 7 files trough .DS_Store spidering: /assets /assets/font /cardcrafting /cardcrafting/data /cardcrafting/img /cardcrafting/img_2x /cardcrafting/lib
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d2dd6bea
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/borisGro/falcon-heart.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4ebfe310
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/Maicc30/Futplus.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7d0aada4
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:Oak-Harbor-Kits/Starter-KitV3.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb9ba40449
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Amongas232323/GES.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652225a2252b
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:nmitydv/Academic_Website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb830d6a6a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/Keladose/H-Project.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa354a4d27a29cb2f2abc0fc735cb5e18baaa0f10ce
GraphQL introspection enabled at /graphql Types: 298 (by kind: ENUM: 37, INPUT_OBJECT: 103, OBJECT: 147, SCALAR: 10, UNION: 1) Operations: - Query: Query | fields: categories, categoryItem, categoryItems, libraryCategories, validateAllItemPricingFormulas - Mutation: Mutation | fields: copyCategoryItem, createCategoryItem, deleteCategoryItem, duplicateCategoryItem, moveCategoryItem - Subscription: Subscription | fields: cpuGraph, cpuUsage, logLine, memUsage, notification Directives: auth, deprecated, dev, include, oneOf, signeeAuth, skip, specifiedBy, superAdminOrDev (total: 9)
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa32a97a61ad087978a7c727cd5db1843dafdba0fae
GraphQL introspection enabled at /graphql Types: 297 (by kind: ENUM: 37, INPUT_OBJECT: 103, OBJECT: 146, SCALAR: 10, UNION: 1) Operations: - Query: Query | fields: categories, categoryItem, categoryItems, libraryCategories, validateAllItemPricingFormulas - Mutation: Mutation | fields: copyCategoryItem, createCategoryItem, deleteCategoryItem, duplicateCategoryItem, moveCategoryItem - Subscription: Subscription | fields: cpuGraph, cpuUsage, logLine, memUsage, notification Directives: auth, deprecated, dev, include, oneOf, signeeAuth, skip, specifiedBy, superAdminOrDev (total: 9)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652229a662d7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:zeluizr/zipcode_chile_VTEX_Excel_Generator.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "dev"] github-pr-base-branch = "zeluizr#zipcode_chile_VTEX_Excel_Generator#main" vscode-merge-base = origin/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf17642f59365a30ac01a7a0ac01a7a0ac01a7a
Found 2 files trough .DS_Store spidering: /images /site_libs
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4997511d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/VeeraNagendraBabu/DraftSite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe5c352ff
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/b4ktas/placobek.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbb7605e4
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "upstream"] url = https://github.com/soulkiller31/Astrokrishna.git fetch = +refs/heads/*:refs/remotes/upstream/* [remote "origin"] url = https://github.com/soulkiller31/Astrokrishna.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522df30afd8
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/Code-Panchhee/landing-page.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [branch "fix/bg"] vscode-merge-base = origin/master [branch "staging"] vscode-merge-base = origin/master remote = origin merge = refs/heads/staging
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb989414bc
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/BeaglesWorth421/The-Connection.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "v20250715"] remote = origin merge = refs/heads/v20250715 vscode-merge-base = origin/v20250715 [branch "v20250805"] remote = origin merge = refs/heads/v20250805 vscode-merge-base = origin/v20250805 [branch "v20250808"] vscode-merge-base = origin/v20250805 remote = origin merge = refs/heads/v20250808 [branch "v20250808-stripe"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250808-stripe [branch "v20250808-form-repair"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250808-form-repair [branch "v20250812"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250812 [branch "v20250815"] vscode-merge-base = origin/v20250812 remote = origin merge = refs/heads/v20250815 [branch "v20250822"] vscode-merge-base = origin/v20250815 remote = origin merge = refs/heads/v20250822
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbdf4fe0ac
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/BeaglesWorth421/The-Connection.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "v20250715"] remote = origin merge = refs/heads/v20250715 vscode-merge-base = origin/v20250715 [branch "v20250805"] remote = origin merge = refs/heads/v20250805 vscode-merge-base = origin/v20250805 [branch "v20250808"] vscode-merge-base = origin/v20250805 remote = origin merge = refs/heads/v20250808 [branch "v20250808-stripe"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250808-stripe [branch "v20250808-form-repair"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250808-form-repair [branch "v20250812"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250812 [branch "v20250815"] vscode-merge-base = origin/v20250812
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb653830ab
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/BeaglesWorth421/The-Connection.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "v20250715"] remote = origin merge = refs/heads/v20250715 vscode-merge-base = origin/v20250715 [branch "v20250805"] remote = origin merge = refs/heads/v20250805 vscode-merge-base = origin/v20250805 [branch "v20250808"] vscode-merge-base = origin/v20250805 remote = origin merge = refs/heads/v20250808 [branch "v20250808-stripe"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250808-stripe [branch "v20250808-form-repair"] vscode-merge-base = origin/v20250808 remote = origin merge = refs/heads/v20250808-form-repair
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb22a0b539
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/BeaglesWorth421/The-Connection.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "v20250715"] remote = origin merge = refs/heads/v20250715 vscode-merge-base = origin/v20250715
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227fb8bc60
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/pizzalover125/pizzalover125tech.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb96f2734b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/TrueLearn-Academy/truezen-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0d4d32cb
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/naseeb0007/safa-public-school-portfolio-main.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522cf83e424
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/robertbkoch/Cinca.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "holding-page"] vscode-merge-base = origin/main remote = origin merge = refs/heads/holding-page
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb97c45362
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:pedrowork/portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb70ded880
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Marzooklathief/new_formula.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c0e34cc3
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/afc1804/test1 fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb5cf2377c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/VicMalac/claritio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb395f1d36
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Firuza-pl/MyResume.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb09d7fbf8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Raviipandey/ThinkDesign.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb44ec45f0
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/MarianoTimistit23/csg-seguros.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522474aa93e
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/walterdiaz78/cuadrosdeluz.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbdb451bcd
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/KALIFX/PDFTOOLSTRIO.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1fc548fc
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/telesoko/telesokostore.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62f9ffa0d7934fd2f00bb52477606dfac8b7c17e2
GraphQL introspection enabled at /api/graphql Types: 105 (by kind: ENUM: 7, INPUT_OBJECT: 40, OBJECT: 50, SCALAR: 8) Operations: - Query: Query | fields: countBlog, countBlogCategory, getBlog, listBlog, listBlogCategory - Mutation: Mutation | fields: createBlog, createBlogCategory, deleteBlog, publishBlog, updateBlog Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb818e678e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/PRITHVIBO/DiscussionForum fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbb1fb787b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/PRITHVIBO/DiscussionForum fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522f2afb161
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/veppy1/pepeponke.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe84e8ae7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Jalita19/phoenixofresilience_website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652282838ff1
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/AmmanDynamics/movenpick-menu-web.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "develop"] remote = origin merge = refs/heads/develop vscode-merge-base = origin/develop [branch "master"] remote = origin merge = refs/heads/master [gitflow "branch"] master = master develop = develop [gitflow "prefix"] feature = feature/ release = release/ hotfix = hotfix/ support = support/ versiontag = [branch "feature/new-menue-index"] remote = origin merge = refs/heads/feature/new-menue-index
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652220cff140
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/AmmanDynamics/movenpick-menu-web.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "develop"] remote = origin merge = refs/heads/develop [branch "master"] remote = origin merge = refs/heads/master [gitflow "branch"] master = master develop = develop [gitflow "prefix"] feature = feature/ release = release/ hotfix = hotfix/ support = support/ versiontag = [branch "feature/new-menue-index"] remote = origin merge = refs/heads/feature/new-menue-index
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb51d6d73e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/ntharaka430-bot/CalculateHome.com-Local.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652266b3ee95
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/Users/olgaleletalla/Documents/cleaning_web_site fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb17029de1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/rhanna3991/augmentcrafter fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbc64c7536
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/rhanna3991/augmentcrafter.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8abe1f8a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/rhanna3991/augmentcrafter.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb582ad3a2
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://<YOUR_TOKEN>@github.com/charslanasif0/Bionexa_portal.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d68eb81256936d4786629b85c08c01bf782d637200
GraphQL introspection enabled at /api/graphql Types: 120 (by kind: ENUM: 2, INPUT_OBJECT: 10, OBJECT: 103, SCALAR: 5) Operations: - Query: Query | fields: fota, me, user, users, usersRe - Mutation: Mutation | fields: ackAlarm, addAPIKey, addComment, addCompany, addCustomKeyCode Directives: deprecated, include, skip (total: 3)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6def279538ea4c91186ab211d0ba0f435dc6c0055
GraphQL introspection enabled at /api/graphql Types: 119 (by kind: ENUM: 2, INPUT_OBJECT: 10, OBJECT: 102, SCALAR: 5) Operations: - Query: Query | fields: fota, me, user, users, usersRe - Mutation: Mutation | fields: ackAlarm, addAPIKey, addComment, addCompany, addCustomKeyCode Directives: deprecated, include, skip (total: 3)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65221f0817c6
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:alexrosen45/spatial_constraints_site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbc6322c7a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/talhazafarsb/studentBridge.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb5a3bf664
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Developer-Blessy/amazonwoods-door.git fetch = +refs/heads/*:refs/remotes/origin/* [user] email = deveblessyfreelance7@gmail.com name = Developer-Blessy
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d4f31f12
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/nayan-em/Denmith.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d4632442
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:Lyan-OS/Dreamcoffee.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d67c42e5051478b6c78673ce64a40222378e03a4f1
GraphQL introspection enabled at /api/graphql Types: 231 (by kind: ENUM: 18, INPUT_OBJECT: 67, INTERFACE: 3, OBJECT: 136, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d621b35c04cb1a7648e53297137c50bc8cbe6651fc
GraphQL introspection enabled at /api/graphql Types: 228 (by kind: ENUM: 19, INPUT_OBJECT: 65, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6b051d5706ad22d74683d93e70e782bb076775b10
GraphQL introspection enabled at /api/graphql Types: 227 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6da3e8120aa5f0324aa57fdb7ac067fc0cc54fbe0
GraphQL introspection enabled at /api/graphql Types: 225 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 132, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb9ceeb868
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/TBN22/softwashpros.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0 [branch "talal"] remote = origin merge = refs/heads/talal vscode-merge-base = origin/main [branch "testing"] remote = origin merge = refs/heads/testing vscode-merge-base = origin/testing
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb6fadeb45
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/TBN22/softwashpros.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0 [branch "talal"] remote = origin merge = refs/heads/talal vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbeb8ec68
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/TBN22/softwashpros.org.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "talal"] github-pr-base-branch = "TBN22#softwashpros.org#main" vscode-merge-base = origin/main remote = origin merge = refs/heads/talal [branch "testing"] github-pr-base-branch = "TBN22#softwashpros.org#talal" vscode-merge-base = origin/talal remote = origin merge = refs/heads/testing
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d545ab09
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/shift-solutions/best_in_show_marketing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224cd58649
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/shift-solutions/best_in_show_marketing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb5f15446b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/UGS141/Mvr-logistics-site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb94722c48
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Hugocorreaa/nft-landing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d68a73f3a066dcfea44221a584091f91a7a5da007f
GraphQL introspection enabled at /api/graphql Types: 1014 (by kind: ENUM: 18, INPUT_OBJECT: 124, OBJECT: 861, SCALAR: 8, UNION: 3) Operations: - Query: Query | fields: User, Users, countUsers, docAccessUser, meUser - Mutation: Mutation | fields: createUser, deleteUser, logoutUser, refreshTokenUser, updateUser Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb2278fabb
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Ddxx98/ark-analytical-solutions.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1226a2b2
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/mindrootlabs/mindroot-labs-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e94a3f6c
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/epiphyte78-web/junglegroves.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb2d000f95
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/kavish055/Portfolio-Ashar-Kavish.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb923963f8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/kavish055/Portfolio-Ashar-Kavish.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbcb000850
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/3elk/Website-IP-Logger.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb582879a0
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/haikieki/CNPREDLP.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master vscode-merge-base = origin/master
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225e5c35c3f
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : path=users key=User name=User label=Users singular=User plural=Users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout _OrganizationsMeta (args: none) : path=organizations key=Organization name=Organization label=Organizations singular=Organization plural=Organizations _CampaignsMeta (args: none) : name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312257508e741
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts _OrganizationsMeta (args: none) : singular=Organization plural=Organizations path=organizations key=Organization name=Organization label=Organizations _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312257581d7c3
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout _OrganizationsMeta (args: none) : singular=Organization plural=Organizations path=organizations key=Organization name=Organization label=Organizations _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225b3d9e9e9
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : path=users key=User name=User label=Users singular=User plural=Users _DonationsMeta (args: none) : name=Donation label=Donations singular=Donation plural=Donations path=donations key=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns _ReferralTokensMeta (args: none) : path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens _ReferralEventsMeta (args: none) : key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225617ac36b
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : singular=Donation plural=Donations path=donations key=Donation name=Donation label=Donations _CheckoutsMeta (args: none) : name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312258f8b06b3
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : path=organizations key=Organization name=Organization label=Organizations singular=Organization plural=Organizations _CampaignsMeta (args: none) : path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312254f606bab
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : path=users key=User name=User label=Users singular=User plural=Users _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e63122588075189
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : name=Donation label=Donations singular=Donation plural=Donations path=donations key=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312253c59612d
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns _ReferralTokensMeta (args: none) : label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken _ReferralEventsMeta (args: none) : path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225b9138987
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225ae881323
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : name=Donation label=Donations singular=Donation plural=Donations path=donations key=Donation _CheckoutsMeta (args: none) : singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312255d4b98ef
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : plural=Donations path=donations key=Donation name=Donation label=Donations singular=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns _ReferralTokensMeta (args: none) : singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf41f2928
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/Manuelzee/ispecs-solutions-website-template.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa31a0bbaa31a0bbaa31a0bbaa31a0bbaa31a0bbaa3
GraphQL introspection enabled at /graphql
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa339337e52b82fe6a2ed66a0ffc8c1836d823896b9
GraphQL introspection enabled at /graphql Types: 581 (by kind: ENUM: 98, INPUT_OBJECT: 111, INTERFACE: 2, OBJECT: 363, SCALAR: 7) Operations: - Query: Query | fields: getBouncedEmailsStats, getInvoiceHistory, getOnboardingCommStats, getUpcomingOnboardingStats, supplierEngagementBouncedEmails - Mutation: Mutation | fields: createDefaultCustomerMarketSchedule, createFarmerRequestPaymentsClearingAudit, enableContractEntityForProgressClaimProduct, enableProgressClaimsForCustomer, updateCustomerMarketSchedule Directives: deprecated, include, skip, specifiedBy (total: 4)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8936558a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ArthurGuti/Portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652230212ea0
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:dfsobreira/vistastone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652272356971
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/bhuvaneswarignanasekar/redhill-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf2ea484e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/MANSOUR-MHD/cytotec.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd3306292
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/shenleeosialai/aquaa.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb81dce3b7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/BenPancakes/WarpWakeWebsite fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0c3987e7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/Guilhermehenriquee/ana01.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b193c0d8
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/otti007/Entrepath-WEB.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b0564b7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/eymenelneccar/blban.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8a529004
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [http] postBuffer = 524288000 [remote "origin"] url = https://github.com/mohammadmubaslat/MohammadMubaslat.github.io.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652270ce180c
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:thechipsahoy986/trmz-site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227f222cdf
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@gitlab.com:kodeadev/kodea.it.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226f298a0b
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:mahendra180993/kcs-visaslots.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522eb180aec
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:EA-Projects/cliqfit.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6de38b5fec933eb2e06c74db6091e71953d9c41a1
GraphQL introspection enabled at /api/graphql Types: 972 (by kind: ENUM: 6, INPUT_OBJECT: 111, OBJECT: 843, SCALAR: 8, UNION: 4) Operations: - Query: Query | fields: User, Users, countUsers, docAccessUser, meUser - Mutation: Mutation | fields: createUser, deleteUser, logoutUser, refreshTokenUser, updateUser Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb64b9b91c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = git@github.com:thoaionline/clarityengine-landing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb716160d4
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/cenfoire/clean-bio-website fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8ab31ebc
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/IBReformada/IBR-Website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbec1b5850
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/renatoyx/ceara_auto_center.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b7ca70f6
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/keshxyz1/kasonawebsite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa347cfde0012d690c47cc0b617efdc74107ba4c45c
GraphQL introspection enabled at /graphql Types: 240 (by kind: ENUM: 34, INPUT_OBJECT: 68, OBJECT: 127, SCALAR: 10, UNION: 1) Operations: - Query: Query | fields: categories, categoryItem, categoryItems, libraryCategories, validateAllItemPricingFormulas - Mutation: Mutation | fields: copyCategoryItem, createCategoryItem, deleteCategoryItem, duplicateCategoryItem, moveCategoryItem - Subscription: Subscription | fields: cpuGraph, cpuUsage, logLine, memUsage, notification Directives: auth, deprecated, dev, include, oneOf, signeeAuth, skip, specifiedBy, superAdminOrDev (total: 9)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb132dd3e9
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:zhongjidalao/yang-portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa3a63a70a86f0f498c067e8739a14db18ce5e30760
GraphQL introspection enabled at /graphql Types: 10 (by kind: INPUT_OBJECT: 1, OBJECT: 5, SCALAR: 4) Operations: - Query: Queries | fields: inviteInfo - Mutation: Mutations | fields: acceptInvitation, authenticate, authenticateClient, magicLink, refreshAuth Directives: include, skip (total: 2)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb26b8880b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/gourav-6477/vastuvitta-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c1b1441f
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/custom-fail/tag-frontend.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "redesign"] remote = origin merge = refs/heads/redesign
Severity: medium
Fingerprint: 2580fa947178c88602b1737d3d578f6e7c97979b8a3842b39fbdcc10e29074ce
[core] bare = false repositoryformatversion = 0 filemode = false symlinks = false ignorecase = true logallrefupdates = true [remote "origin"] url = https://github.com/custom-fail/tag-frontend.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbc1ee413
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/hassan1105/iradlimousine.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbc6d012aa
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:ISHAQ-BM/orgaflux-linktree.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772ffe4efdd8a7e0281c17968c5672a84e7
Found 11 files trough .DS_Store spidering: /getreich.html /index.html /pubs.html /robots.txt /search.json /site_libs /static /static/docs /static/media /styles.css /updates.html
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbed58339e8bf015637ba2e583b6d69d529
Found 15 files trough .DS_Store spidering: /bootstrap.min.css /getreich.html /index.html /media /pubs.html /ReetamMajumder_CV.pdf /robots.txt /search.json /site_libs /sitemap.xml /static /static/docs /static/media /styles.css /updates.html
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652248543a57
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://git.fhict.nl/I499804/portfolio-sem-7.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbc556b6d2
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/shivamkaushik19/Tech-Innovations.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65229eb1f88d
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/fzee07/Adil-Sayeed-Portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522837514b2
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/koszyczek/orzesze.eu.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbea6cc313
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ptmarcelo/manuelandrade.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1da6bb19
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://balimysore.visualstudio.com/UroCare/_git/UroCare fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e93c9758a0f23582b0761a69b233930b50
Found 5 files trough .DS_Store spidering: /blog /blog/other /blog/pd /site_libs /syllabi
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc79ccffe79af6162dcc621ba72ed97426
Found 4 files trough .DS_Store spidering: /blog /blog/other /blog/pd /site_libs
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9defc5466cefc5466cefc5466cefc5466c
Found 1 files trough .DS_Store spidering: /blog
Severity: low
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35b9114acae5f4748e62fb045e34c073c7f
Found 14 files trough .DS_Store spidering: /blog /blog/ko /contents /contents/bib /contents/logo /contents/publications /contents/syllabi /cv /media /media/2017-02-14 외국인 장학생 273명, 전국 60개 대학서 학위 취득 12.20.31 AM /research /research/chapters /syllabi /syllabi/deleted-journal-syllabus
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af247256de703d4495680786ea992a41ac10b67
Found 9 files trough .DS_Store spidering: /blog /blog/ko /cv /media /media/2017-02-14 외국인 장학생 273명, 전국 60개 대학서 학위 취득 12.20.31 AM /research /research/chapters /syllabi /syllabi/deleted-journal-syllabus
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8235a46cbf33f7fe3b73fda05898c2acf
Found 8 files trough .DS_Store spidering: /blog /blog/ko /cv /media /research /research/chapters /syllabi /syllabi/deleted-journal-syllabus
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e1de306bddc5855f740a45e7adbb9e9e0
Found 6 files trough .DS_Store spidering: /blog /cv /media /media/2017-02-14 외국인 장학생 273명, 전국 60개 대학서 학위 취득 12.20.31 AM /research /syllabi
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744d2cf8e3bcbe04de0e478ee150eb09d864
Found 12 files trough .DS_Store spidering: /blog /blog/2023-04-28 Overseas Koreans /blog/2023-07-20 Galatasaray 2023-2024 Season Squad Guessing /blog/2023-08-14 Extracting data from a complicated pdf file /blog/2023-12-19 Countering Russian Influence /blog/2024-04-23 Korean Trade Data /blog/2024-04-23 Working with Korean Diplomatic Datasets /cv /media /research /research/chapters /syllabi
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a092a80e932f3bf11303ba94d5cbc2c2a8
Found 13 files trough .DS_Store spidering: /blog /blog/2023-04-28 Overseas Koreans /blog/2023-07-20 Galatasaray 2023-2024 Season Squad Guessing /blog/2023-08-14 Extracting data from a complicated pdf file /blog/2023-12-19 Countering Russian Influence /blog/2024-04-23 Korean Trade Data /blog/2024-04-23 Working with Korean Diplomatic Datasets /cv /media /research /research/chapters /syllabi /syllabi/deleted-journal-syllabus
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e93c9758a0f6249833db43b533ecee97e0
Found 5 files trough .DS_Store spidering: /blog /blog/2023-01-15 R codes, packages, examples - Reminder for myself 11.15.35 AM /blog/2023-04-28 Overseas Koreans /blog/2023-07-20 Galatasaray 2023-2024 Season Squad Guessing /blog/2023-08-14 Extracting data from a complicated pdf file
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772db4cb80f83c1447a6c06337117712c5d
Found 11 files trough .DS_Store spidering: /contents /contents/bib /contents/cv /contents/logo /contents/syllabi /cv /research /research/articles /research/articles/2015 JIAS Why Do We Need Non-state Actors in Public Diplomacy /research/editorials /research/working-papers
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd8de45fc
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/arhamhi/R_v6.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa354a4d27a29cb2f2abc0fc735cb5e18baaa0f10ce
GraphQL introspection enabled at /graphql Types: 298 (by kind: ENUM: 37, INPUT_OBJECT: 103, OBJECT: 147, SCALAR: 10, UNION: 1) Operations: - Query: Query | fields: categories, categoryItem, categoryItems, libraryCategories, validateAllItemPricingFormulas - Mutation: Mutation | fields: copyCategoryItem, createCategoryItem, deleteCategoryItem, duplicateCategoryItem, moveCategoryItem - Subscription: Subscription | fields: cpuGraph, cpuUsage, logLine, memUsage, notification Directives: auth, deprecated, dev, include, oneOf, signeeAuth, skip, specifiedBy, superAdminOrDev (total: 9)
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa32a97a61ad087978a7c727cd5db1843dafdba0fae
GraphQL introspection enabled at /graphql Types: 297 (by kind: ENUM: 37, INPUT_OBJECT: 103, OBJECT: 146, SCALAR: 10, UNION: 1) Operations: - Query: Query | fields: categories, categoryItem, categoryItems, libraryCategories, validateAllItemPricingFormulas - Mutation: Mutation | fields: copyCategoryItem, createCategoryItem, deleteCategoryItem, duplicateCategoryItem, moveCategoryItem - Subscription: Subscription | fields: cpuGraph, cpuUsage, logLine, memUsage, notification Directives: auth, deprecated, dev, include, oneOf, signeeAuth, skip, specifiedBy, superAdminOrDev (total: 9)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb2e18b5e6
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/SuryaVs5199/kktmatrimony.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b15162c5
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/SmeadIT2024/BegoniaSocietyNSW.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65223fc23ea2
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/mbotello12/velvet.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "working"] remote = origin merge = refs/heads/working vscode-merge-base = origin/working
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1c6140cd
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/majdya/html-css.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "ridosoft"] remote = origin merge = refs/heads/ridosoft
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb202f0228
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/RRimeKS/kaplanlar-holding.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226cb893fd
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/finisus/we-choose-wealth fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb63fd1add
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/henrywangzy/snackwordsgame.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd413fa58
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/dh00mk3tu/lokesh-vats-portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a6f5339a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/dh00mk3tu/lokesh-vats-portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb820e6c47
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/rahmatillokh/marketpos_intro.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb9cae746a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/TiagoPerri/SiteLexAdv.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb2f1d6f4d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/BreezBlox/breezblox.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0f9ec371
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ReljaStefanovicGitHub/23-tattoo-studio-2.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "tattoo-1"] github-pr-base-branch = "ReljaStefanovicGitHub#23-tattoo-studio-2#main" vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb95af4fda
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ReljaStefanovicGitHub/23tattoo.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "tattoo-1"] vscode-merge-base = main remote = origin merge = refs/heads/tattoo-1 [branch "tattoo-2"] vscode-merge-base = tattoo-1 remote = origin merge = refs/heads/tattoo-2 [branch "tattoo-3"] vscode-merge-base = tattoo-2 remote = origin merge = refs/heads/tattoo-3 [branch "tattoo-4"] vscode-merge-base = tattoo-3 remote = origin merge = refs/heads/tattoo-4 [branch "tattoo'5"] vscode-merge-base = tattoo-4 remote = origin merge = refs/heads/tattoo'5 [branch "tattoo-6"] vscode-merge-base = tattoo'5 remote = origin merge = refs/heads/tattoo-6
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb09b75198
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Farjaadrizvi110/Dreamhometest.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: medium
Fingerprint: 5f32cf5d6962f09cff76d438ff76d4383beb58427d453c937c454564112180d7
Found 93 files trough .DS_Store spidering: /Brochures /careers.html /contactdiag.html /contactscan.html /cookie /cookie/css /cookie/docs /cookie/js /cookiepolicy.html /css /fonts /images /images/AikenDemo.mp4 /images/Aikeninst-small-dark.png /images/Aikenist_QuickScan6.mp4 /images/blog /images/blog.jpeg /images/careers.jpg /images/certificates /images/certificates/Anvisa copy.png /images/certificates/anvisa1.png /images/certificates/blank.png /images/certificates/Cer.png /images/certificates/dicom.png /images/certificates/FDA copy.png /images/certificates/FDA.png /images/certificates/gdpr_img.png /images/certificates/hippa.png /images/certificates/hl7-FHIR.png /images/certificates/iec-62304.png /images/certificates/iso-13485.png /images/certificates/iso-14971.png /images/certificates/ISO.jpg /images/certificates/iso.png /images/certificates/iso_cert.jpg /images/certificates/karnataka-elevate.png /images/certificates/karnataka-GOK.png /images/certificates/nabh.png /images/certificates/owasp_logo.png /images/certificates/VAPT.png /images/certificates/zsprize.png /images/cover-page /images/deployment /images/deployment3.jpeg /images/DESKTOP.jpg /images/feature /images/footer /images/header-dew copy.png /images/header-dew.png /images/homescreenslide.png /images/hostings /images/Installations /images/logo /images/map-marker.png /images/nasscom.jpg /images/nasscomproductconclave.jpg /images/nasscomproductconclave.png /images/news-articles /images/Partners /images/Productpage /images/products /images/QuickRad.jpeg /images/QuickRad_1.jpeg /images/QuickRadFeatures.jpeg /images/QuickRadPacs.jpeg /images/QuickRadScreen.jpg /images/rsna.jpeg /images/rsna2.jpeg /images/screen /images/shutterstock-images /images/tablet.png /images/tablet11inch.png /images/tablet2.png /images/team /images/url.png /images/video-bg.jpg /images/Video_1.mp4 /index.html /js /legal.html /newblogposts.html /newspage.html /pricing.html /privacy.html /process.php /Quickdiag.html /Quickrad.html /QuickSuite_User_Manual.pdf /regulatory.html /rsna.html /sliderStyle.js /style.css /UserManual
Severity: medium
Fingerprint: 5f32cf5d6962f09c0f1214d30f1214d3dff670c565ae1e56c7c8b853540e83df
Found 94 files trough .DS_Store spidering: /Brochures /careers.html /contactdiag.html /contactscan.html /cookie /cookie/css /cookie/docs /cookie/js /cookiepolicy.html /css /fonts /images /images/AikenDemo.mp4 /images/Aikeninst-small-dark.png /images/Aikenist_QuickScan6.mp4 /images/blog /images/blog.jpeg /images/careers.jpg /images/certificates /images/certificates/Anvisa copy.png /images/certificates/anvisa1.png /images/certificates/blank.png /images/certificates/Cer.png /images/certificates/dicom.png /images/certificates/FDA copy.png /images/certificates/FDA.png /images/certificates/gdpr_img.png /images/certificates/hippa.png /images/certificates/hl7-FHIR.png /images/certificates/iec-62304.png /images/certificates/iso-13485.png /images/certificates/iso-14971.png /images/certificates/ISO.jpg /images/certificates/iso.png /images/certificates/iso_cert.jpg /images/certificates/karnataka-elevate.png /images/certificates/karnataka-GOK.png /images/certificates/nabh.png /images/certificates/owasp_logo.png /images/certificates/VAPT.png /images/certificates/zsprize.png /images/compliance /images/cover-page /images/deployment /images/deployment3.jpeg /images/DESKTOP.jpg /images/feature /images/footer /images/header-dew copy.png /images/header-dew.png /images/homescreenslide.png /images/hostings /images/Installations /images/logo /images/map-marker.png /images/nasscom.jpg /images/nasscomproductconclave.jpg /images/nasscomproductconclave.png /images/news-articles /images/Partners /images/Productpage /images/products /images/QuickRad.jpeg /images/QuickRad_1.jpeg /images/QuickRadFeatures.jpeg /images/QuickRadPacs.jpeg /images/QuickRadScreen.jpg /images/rsna.jpeg /images/rsna2.jpeg /images/screen /images/shutterstock-images /images/tablet.png /images/tablet11inch.png /images/tablet2.png /images/team /images/url.png /images/video-bg.jpg /images/Video_1.mp4 /index.html /js /legal.html /newblogposts.html /newspage.html /pricing.html /privacy.html /process.php /Quickdiag.html /Quickrad.html /QuickSuite_User_Manual.pdf /regulatory.html /rsna.html /sliderStyle.js /style.css /UserManual
Severity: medium
Fingerprint: 5f32cf5d6962f09c62fb79d662fb79d6fa412274257fbf619a57a3ba2fdc1304
Found 95 files trough .DS_Store spidering: /Brochures /careers.html /contactdiag.html /contactscan.html /cookie /cookie/css /cookie/docs /cookie/js /cookiepolicy.html /css /fonts /images /images/AikenDemo.mp4 /images/Aikeninst-small-dark.png /images/Aikenist_QuickScan6.mp4 /images/blog /images/blog.jpeg /images/careers.jpg /images/certificates /images/certificates/Anvisa copy.png /images/certificates/anvisa1.png /images/certificates/blank.png /images/certificates/Cer.png /images/certificates/dicom.png /images/certificates/FDA copy.png /images/certificates/FDA.png /images/certificates/gdpr_img.png /images/certificates/hippa.png /images/certificates/hl7-FHIR.png /images/certificates/iec-62304.png /images/certificates/iso-13485.png /images/certificates/iso-14971.png /images/certificates/ISO.jpg /images/certificates/iso.png /images/certificates/iso_cert.jpg /images/certificates/karnataka-elevate.png /images/certificates/karnataka-GOK.png /images/certificates/nabh.png /images/certificates/owasp_logo.png /images/certificates/VAPT.png /images/certificates/zsprize.png /images/compliance /images/cover-page /images/deployment /images/deployment3.jpeg /images/DESKTOP.jpg /images/feature /images/footer /images/header-dew copy.png /images/header-dew.png /images/homescreenslide.png /images/hostings /images/Installations /images/logo /images/map-marker.png /images/nasscom.jpg /images/nasscomproductconclave.jpg /images/nasscomproductconclave.png /images/news-articles /images/Partners /images/Productpage /images/products /images/QuickRad.jpeg /images/QuickRad_1.jpeg /images/QuickRadFeatures.jpeg /images/QuickRadPacs.jpeg /images/QuickRadScreen.jpg /images/rsna.jpeg /images/rsna2.jpeg /images/screen /images/shutterstock-images /images/tablet.png /images/tablet11inch.png /images/tablet2.png /images/team /images/url.png /images/video-bg.jpg /images/Video_1.mp4 /index.html /js /legal.html /newblogposts.html /newspage.html /pricing.html /privacy.html /process.php /Quickdiag.html /Quickrad.html /Quickscan.html /QuickSuite_User_Manual.pdf /regulatory.html /rsna.html /sliderStyle.js /style.css /UserManual
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522eb0198b8
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/GoodEgUY/pugga-site-latest.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a286fbd6
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/GeroZayas/GZ-LLM-Prompt-Organizer.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbddfdfe81
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/DeBeeUche/ticketbox-clone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [gui] wmstate = normal geometry = 1109x563+128+128 216 255
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e21772a7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "gitsafe-backup"] url = git://gitsafe:5418/backup.git fetch = +refs/heads/*:refs/remotes/gitsafe-backup/* skipFetchAll = true [remote "origin"] url = https://github.com/hamdStack/PVSC-Education fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0d600344
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/AnuragSaini12/Uday-Dokras.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb6cb9084e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/RangeTech/website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf43cba59
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/TryumOperacoes/hlg-pertenza.git fetch = +refs/heads/*:refs/remotes/origin/*
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225a0ce0803
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : path=donations key=Donation name=Donation label=Donations singular=Donation plural=Donations _CheckoutsMeta (args: none) : singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e63122500fbc69b
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : key=User name=User label=Users singular=User plural=Users path=users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : key=Organization name=Organization label=Organizations singular=Organization plural=Organizations path=organizations _CampaignsMeta (args: none) : plural=Campaigns path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225515ce8c9
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : singular=User plural=Users path=users key=User name=User label=Users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e63122586929967
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : path=users key=User name=User label=Users singular=User plural=Users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts singular=Checkout _OrganizationsMeta (args: none) : plural=Organizations path=organizations key=Organization name=Organization label=Organizations singular=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312250adfa527
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : singular=User plural=Users path=users key=User name=User label=Users _DonationsMeta (args: none) : key=Donation name=Donation label=Donations singular=Donation plural=Donations path=donations _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : singular=Organization plural=Organizations path=organizations key=Organization name=Organization label=Organizations _CampaignsMeta (args: none) : path=campaigns key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns _ReferralTokensMeta (args: none) : path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens _ReferralEventsMeta (args: none) : singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312250fb06553
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : label=Organizations singular=Organization plural=Organizations path=organizations key=Organization name=Organization _CampaignsMeta (args: none) : key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event plural=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225f396bbdf
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : plural=Users path=users key=User name=User label=Users singular=User _DonationsMeta (args: none) : plural=Donations path=donations key=Donation name=Donation label=Donations singular=Donation _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : singular=Organization plural=Organizations path=organizations key=Organization name=Organization label=Organizations _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225ca9ad9df
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : plural=Donations path=donations key=Donation name=Donation label=Donations singular=Donation _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : name=Organization label=Organizations singular=Organization plural=Organizations path=organizations key=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e6312252d20efc3
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : singular=Donation plural=Donations path=donations key=Donation name=Donation label=Donations _CheckoutsMeta (args: none) : singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout label=Checkouts _OrganizationsMeta (args: none) : label=Organizations singular=Organization plural=Organizations path=organizations key=Organization name=Organization _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : name=ReferralToken label=Referral Tokens singular=Referral Token plural=Referral Tokens path=referral-tokens key=ReferralToken _ReferralEventsMeta (args: none) : label=Referral Events singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225f4877549
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : name=User label=Users singular=User plural=Users path=users key=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : key=Checkout name=Checkout label=Checkouts singular=Checkout plural=Checkouts path=checkouts _OrganizationsMeta (args: none) : path=organizations key=Organization name=Organization label=Organizations singular=Organization plural=Organizations _CampaignsMeta (args: none) : label=Campaigns singular=Campaign plural=Campaigns path=campaigns key=Campaign name=Campaign _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : singular=Referral Event plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events
Severity: high
Fingerprint: c2db3a1c40d490db1a0bbaa3aeb4978ebc0d717e5b314ca34e631225ec24e7af
GraphQL introspection enabled at /graphql Types: 94 (by kind: ENUM: 11, INPUT_OBJECT: 49, OBJECT: 27, SCALAR: 7) Operations: - Query: Query | fields: User, _UsersMeta, _allUsersMeta, allDonations, allUsers - Mutation: Mutation | fields: createUser, createUsers, deleteUser, updateUser, updateUsers Directives: cacheControl, deprecated, include, skip (total: 4) Readable stores: 7 _UsersMeta (args: none) : label=Users singular=User plural=Users path=users key=User name=User _DonationsMeta (args: none) : label=Donations singular=Donation plural=Donations path=donations key=Donation name=Donation _CheckoutsMeta (args: none) : label=Checkouts singular=Checkout plural=Checkouts path=checkouts key=Checkout name=Checkout _OrganizationsMeta (args: none) : singular=Organization plural=Organizations path=organizations key=Organization name=Organization label=Organizations _CampaignsMeta (args: none) : key=Campaign name=Campaign label=Campaigns singular=Campaign plural=Campaigns path=campaigns _ReferralTokensMeta (args: none) : plural=Referral Tokens path=referral-tokens key=ReferralToken name=ReferralToken label=Referral Tokens singular=Referral Token _ReferralEventsMeta (args: none) : plural=Referral Events path=referral-events key=ReferralEvent name=ReferralEvent label=Referral Events singular=Referral Event
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa377606e75d9ca2d77ea8109466a24a8ef5b6e8caf
GraphQL introspection enabled at /graphql Types: 533 (by kind: ENUM: 45, INPUT_OBJECT: 128, INTERFACE: 22, OBJECT: 321, SCALAR: 5, UNION: 12) Operations: - Query: RootQuery | fields: allSettings, branch, branchBy, branches, career - Mutation: RootMutation | fields: createBranch, createCareer, createCategory, createComment, createContact Directives: deprecated, include, skip (total: 3)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb87f99425
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/LcsGomes-AMS/lava-car fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3c57d805
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/lImFsheng/PSV2.git fetch = +refs/heads/*:refs/remotes/origin/* [lfs] repositoryformatversion = 0 [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master vscode-merge-base = origin/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226936aafe
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/addelong/imageoftext.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbc782881c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/QAjobs/QATestingJobs.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522b4811374
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/RollbackBJJ/rollback-web.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d67c42e5051478b6c78673ce64a40222378e03a4f1
GraphQL introspection enabled at /api/graphql Types: 231 (by kind: ENUM: 18, INPUT_OBJECT: 67, INTERFACE: 3, OBJECT: 136, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d621b35c04cb1a7648e53297137c50bc8cbe6651fc
GraphQL introspection enabled at /api/graphql Types: 228 (by kind: ENUM: 19, INPUT_OBJECT: 65, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6b051d5706ad22d74683d93e70e782bb076775b10
GraphQL introspection enabled at /api/graphql Types: 227 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6da3e8120aa5f0324aa57fdb7ac067fc0cc54fbe0
GraphQL introspection enabled at /api/graphql Types: 225 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 132, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652219ab1fd7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/danielbsh/consulting.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1c08413d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:magedghazouly/ghazouly-site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe22d4b6c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:magedghazouly/ghazouly-site.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224cdb382e
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/deschdev/new-portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522bdf37c56
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/deschdev/new-portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65229065d68e
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:Dhairya99999/BhaukaalStudios.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "changes"] remote = origin merge = refs/heads/changes [branch "main"] remote = origin vscode-merge-base = origin/main merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb60f30196
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/git-joao/projeto-nortax fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin vscode-merge-base = origin/main vscode-merge-base = origin/main merge = refs/heads/main [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d14154f7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/katerina-axdx/katerina.today.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db84e0e35024ec0432a91d5bc23203715b21e53d2014567896
GraphQL introspection enabled at /api Types: 26 (by kind: ENUM: 5, INPUT_OBJECT: 2, OBJECT: 14, SCALAR: 5) Operations: - Query: Query | fields: app, appPackage, apps, currentUser, project - Mutation: Mutation | fields: createProject, createStripeCheckoutBillingPortalUrl, createStripeCheckoutSession, updateProject, updateUser Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf50ad6ca
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/Antiquairesite/Antiquaire-nancy.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb58c32fba
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://www.vigiatech.cl fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65225a8db935
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://shaharbh@bitbucket.org/shaharbh/mobileupswebsite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbb1535e9a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/elliotknock/Knockly-Website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1ce04e16
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/SUJENDRANJ/urban-nexgen.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09c3af247253af24725dad43382a08d12638d5ca19997302541
Found 9 files trough .DS_Store spidering: /icons /images /images/appa /images/kumbakonam_2023 /images/mughals-modernstate /images/trees /js /processed_images /vendor
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392abd8ba55a4d11d696d31f4f2b3d732b66c
Found 7 files trough .DS_Store spidering: /icons /images /images/kumbakonam_2023 /images/mughals-modernstate /images/trees /js /processed_images
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc837288bfabecc478833b8c8e32fbcb18
Found 4 files trough .DS_Store spidering: /icons /images /js /processed_images
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814e8764e31d28c0bab6d784e6fa76b3eb05
Found 6 files trough .DS_Store spidering: /icons /images /images/kumbakonam_2023 /images/mughals-modernstate /images/trees /processed_images
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d956ff55a956ff55a956ff55a956ff55a
Found 1 files trough .DS_Store spidering: /icons
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb662dfa16
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/rdpgz18/gshop fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbdd976722
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/thesrinivasgundam/srinivasgundam.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] vscode-merge-base = origin/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d67c42e5051478b6c78673ce64a40222378e03a4f1
GraphQL introspection enabled at /api/graphql Types: 231 (by kind: ENUM: 18, INPUT_OBJECT: 67, INTERFACE: 3, OBJECT: 136, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d621b35c04cb1a7648e53297137c50bc8cbe6651fc
GraphQL introspection enabled at /api/graphql Types: 228 (by kind: ENUM: 19, INPUT_OBJECT: 65, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6b051d5706ad22d74683d93e70e782bb076775b10
GraphQL introspection enabled at /api/graphql Types: 227 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 134, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6da3e8120aa5f0324aa57fdb7ac067fc0cc54fbe0
GraphQL introspection enabled at /api/graphql Types: 225 (by kind: ENUM: 19, INPUT_OBJECT: 64, INTERFACE: 3, OBJECT: 132, SCALAR: 6, UNION: 1) Operations: - Query: Query | fields: articlePackage, articlePackageTags, articlePackages, articleTemplates, campaign - Mutation: Mutation | fields: removeArticle, removeArticlePackage, upsertArticle, upsertArticlePackage, upsertArticleTemplate Directives: deprecated, include, isAuthenticated, oneOf, optionalTenantId, skip, specifiedBy (total: 7)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652260e65dbf
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/noahsaintlouis/ocalaguttercleaners.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522550afee0
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:samihasan126/flow-site.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228e06df91
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/ozoneeT/dansaki.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb01389a3e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Rajatbali/Cabs-Services-Business-webpage.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbefc51152
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/henriqueffazendeiro/centro.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb52117b7e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/myFiHub/podium-landing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe5c4b841
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:caresjac/AvanteGrande.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb13ccd3a0
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Staelle-desti/Projet_international.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09cdafa5447dafa54477769d371caebdb64b7c7c5a82f3f7295
Found 18 files trough .DS_Store spidering: /cv /data /posts /site_libs 10 /site_libs 11 /site_libs 12 /site_libs 13 /site_libs 14 /site_libs 15 /site_libs 2 /site_libs 3 /site_libs 4 /site_libs 5 /site_libs 6 /site_libs 7 /site_libs 8 /site_libs 9 /teaching
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744d7f25e9474ee4b4633598afbaf7ca2248
Found 12 files trough .DS_Store spidering: /cv /posts /site_libs /site_libs 2 /site_libs 3 /site_libs 4 /site_libs 5 /site_libs 6 /site_libs 7 /site_libs 8 /site_libs 9 /teaching
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8df03f504b2c5304852c50c9976792919
Found 8 files trough .DS_Store spidering: /cv /posts /site_libs /site_libs 2 /site_libs 3 /site_libs 4 /site_libs 5 /teaching
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb06cbd057
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ano94-prog/abc99.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4f0f0047
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/protohacks77/examsideman.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3119201d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/MaimelaTshepiso/Ngwaketsi-Lifting-Engineering.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228307af97
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/suizhe01/wong-cheng.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c5b888d6
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/suizhe01/wong-cheng.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb614d0535
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/liveslow0/smart-spare-parts.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652269ecfcfb
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/GoatStack/makeweb.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb33f54e15
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/jairo172008-cloud/cayetano_market3.0.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbf7c2fc1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Sindbadtrading/terminal-training.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226dfc5387
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = git@github.com:manuelprgit/ArchomeSoluciones.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb55115234
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Nirmal-RJ/khaja-catalogue.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652218fcedaa
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/studiomigu/WEBSITE-VODOINSTALATERSKI-SERVIS.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65225b80880c
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:sayidu/kodee.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "site-improvements"] vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba017513d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Usman12k13/Urban-Aura.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09cf35cbfb3f35cbfb37d19b1b6e13fa1fa9689dd3b88230548
Found 29 files trough .DS_Store spidering: /about.html /blog.html /cv.html /headshot.jpg /index.html /listings.html /listings.json /logo.webp /posts /posts/blah.html /posts/crafting-cv-and-personal-statement /posts/embracing-new-horizons /posts/essentials-for-sustained-community-driven-development /posts/kazhuta-kali /posts/kazhutakali /posts/malayalam-typing /posts/new-beginnings /posts/post-with-code /posts/storytelling-rules /posts/systems-of-measurement /posts/temperature-conversion /posts/temperature_conversion /posts/welcome /posts/why-blog /robots.txt /search.json /site_libs /sitemap.xml /styles.css
Severity: low
Fingerprint: 5f32cf5d6962f09c684e525d684e525d692393444ae60bb45a178d055321a8ba
Found 27 files trough .DS_Store spidering: /about.html /blog.html /cv.html /index.html /listings.html /listings.json /logo.webp /posts /posts/blah.html /posts/crafting-cv-and-personal-statement /posts/embracing-new-horizons /posts/essentials-for-sustained-community-driven-development /posts/kazhuta-kali /posts/kazhutakali /posts/malayalam-typing /posts/new-beginnings /posts/post-with-code /posts/storytelling-rules /posts/temperature-conversion /posts/temperature_conversion /posts/welcome /posts/why-blog /robots.txt /search.json /site_libs /sitemap.xml /styles.css
Severity: low
Fingerprint: 5f32cf5d6962f09c7c3d3e457c3d3e45061597bc1807eabcdde6203d1d70ae9a
Found 30 files trough .DS_Store spidering: /about.html /blog.html /cv.html /cv.pdf /index.html /KR.jpeg /kr.svg /listings.html /listings.json /logo.webp /posts /posts/blah.html /posts/crafting-cv-and-personal-statement /posts/embracing-new-horizons /posts/essentials-for-sustained-community-driven-development /posts/kazhuta-kali /posts/kazhutakali /posts/malayalam-typing /posts/new-beginnings /posts/post-with-code /posts/storytelling-rules /posts/temperature-conversion /posts/temperature_conversion /posts/welcome /posts/why-blog /robots.txt /search.json /site_libs /sitemap.xml /styles.css
Severity: low
Fingerprint: 5f32cf5d6962f09c2a439cf82a439cf85d4498f7d21b1f0fd0e806c68871fe25
Found 31 files trough .DS_Store spidering: /about.html /blog.html /cv.html /cv.pdf /headshot.png /index.html /KR.jpeg /kr.svg /listings.html /listings.json /logo.webp /posts /posts/blah.html /posts/crafting-cv-and-personal-statement /posts/embracing-new-horizons /posts/essentials-for-sustained-community-driven-development /posts/kazhuta-kali /posts/kazhutakali /posts/malayalam-typing /posts/new-beginnings /posts/post-with-code /posts/storytelling-rules /posts/temperature-conversion /posts/temperature_conversion /posts/welcome /posts/why-blog /robots.txt /search.json /site_libs /sitemap.xml /styles.css
Severity: low
Fingerprint: 5f32cf5d6962f09c2a439cf82a439cf85d4498f7d21b1f0fd0e806c60c105061
Found 31 files trough .DS_Store spidering: /about.html /blog.html /cv.html /cv.pdf /headshot.jpg /index.html /KR.jpeg /kr.svg /listings.html /listings.json /logo.webp /posts /posts/blah.html /posts/crafting-cv-and-personal-statement /posts/embracing-new-horizons /posts/essentials-for-sustained-community-driven-development /posts/kazhuta-kali /posts/kazhutakali /posts/malayalam-typing /posts/new-beginnings /posts/post-with-code /posts/storytelling-rules /posts/temperature-conversion /posts/temperature_conversion /posts/welcome /posts/why-blog /robots.txt /search.json /site_libs /sitemap.xml /styles.css
Severity: low
Fingerprint: 5f32cf5d6962f09c47dfe71947dfe71960e9e2589d6f11f8ac27f0b9728bac2b
Found 16 files trough .DS_Store spidering: /about.html /blog.html /cv.html /cv.pdf /headshot.jpg /index.html /KR.jpeg /kr.svg /listings.html /listings.json /posts /robots.txt /search.json /site_libs /sitemap.xml /styles.css
Severity: low
Fingerprint: 5f32cf5d6962f09c668fcbec668fcbec07d245e3dd50752b9bcea6d2f826d169
Found 17 files trough .DS_Store spidering: /about.html /blog.html /cv.html /cv.pdf /headshot.jpeg /headshot.jpg /index.html /KR.jpeg /kr.svg /listings.html /listings.json /posts /robots.txt /search.json /site_libs /sitemap.xml /styles.css
Severity: low
Fingerprint: 5f32cf5d6962f09c4239b3d84239b3d8defae55749dd1c5e068db8cc4668a143
Found 8 files trough .DS_Store spidering: /about.html /cv.html /index.html /robots.txt /search.json /site_libs /sitemap.xml /styles.css
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db84e0e3509bb751fab52dd9aabdfbe41f2425870311c66483
GraphQL introspection enabled at /api Types: 39 (by kind: ENUM: 6, INPUT_OBJECT: 2, OBJECT: 25, SCALAR: 6) Operations: - Query: Query | fields: inventories, inventory, me, users, vendors - Mutation: Mutation | fields: changePassword, logError, login, resetPassword, signup Directives: cacheControl, deprecated, include, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522481ad52a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/Cosmium-apps/ti-website.git fetch = +refs/heads/*:refs/remotes/origin/* [user] name = julien.p email = julien@cosmium.app [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb9c550188
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/hoangquan2419/profile.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d60619e9e6c99028968146636b711dd6c00db2bea8
GraphQL introspection enabled at /api/graphql Types: 15 (by kind: ENUM: 2, OBJECT: 9, SCALAR: 4) Operations: - Query: Query | fields: artworks - Mutation: Mutation | fields: updateArtwork Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5) Readable stores: 0
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa3eb172d4c8c2d8610253077dd84defdfd92dd0040
GraphQL introspection enabled at /graphql Types: 118 (by kind: ENUM: 17, INPUT_OBJECT: 27, OBJECT: 66, SCALAR: 6, UNION: 2) Operations: - Query: Query | fields: _empty, allAdmins, budgetEstimation, independenceDayResult, init2FA - Mutation: Mutation | fields: _empty, createUser, independenceDaySubmit, loginWithPassword, subscribeToUpdates Directives: auth, deprecated, include, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb37dabd70
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/limachi72/multigame.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4dd41ded
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/leandros1793/alma-obrador-frontend.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb962b5201
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/arkadyabramoff/fixwalletissues.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d695aa366a2d6765da218df29b63359b190e05f629
GraphQL introspection enabled at /api/graphql Types: 58 (by kind: ENUM: 3, INPUT_OBJECT: 10, OBJECT: 37, SCALAR: 8) Operations: - Query: Query | fields: Agenda, Agenda_aggregated, Agenda_by_id, Agenda_by_version, hero_content - Subscription: Subscription | fields: Agenda_mutated, Headersettings_mutated, Navigation_mutated, faq_items_mutated, hero_content_mutated Directives: deprecated, include, skip (total: 3)
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d695aa366a2d6765da218df29b63359b199c0b8145
GraphQL introspection enabled at /api/graphql Types: 58 (by kind: ENUM: 3, INPUT_OBJECT: 10, OBJECT: 37, SCALAR: 8) Operations: - Query: Query | fields: Agenda, Agenda_aggregated, Agenda_by_id, Agenda_by_version, hero_content - Subscription: Subscription | fields: Agenda_mutated, Headersettings_mutated, Navigation_mutated, faq_items_mutated, hero_content_mutated Directives: deprecated, include, skip (total: 3) Readable stores: 1 hero_content (args: optional/default) : id=1 title=DÉ COMEDY CLUB VAN GRONINGEN! cta_text=IK WIL LACHEN ECHT HE countdown_title=Volgende show over: no_events_message=Binnenkort meer evenementen! is_active=true
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d695aa366a2d6765da218df29b63359b19bbffe55b
GraphQL introspection enabled at /api/graphql Types: 58 (by kind: ENUM: 3, INPUT_OBJECT: 10, OBJECT: 37, SCALAR: 8) Operations: - Query: Query | fields: Agenda, Agenda_aggregated, Agenda_by_id, Agenda_by_version, hero_content - Subscription: Subscription | fields: Agenda_mutated, Headersettings_mutated, Navigation_mutated, faq_items_mutated, hero_content_mutated Directives: deprecated, include, skip (total: 3) Readable stores: 1 hero_content (args: optional/default) : is_active=true id=1 title=DÉ COMEDY CLUB VAN GRONINGEN! cta_text=IK WIL LACHEN ECHT HE countdown_title=Volgende show over: no_events_message=Binnenkort meer evenementen!
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d695aa366a2d6765da218df29b63359b191faa82e1
GraphQL introspection enabled at /api/graphql Types: 58 (by kind: ENUM: 3, INPUT_OBJECT: 10, OBJECT: 37, SCALAR: 8) Operations: - Query: Query | fields: Agenda, Agenda_aggregated, Agenda_by_id, Agenda_by_version, hero_content - Subscription: Subscription | fields: Agenda_mutated, Headersettings_mutated, Navigation_mutated, faq_items_mutated, hero_content_mutated Directives: deprecated, include, skip (total: 3) Readable stores: 1 hero_content (args: optional/default) : no_events_message=Binnenkort meer evenementen! is_active=true id=1 title=DÉ COMEDY CLUB VAN GRONINGEN! cta_text=IK WIL LACHEN ECHT HE countdown_title=Volgende show over:
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d695aa366a2d6765da218df29b63359b19757654cd
GraphQL introspection enabled at /api/graphql Types: 58 (by kind: ENUM: 3, INPUT_OBJECT: 10, OBJECT: 37, SCALAR: 8) Operations: - Query: Query | fields: Agenda, Agenda_aggregated, Agenda_by_id, Agenda_by_version, hero_content - Subscription: Subscription | fields: Agenda_mutated, Headersettings_mutated, Navigation_mutated, faq_items_mutated, hero_content_mutated Directives: deprecated, include, skip (total: 3) Readable stores: 1 hero_content (args: optional/default) : title=DÉ COMEDY CLUB VAN GRONINGEN! cta_text=IK WIL LACHEN ECHT HE countdown_title=Volgende show over: no_events_message=Binnenkort meer evenementen! is_active=true id=1
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbad970df8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/sukamadev/P-gina-Web.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb82a7b97d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/GCHkongcheng/TKZC.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb37dc2205
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/GCHkongcheng/TKZC.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb6eb11654
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/skylordking5/blcapitalltd.git fetch = +refs/heads/*:refs/remotes/origin/* [lfs] repositoryformatversion = 0 [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb44d0fbb2
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/savi1047/LawnAndStone.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522cb824536
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/research-16alpha/halfsy_frontend.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "mobileVersion"] vscode-merge-base = origin/main remote = origin merge = refs/heads/mobileVersion
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb06cbd057
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ano94-prog/abc99.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522eb0c51cb
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/myattsu/portfolio-of-myathsu.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65223dcfafc1
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://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@github.com/uniqwebai-dev/Malajap.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb64f6d143
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/AJ22326009/Dot-Collection-Global-Design.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d6623d756260956f32dfefe60ecae2d83cbf8272cc
GraphQL introspection enabled at /api/graphql Types: 2918 (by kind: ENUM: 77, INPUT_OBJECT: 375, OBJECT: 2446, SCALAR: 8, UNION: 12) Operations: - Query: Query | fields: Page, Pages, countPages, docAccessPage, versionPage - Mutation: Mutation | fields: createPage, deletePage, duplicatePage, restoreVersionPage, updatePage Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d62337d3d62337d3d62337d3d62337d3d62337d3d6
GraphQL introspection enabled at /api/graphql
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d60bcc606310af0fa17b84fb0f7708ee26524ecc82
GraphQL introspection enabled at /api/graphql Types: 3018 (by kind: ENUM: 73, INPUT_OBJECT: 432, OBJECT: 2502, SCALAR: 8, UNION: 3) Operations: - Query: Query | fields: User, Users, countUsers, docAccessUser, meUser - Mutation: Mutation | fields: createUser, deleteUser, logoutUser, refreshTokenUser, updateUser Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb880ca32f
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/UAMYvonne/YANIFA-WEBSITE.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222647c0c6
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/RonitGandhi/new-portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [pull] rebase = true
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb80df56e1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Jackrise/mananciais.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8a21bf09
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/HasbiyallahuJafaru/sunshineinapod.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226b102c83
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/mtechnopower/mtechnopower.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652257bd7469
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/lewwilson20011/alano-club-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228eb712bb
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/abdirxhmxn/portfolio fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522946fb393
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/Appstep-Technologies-Private-Limited/The_Bhai_Special_HTML.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "sonali-dev"] vscode-merge-base = origin/main remote = origin merge = refs/heads/sonali-dev
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb73bd58d9
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/trispacesofficial-cpu/Trispaces_Static_Pages.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbb2712d65
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/dishastudioz/ds_underdev fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbafb226bd
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/haseeb0335/Lush-by-zain.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa3162fc1bdbce46f5f516f3d846150721ade1429ed
GraphQL introspection enabled at /graphql Types: 23 (by kind: ENUM: 2, INPUT_OBJECT: 1, OBJECT: 17, SCALAR: 3) Operations: - Query: Query | fields: getUser, getUsers - Mutation: Mutation | fields: createUser, deleteUser, loginUser, updateFirstTimeLogin, updateUser Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 2 getUser (args: optional/default) : code=401 message=UNAUTHORIZED getUsers (args: optional/default) : code=401 message=UNAUTHORIZED
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa3162fc1bdbce46f5f516f3d846150721ad465657b
GraphQL introspection enabled at /graphql Types: 23 (by kind: ENUM: 2, INPUT_OBJECT: 1, OBJECT: 17, SCALAR: 3) Operations: - Query: Query | fields: getUser, getUsers - Mutation: Mutation | fields: createUser, deleteUser, loginUser, updateFirstTimeLogin, updateUser Directives: deprecated, include, skip, specifiedBy (total: 4) Readable stores: 2 getUser (args: optional/default) : message=UNAUTHORIZED code=401 getUsers (args: optional/default) : code=401 message=UNAUTHORIZED
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb288c8b29
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/tiryakienes/tiryakienes.github.io.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb75d19f51
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/albertzeqiri/albertzeqiri.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3c856c91
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/hyper220502-byte/clinic01.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd15519dd
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Dev-V-Trivedi/theentrepreneurjunction.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbc9543405
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/eymenelneccar/menuhello.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb27d2f7b0
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/eymenelneccar/menukas.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbac01599e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Kurisuo/PerspectivePaint.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb92b8c76a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Kurisuo/PerspectivePainting.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd4f49824
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Arunkumar6522/artarun_portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652276df9ddd
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/HarryNC92/Titan-Landing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb44ec45f0
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/MarianoTimistit23/csg-seguros.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba401ecd6
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/kayceeeneh/OcturionTech-demo.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe5e08cf5
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/nversahakyanc/xitytour.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbca42cd5e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ebisuexports-cpu/EBISU-EXPORTS.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b0564b7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/eymenelneccar/blban.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652214a57a61
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/DavideSchirru17/lapdance.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb18351f5a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/albertzeqiri/kodratech.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652279e4fc56
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/xNightW0lfz/yxs-cdn.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf53f02d3
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/meagsp/personal_website.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228f721257
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/jermaine999/dandy-cookies fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbcee49cc1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/KYRAS-2023/SocioPotents.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main gk-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb5b120909
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/amarildopisha/Lakrorane.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7b0564b7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/eymenelneccar/blban.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db1a0bbaa3a63a70a86f0f498c067e8739a14db18ce5e30760
GraphQL introspection enabled at /graphql Types: 10 (by kind: INPUT_OBJECT: 1, OBJECT: 5, SCALAR: 4) Operations: - Query: Queries | fields: inviteInfo - Mutation: Mutations | fields: acceptInvitation, authenticate, authenticateClient, magicLink, refreshAuth Directives: include, skip (total: 2)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe233e1d8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/AfeefaRehan/palettefit-backend.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652260abc83c
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/chanceriley6/margindept-website.git fetch = +refs/heads/*:refs/remotes/origin/*
Exposing Swagger/OpenAPI documentation is primarily a risk if your API has underlying security flaws, as it gives attackers a precise roadmap to find them.
Those detail every endpoint, parameter, and data model, making it easier to discover and exploit vulnerabilities like broken access control or injection points.
While a perfectly secure API mitigates the danger, protecting your documentation is a critical layer of defense that forces attackers to work without a map.
Severity: info
Fingerprint: 5733ddf49ff49cd1f5e22fb4b4c3c7736742e537d69d6101a5ca07d35f309d8f
Public Swagger UI/API detected at path: /api/swagger.json - sample paths:
DELETE /maker/estimationProfile/{id}
DELETE /maker/location/{id}
DELETE /maker/material/{id}
DELETE /maker/materialType/{id}
DELETE /maker/shippingrate/{id}
DELETE /maker/technology/{id}
GET /CurrentUser
GET /GetMakerOrders
GET /GetOpenOrders
GET /RefreshStripeAccount
GET /StripeAccountLink
GET /currentMaker
GET /maker
GET /maker/dashboard
GET /maker/emailtemplates
GET /maker/estimationProfiles
GET /maker/info/{storeName?}
GET /maker/locations
GET /maker/materialTypes
GET /maker/materials
GET /maker/paymentrates
GET /maker/shippingrates
GET /maker/technologies
POST /AcceptOrder
POST /CancelOrder
POST /Checkout
POST /CompleteOrder
POST /DebugClaims
POST /GetShippingQuote
POST /OnboardStripeAccount
POST /OrderReadyForPickup
POST /OrderShipped
POST /RefundOrder
POST /freetrial/submit
POST /maker/bulkDiscountOptions
POST /maker/emailtemplate/test
POST /maker/emailtemplate/update
POST /maker/estimationProfile
POST /maker/estimationProfile/update
POST /maker/info/update
POST /maker/location
POST /maker/location/update
POST /maker/material
POST /maker/material/update
POST /maker/materialType
POST /maker/materialType/update
POST /maker/paymentrate/update
POST /maker/shippingrate
POST /maker/shippingrate/delete
POST /maker/shippingrate/update
POST /maker/shippo/integrate
POST /maker/shippo/integrate/complete
POST /maker/signup
POST /maker/technology
POST /maker/technology/update
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf66c12ab
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Jabbes-Tembo/Portfolio-Site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522fac55736
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/xNightW0lfz/GSV2.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd31fb432
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:premierautomarine/PremierDetailingWeb.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbb9fafca5
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/shorty1111/BTCv01.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65222ee538b6
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/studiomigu/Vodoinstalater-OnTop.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a5661f3c
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/studiomigu/Vodoinstalater-Mlaznica.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbf7c2fc1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Sindbadtrading/terminal-training.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbad077401
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/lucasalves0722/Hospedador-de-links.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522031d68a8
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/sarahokafor-gif/splitsmart.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d63333eee3d801bf21daa10cc165f066b36a27a89b
GraphQL introspection enabled at /api/graphql Types: 3897 (by kind: ENUM: 105, INPUT_OBJECT: 477, OBJECT: 3291, SCALAR: 8, UNION: 16) Operations: - Query: Query | fields: Page, Pages, countPages, docAccessPage, versionPage - Mutation: Mutation | fields: createPage, deletePage, duplicatePage, restoreVersionPage, updatePage Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb795b085d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/OrhideaQadraku/orhidea_portfolio.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522323edf99
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://abdulmalik.creations@gitlab.com/abdulmalik.creations/saudi-company-page.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main gk-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1a130337
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:ninghaomiao2002/SportsWebsite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3332beea
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/swathisuren77/SS-Wesite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4a486643
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/r7ings/dexinexhibition.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8df82e26
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/nlgamevibes-create/Wesbite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb41dac4db
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Atenzo/rublev-site.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522bb388a5a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/aaugust22/Personal-Website.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652273aa433e
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/studiomigu/WEBSITE-VODOINSTALATERSKI-SERVIS.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba0667354
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/dev-juliadimas/cartaoVisita.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
GraphQL introspection is enabled.
This could leak to data leak if not properly configured.
Severity: medium
Fingerprint: c2db3a1c40d490db2337d3d69162149da61173fff508501d01c537e86e83c108
GraphQL introspection enabled at /api/graphql Types: 518 (by kind: ENUM: 14, INPUT_OBJECT: 69, OBJECT: 424, SCALAR: 8, UNION: 3) Operations: - Query: Query | fields: User, Users, countUsers, docAccessUser, meUser - Mutation: Mutation | fields: createUser, deleteUser, logoutUser, refreshTokenUser, updateUser Directives: deprecated, include, oneOf, skip, specifiedBy (total: 5)
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba04a7895
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Ami2490/armeria.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba2947926
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/uci-inf-133/a1-personal-website-jimadiso.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbbf8ded7
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ItesiwajuTechnologies/landing-page.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522e51e933a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://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@github.com/sudheerpalyam/stackon-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe94634ec
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/kesavaram9751/Adithya-IAS-Academy.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227344c524
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/LifeSentences/asaphdesign.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65224bb95997
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/KAYTTAJA/erakkomaja.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb72ccaa03
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/minproducer/fbaiomod.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb6b2c5dbb
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/edwardlchiarini/wrtpros-report.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbf7c2fc1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Sindbadtrading/terminal-training.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7a3705b4
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/balkrishna62/todolist.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d34be60a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [submodule] active = . [remote "origin"] url = https://github.com/xNightW0lfz/before-disaster-game.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb086a4470
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:alexanderdevbr/docecor.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb6e13cece
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/vanilla-admin/R-Official.git fetch = +refs/heads/*:refs/remotes/origin/* [lfs] repositoryformatversion = 0 [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbf7c2fc1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Sindbadtrading/terminal-training.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbdea273c
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/xoanm520/btbi-portfolio.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a527a31a
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/alessiotecleme/personal-site.git fetch = +refs/heads/*:refs/remotes/origin/* [pull] rebase = false [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3fd7e735
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ad-seo/hakik-html.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main gk-merge-base = origin/main [branch "branch/dev"] vscode-merge-base = origin/main remote = origin merge = refs/heads/branch/dev gk-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1deb3730
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ad-seo/hakik-html.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "branch/dev_home"] vscode-merge-base = origin/main remote = origin merge = refs/heads/branch/dev_home [user] name = ParkSeokho email = psh9797@gmail.com
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbba4f6db5
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ad-seo/hakik-html.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "branch/dev_home"] vscode-merge-base = origin/main remote = origin merge = refs/heads/branch/dev_home
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb2d4d39e3
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ad-seo/hakik-html.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "branch/dev"] vscode-merge-base = origin/main remote = origin merge = refs/heads/branch/dev
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb06765211
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/drononsky-source/urbanmountainridefgfdgd.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8f5eb7c6
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = git@github.com:vishalmaurya850/JOB.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] vscode-merge-base = origin/master vscode-merge-base = origin/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652288447ae4
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/AlamGeeth/synsara-convergence.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main //# sourceMappingURL=data:application/json;base64,eyJ2ZXJzaW9uIjozLCJzb3VyY2VzIjpbImNvbmZpZyJdLCJzb3VyY2VzQ29udGVudCI6WyJbY29yZV1cblx0cmVwb3NpdG9yeWZvcm1hdHZlcnNpb24gPSAwXG5cdGZpbGVtb2RlID0gdHJ1ZVxuXHRiYXJlID0gZmFsc2Vcblx0bG9nYWxscmVmdXBkYXRlcyA9IHRydWVcbltyZW1vdGUgXCJvcmlnaW5cIl1cblx0dXJsID0gaHR0cHM6Ly9naXRodWIuY29tL0FsYW1HZWV0aC9zeW5zYXJhLWNvbnZlcmdlbmNlLmdpdFxuXHRmZXRjaCA9ICtyZWZzL2hlYWRzLyo6cmVmcy9yZW1vdGVzL29yaWdpbi8qXG5bYnJhbmNoIFwibWFpblwiXVxuXHRyZW1vdGUgPSBvcmlnaW5cblx0bWVyZ2UgPSByZWZzL2hlYWRzL21haW5cbiJdLCJuYW1lcyI6W10sIm1hcHBpbmdzIjoiQUFBQSxDQUFDLElBQUksQ0FBQztBQUNOLENBQUMsdUJBQXVCLENBQUMsQ0FBQyxDQUFDLENBQUM7QUFDNUIsQ0FBQyxRQUFRLENBQUMsQ0FBQyxDQUFDLElBQUk7QUFDaEIsQ0FBQyxJQUFJLENBQUMsQ0FBQyxDQUFDLEtBQUs7QUFDYixDQUFDLGdCQUFnQixDQUFDLENBQUMsQ0FBQyxJQUFJO0FBQ3hCLENBQUMsTUFBTSxDQUFDLENBQUMsTUFBTSxDQUFDLENBQUM7QUFDakIsQ0FBQyxHQUFHLENBQUMsQ0FBQyxDQUFDLEtBQUssQ0FBQyxDQUFDLENBQUMsTUFBTSxDQUFDLEdBQUcsQ0FBQyxTQUFTLENBQUMsT0FBTyxDQUFDLFdBQVcsQ0FBQyxHQUFHO0FBQzNELENBQUMsS0FBSyxDQUFDLENBQUMsQ0FBQyxDQUFDLElBQUksQ0FBQyxLQUFLLENBQUMsQ0FBQyxDQUFDLElBQUksQ0FBQyxPQUFPLENBQUMsTUFBTSxDQUFDLENBQUM7QUFDNUMsQ0FBQyxNQUFNLENBQUMsQ0FBQyxJQUFJLENBQUMsQ0FBQztBQUNmLENBQUMsTUFBTSxDQUFDLENBQUMsQ0FBQyxNQUFNO0FBQ2hCLENBQUMsS0FBSyxDQUFDLENBQUMsQ0FBQyxJQUFJLENBQUMsS0FBSyxDQUFDLElBQUk7In0=
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4bf7774b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/AlamGeeth/synsara-wait.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c24ef5f7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/pradipbhor/tikoneimportexport.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8924bb8a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Metta-Tony/Auston-Matthews-main.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228476af36
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/PouyanNorouzi/COMP4537_Lab00.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb51109190
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Dev2804D/telegram fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3506a784
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ProximaTerminal/comp-sh.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8ddf9d84
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ProximaTerminal/comp-sh.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522276606e7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:lsmucassi/mytasa.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb772030f6
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/SetMyWeb/MaALa.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf2943e71
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Laurab1528/VELAS.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb43f0ea0b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ad-seo/unam-xi.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "branch/psh_dev"] vscode-merge-base = origin/main remote = origin merge = refs/heads/branch/psh_dev gk-merge-base = origin/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbd3b6111
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ad-seo/unam-xi.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "branch/psh_dev_home"] vscode-merge-base = origin/main remote = origin merge = refs/heads/branch/psh_dev_home [user] name = ParkSeokho email = psh9797@gmail.com
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4158fc32
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ad-seo/unam-xi.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [branch "branch/psh_dev"] vscode-merge-base = origin/main remote = origin merge = refs/heads/branch/psh_dev
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb154397f8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/kurilpratik/TheFamilyTree.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb2e5fd2b9
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/davinciism/TheFamilyTree.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226249dde7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:ricardoasinr/vylandscaping.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0e145566
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/juancuevas-ops/tributarias.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb390c18b6
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/fycscoder/Rohiartandcraft.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1efe38fc
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [user] email = shubhamdixit2555 name = shubhamdixit2555 [remote "origin"] url = https://github.com/shubhamdixit2555/web_vanity_unity.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65221f873f02
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/ClementHerpe/maison-martine.com.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba0855f7b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/jeffwilleford3162-create/jeffwilleford3162-create.github.io.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbda037c8b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/Jay0588/Sparktrading-.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb23030047
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/411bz-com/noba.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65227c94c77e
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/stepdefreitaas/asdaos.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226da63f06
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/arunabha369/puja-parikrama.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0271438a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/ammitt23/virtul-Assitant.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb6e40e71a
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/imayushseth/the_heartbeat_of_varanasi.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba8caf359
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/shekhar-prateek/CertNinja.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbbf26d5d8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/macekq/ostravsky.guru.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4fbe3171
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/amazonxavante/Apiario-Ozoraide20.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin github-pr-base-branch = "amazonxavante#Apiario-Ozoraide20#main" merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbc91feaaa
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/haider32/TeknoTrail fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] vscode-merge-base = origin/main vscode-merge-base = origin/main remote = origin merge = refs/heads/main
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbadd83fa1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/haider32/TeknoTrail fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522d6cd3086
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/Pratyushsharma101/Plant-Disease-Recognition-System fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [lfs] repositoryformatversion = 0 [remote "upstream"] url = https://github.com/kumarvivek9088/Plant-Disease-Recognition-System.git fetch = +refs/heads/*:refs/remotes/upstream/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652207f7a896
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/davidsnyder-nc/fappr fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522a6951b5c
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/davidsnyder-nc/briefnews fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb9c2d8a3d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/elimtechlab/oasisspacreations.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master vscode-merge-base = origin/master [lfs] repositoryformatversion = 0 [remote "upstream"] url = https://github.com/JustGoodThemes/Scriptor-Jekyll-Theme.git fetch = +refs/heads/*:refs/remotes/upstream/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3cb0b2fe
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Plaziita/PlaziitaSite.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbf3ef7b58
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/bbcb0013/firefly-site.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652225bb7125
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true [remote "origin"] url = https://github.com/AL-Hareth/jcc_admin.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbb2712d65
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/dishastudioz/ds_underdev fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522f969a01f
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:Turistikus/turistikus_site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [user] email = johnnyfreirejh@hotmail.com name = johnnydev-tech
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb1df96d2d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/cyllene2301-art/birthday-countdown fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd8582856
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/hashirShahzad0070/0xmeme.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fbf3ed663c289bc8b7fefe8ff7fefe8ff
Found 3 files trough .DS_Store spidering: /index.html /js /styles.css
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
Severity: medium
Fingerprint: 5f32cf5d6962f09cfdf2c773fdf2c773c1fb76b642b467b2402b764d7542b993
Found 50 files trough .DS_Store spidering: /data /img /img/2022-10-18-XSD-ULT-01 /img/2022-10-19-XSD-ULT-01 /img/2022-10-30-XSD-ULT-02 /img/2023-01-07-XSD-ULT-01 /img/2023-03-03-XSD-ULT-01 /img/2023-03-05-XSD-ULT-01 /img/2023-07-06-XSD-ULT-01 /img/2023-07-07-manual /img/2023-07-08-manual /img/2023-07-15-XSD-ULT-01 /img/2023-08-09-XSD-ULT-01 /img/2023-08-11-XSD-ULT-01 /img/2023-08-15-XSD-ULT-01 /img/2023-08-20-XSD-ULT-01 /img/2023-09-09-XSD-ULT-01 /img/2023-09-30-manual /img/2023-10-08-XSD-ULT-01 /img/2024-01-13-XSD-ULT-01 /img/2024-01-28-XSD-UB343B-01 /img/2024-02-04-XSD-UB343B-01 /img/2024-04-14-XSD-UB343B-01 /img/2024-05-25-XSD-UB343B-01 /img/2024-05-26-XSD-UB343B-01 /img/2024-08-10-XSD-UB343B-01 /img/2024-08-11-XSD-UB343B-01 /img/2024-10-31-XSD-UB343B-01 /img/2024-12-30-XSD-UB343B-01 /img/2024-12-31-XSD-UB343B-01 /img/2024-12-31-XSD-UB343B-02 /img/2025-01-17-XSD-UB343B-02 /img/2025-02-02-XSD-UB343B-01 /img/2025-02-04-XSD-UB343B-01 /img/2025-02-15-XSD-UB343B-01 /img/2025-03-02-XSD-UB343B-01 /img/2025-03-19-XSD-UB343B-01 /img/2025-03-30-XSD-UB343B-01 /img/2025-04-11-XSD-UB343B-01 /img/2025-04-26-XSD-UB343B-01 /img/2025-05-10-XSD-UB343B-01 /img/2025-05-15-XSD-UB343B-01 /img/2025-05-18-XSD-UB343B-01 /img/2025-06-14-XSD-UB343B-02 /img/2025-07-05-XSD-UB343B-01 /img/2025-07-11-XSD-UB343B-01 /img/2025-08-06-XSD-UB343B-01 /img/2025-08-08-XSD-UB343B-01 /posts /site_libs
Severity: medium
Fingerprint: 5f32cf5d6962f09c1f1b52f11f1b52f1edfc79e4a5fc8e801033030f0d192175
Found 96 files trough .DS_Store spidering: /data /img /img/2022-10-18-XSD-ULT-01 /img/2022-10-19-XSD-ULT-01 /img/2022-10-30-XSD-ULT-02 /img/2023-01-07-XSD-ULT-01 /img/2023-03-03-XSD-ULT-01 /img/2023-03-05-XSD-ULT-01 /img/2023-07-06-XSD-ULT-01 /img/2023-07-07-manual /img/2023-07-08-manual /img/2023-07-15-XSD-ULT-01 /img/2023-08-09-XSD-ULT-01 /img/2023-08-11-XSD-ULT-01 /img/2023-08-15-XSD-ULT-01 /img/2023-08-20-XSD-ULT-01 /img/2023-09-09-XSD-ULT-01 /img/2023-09-30-manual /img/2023-10-08-XSD-ULT-01 /img/2024-01-13-XSD-ULT-01 /img/2024-01-28-XSD-UB343B-01 /img/2024-02-04-XSD-UB343B-01 /img/2024-04-14-XSD-UB343B-01 /img/2024-05-25-XSD-UB343B-01 /img/2024-05-26-XSD-UB343B-01 /img/2024-08-10-XSD-UB343B-01 /img/2024-08-11-XSD-UB343B-01 /img/2024-10-31-XSD-UB343B-01 /img/2024-12-30-XSD-UB343B-01 /img/2024-12-31-XSD-UB343B-01 /img/2024-12-31-XSD-UB343B-02 /img/2025-01-17-XSD-UB343B-02 /img/2025-02-02-XSD-UB343B-01 /img/2025-02-04-XSD-UB343B-01 /img/2025-02-15-XSD-UB343B-01 /img/2025-03-02-XSD-UB343B-01 /img/2025-03-19-XSD-UB343B-01 /img/2025-03-30-XSD-UB343B-01 /img/2025-04-11-XSD-UB343B-01 /img/2025-04-26-XSD-UB343B-01 /img/2025-05-10-XSD-UB343B-01 /img/2025-05-15-XSD-UB343B-01 /img/2025-05-18-XSD-UB343B-01 /img/2025-06-14-XSD-UB343B-02 /img/2025-07-05-XSD-UB343B-01 /img/2025-07-11-XSD-UB343B-01 /img/2025-08-06-XSD-UB343B-01 /img/2025-08-08-XSD-UB343B-01 /posts /posts/2022-10-18-XSD-ULT-01 /posts/2022-10-19-XSD-ULT-01 /posts/2022-10-30-XSD-ULT-02 /posts/2023-01-07-XSD-ULT-01 /posts/2023-03-03-XSD-ULT-01 /posts/2023-03-05-XSD-ULT-01 /posts/2023-07-06-XSD-ULT-01 /posts/2023-07-07-manual /posts/2023-07-08-manual /posts/2023-07-15-XSD-ULT-01 /posts/2023-08-09-XSD-ULT-01 /posts/2023-08-11-XSD-ULT-01 /posts/2023-08-15-XSD-ULT-01 /posts/2023-08-20-XSD-ULT-01 /posts/2023-09-09-XSD-ULT-01 /posts/2023-09-30-manual /posts/2023-10-08-XSD-ULT-01 /posts/2024-01-13-XSD-ULT-01 /posts/2024-01-28-XSD-UB343B-01 /posts/2024-02-04-XSD-UB343B-01 /posts/2024-04-14-XSD-UB343B-01 /posts/2024-05-25-XSD-UB343B-01 /posts/2024-05-26-XSD-UB343B-01 /posts/2024-08-10-XSD-UB343B-01 /posts/2024-08-11-XSD-UB343B-01 /posts/2024-10-31-XSD-UB343B-01 /posts/2024-12-30-XSD-UB343B-01 /posts/2024-12-31-XSD-UB343B-01 /posts/2024-12-31-XSD-UB343B-02 /posts/2025-01-17-XSD-UB343B-02 /posts/2025-02-02-XSD-UB343B-01 /posts/2025-02-04-XSD-UB343B-01 /posts/2025-02-15-XSD-UB343B-01 /posts/2025-03-02-XSD-UB343B-01 /posts/2025-03-19-XSD-UB343B-01 /posts/2025-03-30-XSD-UB343B-01 /posts/2025-04-11-XSD-UB343B-01 /posts/2025-04-26-XSD-UB343B-01 /posts/2025-05-10-XSD-UB343B-01 /posts/2025-05-15-XSD-UB343B-01 /posts/2025-05-18-XSD-UB343B-01 /posts/2025-06-14-XSD-UB343B-02 /posts/2025-07-05-XSD-UB343B-01 /posts/2025-07-11-XSD-UB343B-01 /posts/2025-08-06-XSD-UB343B-01 /posts/2025-08-08-XSD-UB343B-01 /site_libs
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbe20b5ebd
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Altaaf8901/flipscope-site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbec6e7e7d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [submodule] active = . [remote "origin"] url = https://github.com/LeChefVanDato/lechefvandato-site.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main [lfs] repositoryformatversion = 0
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522f42b1ea7
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/ankitind1/mathmulti.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7e1c4547
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Riaan0326/Venues777M.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652203d96b00
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/FAHAD-ALI-github/ExpertSkills--E-Learning-platfom.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb31fda115
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/HenryDc1/M-GDrywallConstrucciones.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8104bab3
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/4ndrrw/portfolio-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522c11c4dc3
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = git@github.com:rahul-jerthi/portfolio.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba6727cc5
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/echosenses-com/echosenses-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb661e3755
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/mak328/moderndeco.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb24af0376
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/yourusername/your-repo.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb09298498
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/kbabyyy13/thegreycanvas.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652297980aa4
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/XianPostsandTelecommunications/myself.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbba80955a1
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Langerud/WorkyStock.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main vscode-merge-base = origin/main [branch "deploy/stripe-coupon-feature"] remote = origin merge = refs/heads/deploy/stripe-coupon-feature
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb5253d045
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/fpexplanador2/deploy.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd4bdf12f
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/njugunakennedy/Coolclads.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Additionally the GIT credentials are present and could give unauthorized access to source code repository of private projects.
Severity: critical
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb0b5807e8
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://rvnthvrm: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@github.com/rvnthvrm/rvnthvrm.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb680bf4e9
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [lfs] repositoryformatversion = 0 [remote "origin"] url = https://github.com/Meliodas0511/-.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65229fdd3530
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/mattkoh98/urban-wash-hub.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbdadbe15b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/jdiego0102/codynex-landing.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main [user] name = jdiegodev email = j.diego010297@gmail.com [branch "ft/dev"] remote = origin merge = refs/heads/ft/dev vscode-merge-base = origin/ft/dev
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb89811874
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/spinalaidforrecovery/safr.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb7be452f5
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Farjaadrizvi110/GreenFix.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65225165923f
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/quasars-tech/udhaari-landing-page.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [pull] ff = only
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb68d5381d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Muneeb10/Akhuwat-Networks.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb3a6e4f38
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/soni434/sansafastener.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb18a39fe0
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/GokulRamesh00/tamilvanan-precision-craft.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb27af5944
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true ignorecase = true [remote "origin"] url = https://github.com/kurtisv/frontend.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb635986c3
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Mahavirmsme2025/mahavirmsme-website.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbbd40ef52e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/gabrielmbergamo/sabrinne.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb480c384d
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/YOUR_USERNAME/rust-store-automated.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65229c4aafed
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/bluesummitmedia/bluesummitmedia.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb887a028e
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/technext/mirko.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb8dc5444b
[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/lyarinet/bash-script-analyzer.git fetch = +refs/heads/*:refs/remotes/origin/*
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a652213978ce0
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/devharikaushik/vagus2025.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main vscode-merge-base = origin/main vscode-merge-base = origin/main [user] name = devharikaushik email = devharikaushik@gmail.com
The following URL (usually /.git/config) is publicly accessible and is leaking source code and repository configuration.
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65226b73945b
[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true ignorecase = true precomposeunicode = true [remote "origin"] url = https://github.com/Soumya26-nadgir/personal-website.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Open service 35.157.26.135:80 · auditvault.quantamind.co
2026-01-13 01:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:20:53 GMT Location: https://auditvault.quantamind.co/ Server: Netlify X-Nf-Request-Id: 01KETF21BW8FAHVC23W88Z4T47 Content-Length: 48 Connection: close Redirecting to https://auditvault.quantamind.co/
Open service 35.157.26.135:443 · auditvault.quantamind.co
2026-01-13 01:20
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 460
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:20:45 GMT
Etag: "efe83b72f791e06c7fb75983969b42f6-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETF1SM44T0EM7SCYJJZWBNN
Connection: close
Page title: quantamind-ui
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>quantamind-ui</title>
<script type="module" crossorigin src="/assets/index-tmARuzh0.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-BazWsrV-.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · mestream.io
2026-01-13 01:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:20:52 GMT Location: https://mestream.io/ Server: Netlify X-Nf-Request-Id: 01KETF20Z3MZCW2GW5MG59JRTE Content-Length: 35 Connection: close Redirecting to https://mestream.io/
Open service 35.157.26.135:443 · mestream.io
2026-01-13 01:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:20:44 GMT Location: https://www.mestream.io/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETF1S4X2QGDBZM5JPXQREXA Content-Length: 39 Connection: close Redirecting to https://www.mestream.io/
Open service 35.157.26.135:80 · sso-dev.kitesoft.xyz
2026-01-13 01:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:20:34 GMT Location: https://sso-dev.kitesoft.xyz/ Server: Netlify X-Nf-Request-Id: 01KETF1FMM6W5JCQR806BHS8ZF Content-Length: 44 Connection: close Redirecting to https://sso-dev.kitesoft.xyz/
Open service 35.157.26.135:443 · sso-dev.kitesoft.xyz
2026-01-13 01:20
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 475
Content-Security-Policy: default-src 'self'; script-src 'self' 'unsafe-inline' 'unsafe-eval' https://apis.google.com https://www.gstatic.com; style-src 'self' 'unsafe-inline' https://fonts.googleapis.com; font-src 'self' https://fonts.gstatic.com; img-src 'self' data: https://*.googleusercontent.com https://www.gstatic.com; connect-src 'self' https://auth-dev.kitesoft.xyz https://*.firebaseio.com https://*.googleapis.com https://identitytoolkit.googleapis.com https://securetoken.googleapis.com; frame-src https://nexbis-iam-dev.firebaseapp.com https://*.firebaseapp.com; frame-ancestors 'none'; form-action 'self'; base-uri 'self'; object-src 'none'
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:20:26 GMT
Etag: "fb28efff675074676fd42b515355fe19-ssl"
Permissions-Policy: accelerometer=(), camera=(), geolocation=(), gyroscope=(), magnetometer=(), microphone=(), payment=(), usb=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETF17RVXF6905QBDBKEE49C
X-Xss-Protection: 1; mode=block
Connection: close
Page title: Login
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<title>Login</title>
<base href="/" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<link rel="icon" type="image/x-icon" href="/favicon.ico" />
<script type="module" crossorigin src="/assets/index-ByDBh_Qg.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-LnK9jA-W.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.forexharmony.com
2026-01-13 01:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:20:25 GMT Location: https://www.forexharmony.com/ Server: Netlify X-Nf-Request-Id: 01KETF16S0CQV2SAK32QZS4XAW Content-Length: 44 Connection: close Redirecting to https://www.forexharmony.com/
Open service 35.157.26.135:443 · www.forexharmony.com
2026-01-13 01:20
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 10221 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 01:20:17 GMT Etag: "fe1c8617693d13ec94163c7415b695ea-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETF0YZD51239SFP545VPR9M Connection: close Page title: نغم التداول - منصة تحليل الأسواق المالية والعملات الرقمية <!DOCTYPE html> <html lang="ar" dir="rtl"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <link rel="icon" href="https://public-frontend-cos.metadl.com/mgx/img/favicon.png" type="image/png"> <!-- Primary Meta Tags --> <title>نغم التداول - منصة تحليل الأسواق المالية والعملات الرقمية</title> <meta name="title" content="نغم التداول - منصة تحليل الأسواق المالية والعملات الرقمية" /> <meta name="description" content="منصة شاملة لتحليل الأسواق المالية والعملات الرقمية مع تحليلات متقدمة وإشارات تداول دقيقة من خبراء معتمدين. احصل على تحليلات فنية وأساسية للبيتكوين والإيثيريوم وجميع العملات الرقمية." /> <meta name="keywords" content="تحليل مالي, عملات رقمية, بيتكوين, إيثيريوم, تداول, إشارات تداول, تحليل فني, تحليل أساسي, البورصة, الأسهم, الفوركس, العملات المشفرة, استثمار, محللين ماليين, توقعات السوق, رسوم بيانية, شارت, مؤشرات فنية, دعم ومقاومة, موجات إليوت, فيبوناتشي, RSI, MACD, المتوسطات المتحركة, حجم التداول, تقلبات السوق, إدارة المخاطر, استراتيجيات التداول, تعليم التداول, أخبار العملات الرقمية, تحديثات السوق, منصة تداول, وسيط مالي, تحليل اقتصادي, السوق السعودي, الأسواق العربية" /> <meta name="author" content="نغم التداول" /> <meta name="robots" content="index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1" /> <meta name="googlebot" content="index, follow" /> <meta name="language" content="Arabic" /> <meta name="revisit-after" content="1 day" /> <meta name="distribution" content="global" /> <meta name="rating" content="general" /> <!-- Canonical URL --> <link rel="canonical" href="https://naghamtrading.com/" /> <!-- Open Graph Meta Tags --> <meta property="og:type" content="website" /> <meta property="og:url" content="https://naghamtrading.com/" /> <meta property="og:title" content="نغم التداول - منصة تحليل الأسواق المالية والعملات الرقمية" /> <meta property="og:description" content="منصة شاملة لتحليل الأسواق المالية والعملات الرقمية مع تحليلات متقدمة وإشارات تداول دقيقة من خبراء معتمدين" /> <meta property="og:image" content="/images/financialanalysis.jpg" /> <meta property="og:image:width" content="1200" /> <meta property="og:image:height" content="630" /> <meta property="og:image:alt" content="نغم التداول - منصة تحليل الأسواق المالية" /> <meta property="og:locale" content="ar_SA" /> <meta property="og:site_name" content="نغم التداول" /> <meta property="article:author" content="نغم التداول" /> <meta property="article:publisher" content="https://www.facebook.com/naghamtrading" /> <!-- Twitter Card Meta Tags --> <meta name="twitter:card" content="summary_large_image" /> <meta name="twitter:site" content="@naghamtrading" /> <meta name="twitter:creator" content="@naghamtrading" /> <meta name="twitter:title" content="نغم التداول - منصة تحليل الأسواق المالية والعملات الرقمية" /> <meta name="twitter:description" content="منصة شاملة لتحليل الأسواق المالية والعملات الرقمية مع تحليلات متقدمة وإشارات تداول دقيقة" /> <meta name="twitter:image" content="/images/financialmarkets.jpg" /> <meta name="twitter:image:alt" content="نغم التداول - منصة تحل�
Open service 35.157.26.135:80 · www.prissnap.no
2026-01-13 01:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:20:25 GMT Location: https://www.prissnap.no/ Server: Netlify X-Nf-Request-Id: 01KETF15ZZDB6MT2VSYPBA8QW4 Content-Length: 39 Connection: close Redirecting to https://www.prissnap.no/
Open service 35.157.26.135:443 · www.prissnap.no
2026-01-13 01:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:20:17 GMT Location: https://prissnap.no/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETF0YHMB42KJEWY1G1EJ2DY Content-Length: 35 Connection: close Redirecting to https://prissnap.no/
Open service 35.157.26.135:80 · www.randallfx.com
2026-01-13 01:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:19:43 GMT Location: http://randallfx.com/ Server: Netlify X-Nf-Request-Id: 01KETEZXSNK1VCP4X9HEWWKCR9 Content-Length: 36 Connection: close Redirecting to http://randallfx.com/
Open service 35.157.26.135:443 · www.randallfx.com
2026-01-13 01:19
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1355
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:19:34 GMT
Etag: "14813d0537b549226c1c2a71b3854d65-ssl"
Server: Netlify
X-Nf-Request-Id: 01KETEZMRZ8BEMM0AD65MS48H5
Connection: close
Page title: Randall FX | Professional Pyrotechnics & Special Effects
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<link rel="icon" href="/favicon.png" type="image/png" />
<title>Randall FX | Professional Pyrotechnics & Special Effects</title>
<meta name="description" content="Randall FX provides professional pyrotechnics and special effects for film, TV, live events, and theatrical productions. Ignite your next project with us." />
<meta name="author" content="Randall FX" />
<meta property="og:title" content="Randall FX | Professional Pyrotechnics & Special Effects" />
<meta property="og:description" content="Creating spectacular moments that ignite imagination. Professional pyrotechnics for film, events, and more." />
<meta property="og:type" content="website" />
<meta property="og:image" content="https://lovable.dev/opengraph-image-p98pqg.png" />
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:site" content="@RandallFX" />
<meta name="twitter:image" content="https://lovable.dev/opengraph-image-p98pqg.png" />
<script type="module" crossorigin src="/assets/index-Bp47_oTN.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DldxwDA3.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.netviewtv.com
2026-01-13 01:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:19:19 GMT Location: https://netviewtv.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEZ6CZ9GZMA4H6KQKJ7E6H Content-Length: 37 Connection: close Redirecting to https://netviewtv.com/
Open service 35.157.26.135:80 · www.netviewtv.com
2026-01-13 01:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:19:27 GMT Location: https://www.netviewtv.com/ Server: Netlify X-Nf-Request-Id: 01KETEZDTEVTKVZKHRH5BPSENN Content-Length: 41 Connection: close Redirecting to https://www.netviewtv.com/
Open service 35.157.26.135:80 · www.semmanuel.com
2026-01-13 01:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:19:16 GMT Location: https://www.semmanuel.com/ Server: Netlify X-Nf-Request-Id: 01KETEZ3B3Y57MEG0VFCGCQQ7T Content-Length: 41 Connection: close Redirecting to https://www.semmanuel.com/
Open service 35.157.26.135:443 · www.semmanuel.com
2026-01-13 01:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:19:08 GMT Location: https://semmanuel.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEYV40VSXR8KZ7FMT11ABB Content-Length: 37 Connection: close Redirecting to https://semmanuel.com/
Open service 35.157.26.135:443 · animathio.com
2026-01-13 01:18
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 913
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:18:23 GMT
Etag: "51861496d543268412cfe596a424e749-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEXFJDFJDRFH44FA60AD55
Connection: close
Page title: AniMathIO
<!DOCTYPE html>
<html lang="en">
<head>
<base href="/" />
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<meta property="og:title" content="AniMathIO" />
<meta
property="og:image:alt"
content="AniMathIO is a video editor application for editing mathematical animations and videos."
/>
<meta
name="description"
content="AniMathIO is a video editor application for editing mathematical animations and videos."
/>
<meta name="keywords" content="video editor, mathematical animations" />
<title>AniMathIO</title>
<link rel="shortcut icon" type="png" href="img/AniMathIO.png" />
<script type="module" crossorigin src="/assets/index-D38O4wAi.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-C-TDeY61.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · animathio.com
2026-01-13 01:18
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:18:32 GMT Location: https://animathio.com/ Server: Netlify X-Nf-Request-Id: 01KETEXQTB13HJ4QYTC1XFS1CX Content-Length: 37 Connection: close Redirecting to https://animathio.com/
Open service 35.157.26.135:80 · valerie.blacktideagency.com
2026-01-13 01:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:17:20 GMT Location: https://valerie.blacktideagency.com/ Server: Netlify X-Nf-Request-Id: 01KETEVHFA1W2RVBY7N5YH1HP5 Content-Length: 51 Connection: close Redirecting to https://valerie.blacktideagency.com/
Open service 35.157.26.135:443 · valerie.blacktideagency.com
2026-01-13 01:17
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 771
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:17:12 GMT
Etag: "740b776940faa8324b2f9a42fa2b1a4c-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEVA4BEP5JGT1DGYZQQEF9
Connection: close
Page title: Do It Scared Coaching - Transform Your Potential with Valerie Maksym
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Do It Scared Coaching - Transform Your Potential with Valerie Maksym</title>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600;700&display=swap" rel="stylesheet">
<script type="module" crossorigin src="/assets/index-BUwUYxa5.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-L2Ri56Pe.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · arcfinder.co.uk
2026-01-13 01:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:17:08 GMT Location: https://arcfinder.co.uk/ Server: Netlify X-Nf-Request-Id: 01KETEV63260PAP2R8FXP1AP1G Content-Length: 39 Connection: close Redirecting to https://arcfinder.co.uk/
Open service 35.157.26.135:443 · arcfinder.co.uk
2026-01-13 01:16
HTTP/1.1 301 Moved Permanently Age: 3 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 37 Content-Security-Policy: default-src 'self'; script-src 'self' 'unsafe-inline' 'unsafe-eval' https://www.googletagmanager.com https://www.google-analytics.com https://static.hotjar.com https://script.hotjar.com https://snap.licdn.com https://googleads.g.doubleclick.net https://js.stripe.com; style-src 'self' 'unsafe-inline' https://fonts.googleapis.com; img-src 'self' data: https: blob:; font-src 'self' data: https://fonts.gstatic.com; connect-src 'self' https://*.culturedashboard.io https://*.culturedashboard.co.uk https://*.culturedashboard.co.za https://*.culturedashboard.eu https://*.arcfinder.org https://www.google-analytics.com https://region1.google-analytics.com https://www.google.com https://api.stripe.com https://*.sentry.io https://*.ingest.de.sentry.io https://px.ads.linkedin.com wss://ws.hotjar.com https://content.hotjar.io https://metrics.hotjar.io; frame-src 'self' https://www.googletagmanager.com https://outlook.office.com https://js.stripe.com https://hooks.stripe.com; frame-ancestors 'none'; base-uri 'self'; form-action 'self' https://outlook.office.com Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:17:00 GMT Location: https://arcfinder.org/ Permissions-Policy: geolocation=(), microphone=(), camera=() Referrer-Policy: strict-origin-when-cross-origin Server: Netlify Strict-Transport-Security: max-age=31536000 X-Content-Type-Options: nosniff X-Frame-Options: DENY X-Nf-Request-Id: 01KETETXRHKZ8PN9DYA8C4D2JY X-Xss-Protection: 1; mode=block Connection: close Redirecting to https://arcfinder.org/
Open service 35.157.26.135:443 · evergreenflooring1.com
2026-01-13 01:15
HTTP/1.1 200 OK
Age: 5180684
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 66043
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 01:15:49 GMT
Etag: "10cgkm8rnsl1ewo"
Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc,cookie=__prerender_bypass|__next_preview_data
Server: Netlify
Strict-Transport-Security: max-age=31536000
Vary: RSC,Next-Router-State-Tree,Next-Router-Prefetch
X-Content-Type-Options: nosniff
X-Nextjs-Date: Thu, 08 Jan 2026 21:03:01 GMT
X-Nf-Request-Id: 01KETERRXC3JZYP1FTMPMW9D4P
X-Powered-By: Next.js
Connection: close
Page title: Evergreen Flooring LLC | Flooring Installation & Repair in Bothell, WA
<!DOCTYPE html><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" as="image" imageSrcSet="/_next/image?url=%2Fbg-hero.jpg&w=640&q=75 640w, /_next/image?url=%2Fbg-hero.jpg&w=750&q=75 750w, /_next/image?url=%2Fbg-hero.jpg&w=828&q=75 828w, /_next/image?url=%2Fbg-hero.jpg&w=1080&q=75 1080w, /_next/image?url=%2Fbg-hero.jpg&w=1200&q=75 1200w, /_next/image?url=%2Fbg-hero.jpg&w=1920&q=75 1920w, /_next/image?url=%2Fbg-hero.jpg&w=2048&q=75 2048w, /_next/image?url=%2Fbg-hero.jpg&w=3840&q=75 3840w" imageSizes="100vw" fetchPriority="high"/><link rel="stylesheet" href="/_next/static/css/a472268ca0bb3f55.css" data-precedence="next"/><link rel="stylesheet" href="/_next/static/css/7362395042a375ed.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-90241e5e5edc9359.js"/><script src="/_next/static/chunks/fd9d1056-c176ba62bfa905c4.js" async=""></script><script src="/_next/static/chunks/23-d5406b024c78f417.js" async=""></script><script src="/_next/static/chunks/main-app-2cafe6b471aea5af.js" async=""></script><script src="/_next/static/chunks/0e5ce63c-15fb2cc9f8935882.js" async=""></script><script src="/_next/static/chunks/5e22fd23-1759e25f1680b973.js" async=""></script><script src="/_next/static/chunks/53c13509-e331967c9ca34d8d.js" async=""></script><script src="/_next/static/chunks/983-ba96c808ab9bed59.js" async=""></script><script src="/_next/static/chunks/999-3ee726a822bfc8ae.js" async=""></script><script src="/_next/static/chunks/109-d189284e4832a068.js" async=""></script><script src="/_next/static/chunks/app/page-2061c4d15ecc0ce9.js" async=""></script><script src="/_next/static/chunks/486-6eda655dc53078ff.js" async=""></script><script src="/_next/static/chunks/178-4d207a0f7a1c0001.js" async=""></script><script src="/_next/static/chunks/app/layout-c9fd9ebb2bc2af9b.js" async=""></script><title>Evergreen Flooring LLC | Flooring Installation & Repair in Bothell, WA</title><meta name="description" content="Evergreen Flooring LLC is a licensed flooring contractor in Bothell, WA. We install and repair hardwood, vinyl, laminate, and tile. Subfloor prep, baseboards, and trim. Family-owned with 20+ years of experience. Free estimates."/><meta name="keywords" content="flooring installation Bothell,floor repair Bothell,flooring contractor Bothell,vinyl plank installation,hardwood floor installer,tile flooring Bothell,subfloor leveling,baseboards and trim,flooring near me"/><meta name="robots" content="index, follow"/><meta name="googlebot" content="index, follow"/><link rel="canonical" href="https://evergreenflooring1.com"/><meta property="og:title" content="Evergreen Flooring LLC | Flooring Installation & Repair in Bothell, WA"/><meta property="og:description" content="Licensed Bothell flooring contractor for installation and repairs. Hardwood, vinyl, laminate, tile, subfloor prep, baseboards, and trim."/><meta property="og:url" content="https://evergreenflooring1.com"/><meta property="og:site_name" content="Evergreen Flooring LLC"/><meta property="og:locale" content="en_US"/><meta property="og:type" content="website"/><meta name="twitter:card" content="summary_large_image"/><meta name="twitter:title" content="Evergreen Flooring LLC | Flooring Installation & Repair in Bothell, WA"/><meta name="twitter:description" content="Professional flooring installation and repair in Bothell, WA. Clean workmanship and clear estimates."/><link rel="icon" href="/favicon.ico" type="image/x-icon" sizes="16x16"/><script src="/_next/static/chunks/polyfills-78c92fac7aa8fdd8.js" noModule=""></script></head><body class="antialiased"><script type="application/ld+json">{"@context":"https://schema.org","@type":"FlooringContractor","@id":"https://evergreenflooring1.com/#organization","name":"Evergreen Flooring LLC","url":"https://evergreenflooring1.com","email":"quote@evergreenfloring1.com","telephone":"+1-425-280-4583","image":"https://evergreenfloorin
Open service 35.157.26.135:80 · evergreenflooring1.com
2026-01-13 01:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:15:57 GMT Location: https://evergreenflooring1.com/ Server: Netlify X-Nf-Request-Id: 01KETES1022CTYBS8ZYZ0QRP3A Content-Length: 46 Connection: close Redirecting to https://evergreenflooring1.com/
Open service 35.157.26.135:80 · setifyu.com
2026-01-13 01:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:15:27 GMT Location: https://setifyu.com/ Server: Netlify X-Nf-Request-Id: 01KETER3VBMPT79VZ8R4R14C5X Content-Length: 35 Connection: close Redirecting to https://setifyu.com/
Open service 35.157.26.135:443 · setifyu.com
2026-01-13 01:15
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 573
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:15:19 GMT
Etag: "fa5dccd5b1f0c19bc3469d8eedad3d2c-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEQVAGVTXK47P3JMPZH279
Connection: close
Page title: Setify - Modern Fitness Planning
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Setify - Modern Fitness Planning</title>
<script type="module" crossorigin src="/assets/index-B9PY4zWH.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-BKV63JPp.css">
<script async src="https://bolt.new/badge.js?s=2a60e59c-5f40-43aa-aca1-042f176514f3"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · tesladogepro.com
2026-01-13 01:15
HTTP/1.1 200 OK Age: 74765 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Cache-Status: "Netlify Edge"; hit;detail=p1 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 01:15:12 GMT Etag: "4dz8xyrzyr22ua-df" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: rsc,next-router-state-tree,next-router-prefetch,next-router-segment-prefetch,Accept-Encoding X-Content-Type-Options: nosniff X-Nextjs-Date: Mon, 12 Jan 2026 04:43:44 GMT X-Nextjs-Prerender: 1, 1 X-Nextjs-Stale-Time: 300 X-Nf-Request-Id: 01KETEQMZTAV22SRP7A9JR0VYK X-Powered-By: Next.js Connection: close Transfer-Encoding: chunked
Open service 35.157.26.135:80 · tesladogepro.com
2026-01-13 01:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:15:20 GMT Location: https://tesladogepro.com/ Server: Netlify X-Nf-Request-Id: 01KETEQW65J8S3MY65DCYQMSVP Content-Length: 40 Connection: close Redirecting to https://tesladogepro.com/
Open service 35.157.26.135:443 · psychicgabby.com
2026-01-13 01:15
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 2206
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:15:09 GMT
Etag: "6ba857b164af50e6b3ce90a29348f3fd-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEQHK7FNC395JSEM8903MQ
Connection: close
Page title: Gabby Psychic Reading
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Gabby Psychic Reading</title>
<style>
body { font-family: Arial, sans-serif; margin: 0; padding: 0; background: #f5f5f5; }
header { background: #6a1b9a; color: white; padding: 40px 20px; text-align: center; }
header h1 { margin: 0; font-size: 2.5em; }
header p { margin-top: 10px; font-size: 1.2em; }
section { padding: 40px 20px; max-width: 800px; margin: auto; background: white; margin-top: 20px; border-radius: 8px; box-shadow: 0 0 10px rgba(0,0,0,0.1); }
h2 { color: #6a1b9a; }
.testimonial { margin-bottom: 20px; padding: 15px; background: #f0e6f8; border-radius: 5px; }
footer { text-align: center; padding: 20px; background: #6a1b9a; color: white; margin-top: 40px; }
a.button { display: inline-block; margin-top: 20px; padding: 15px 25px; background: #ab47bc; color: white; text-decoration: none; border-radius: 5px; font-weight: bold; }
a.button:hover { background: #8e24aa; }
</style>
<meta name="google-site-verification" content="gad7GimBTPPdFHKYYclme1bKyxECkVTL96xDo1i1gh0" /></head>
<body>
<header>
<h1>Gabby Psychic Reading</h1>
<p>Professional Psychic & Spiritual Guidance</p>
</header>
<section>
<h2>About Gabby</h2>
<p>Gabby is a trusted psychic reader providing deep insights and spiritual guidance to help you navigate love, relationships, and life decisions.</p>
</section>
<section>
<h2>Testimonials</h2>
<div class="testimonial">
<strong>Maria S.</strong><br>
"Gabby’s reading was incredibly accurate and gave me the clarity I needed to move forward."
</div>
<div class="testimonial">
<strong>James T.</strong><br>
"Her insight helped me through a tough time and opened new opportunities in my life."
</div>
</section>
<section style="text-align: center;">
<h2>Book Your Reading Today</h2>
<p>Call or text <strong>(626) 418-7493</strong> to schedule your personal session.</p>
<a class="button" href="tel:6264187493">Call Now</a>
</section>
<footer>
© 2025 Gabby Psychic Reading
</footer>
</body>
</html>
Open service 35.157.26.135:80 · psychicgabby.com
2026-01-13 01:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:15:16 GMT Location: https://psychicgabby.com/ Server: Netlify X-Nf-Request-Id: 01KETEQRR8VRKSNQQD7DNNB466 Content-Length: 40 Connection: close Redirecting to https://psychicgabby.com/
Open service 35.157.26.135:443 · www.leadspeed.site
2026-01-13 01:13
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 577
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:13:56 GMT
Etag: "0462f87bb0ae67750d8d4acc06c97d44-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETENAD4Y5DS556RR7VTGYT9
Connection: close
Page title: LeadSpeed AI - Real Estate Accelerator
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/png" href="/2 copy.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>LeadSpeed AI - Real Estate Accelerator</title>
<script type="module" crossorigin src="/assets/index-CS0-pN1r.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-Bpnj_ZLk.css">
<script async src="https://bolt.new/badge.js?s=71a051e2-a257-4fc9-a283-f70317800b8a"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.leadspeed.ai
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:55 GMT Location: https://leadspeed.ai/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEN9GKMFZ3TDCF6QC622KS Content-Length: 36 Connection: close Redirecting to https://leadspeed.ai/
Open service 35.157.26.135:80 · www.leadspeed.ai
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:14:03 GMT Location: https://www.leadspeed.ai/ Server: Netlify X-Nf-Request-Id: 01KETENHCNMKPHYC27GVJNXD47 Content-Length: 40 Connection: close Redirecting to https://www.leadspeed.ai/
Open service 35.157.26.135:80 · www.leadspeed.site
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:14:03 GMT Location: https://www.leadspeed.site/ Server: Netlify X-Nf-Request-Id: 01KETENH93XNMZ7HDMQ35ZB4VK Content-Length: 42 Connection: close Redirecting to https://www.leadspeed.site/
Open service 35.157.26.135:443 · www.jade19.com
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:34 GMT Location: https://jade19.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEMN0T20WQTYG916HQNDA8 Content-Length: 34 Connection: close Redirecting to https://jade19.com/
Open service 35.157.26.135:80 · www.jade19.com
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:42 GMT Location: https://www.jade19.com/ Server: Netlify X-Nf-Request-Id: 01KETEMX4CZM5NW9JNQQ0MMAH1 Content-Length: 38 Connection: close Redirecting to https://www.jade19.com/
Open service 35.157.26.135:443 · www.shanthionlinegold.com
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:33 GMT Location: https://shanthionlinegold.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEMM6Y37E0X8CXFWB9T96F Content-Length: 45 Connection: close Redirecting to https://shanthionlinegold.com/
Open service 35.157.26.135:80 · aspire.carecycle.ai
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:43 GMT Location: https://aspire.carecycle.ai/ Server: Netlify X-Nf-Request-Id: 01KETEMXBY8D1S7SJ7Z7V4TKW5 Content-Length: 43 Connection: close Redirecting to https://aspire.carecycle.ai/
Open service 35.157.26.135:443 · aspire.carecycle.ai
2026-01-13 01:13
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 668
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:13:34 GMT
Etag: "169691693fc61a832580675cd0b25d6a-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEMN6TB0JJMXSP1WH2GBMD
Connection: close
Page title: careCycle Retention Suite Proposal - Interactive Webpage
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<link rel="stylesheet" href="https://use.typekit.net/hdj3ocu.css">
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>careCycle Retention Suite Proposal - Interactive Webpage</title>
<script type="module" crossorigin src="/assets/index-OyE7ugZM.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-Cg0whz1I.css">
<script async src="https://bolt.new/badge.js?s=c1a12a1b-0ab2-4a76-b17c-509c9169d95b"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.shanthionlinegold.com
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:41 GMT Location: https://www.shanthionlinegold.com/ Server: Netlify X-Nf-Request-Id: 01KETEMW12D2PVFXGW1BX6C06Z Content-Length: 49 Connection: close Redirecting to https://www.shanthionlinegold.com/
Open service 35.157.26.135:443 · tracuuhanhchinh.vn
2026-01-13 01:13
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 16558
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:13:32 GMT
Etag: "db377261f287278406699332cfaa20d7-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEMJM8W5W4AYSD2X6VXDC9
Connection: close
Page title: Cổng thông tin Hành chính Việt Nam
<!DOCTYPE html>
<html lang="vi">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Cổng thông tin Hành chính Việt Nam</title>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Be+Vietnam+Pro:wght@300;400;500;700&display=swap"
rel="stylesheet">
<link rel="stylesheet" href="https://unpkg.com/leaflet@1.9.4/dist/leaflet.css" />
<link rel="stylesheet" href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/6.5.2/css/all.min.css" />
<link rel="stylesheet" href="style.css">
<link rel="stylesheet" href="chatbot.css">
<link rel="manifest" href="manifest.json">
</head>
<body>
<header class="site-header-main">
<div class="container header-container">
<div class="logo">
<a href='/'>
<img src="images/logo.png" alt="Logo" class="header-logo-img">
<span class="logo-text-shine">Tra cứu Hành chính VN</span>
</a>
</div>
<div id="province-selector-container" class="province-selector-container">
</div>
<nav class="main-nav">
<ul id="main-nav-links">
<li><a href='/'>Trang chủ</a></li>
<li><a href="#" id="explore-province-culture-btn" title="Khám phá văn hóa của tỉnh"> Khám Phá VH</a></li>
<li><a href='/thong-tin'>Tin tức</a></li>
<li><a id="portal-link" href="https://chinhphu.vn/" target="_blank">Cổng thông tin</a></li>
<li><a href='/nguon-thong-tin'>Về dữ liệu</a></li>
<li><a href='/ve-chung-toi'>Tác giả</a></li>
</ul>
</nav>
<button id="hamburger-btn" class="hamburger-btn">
<span class="hamburger-icon"></span>
</button>
</div>
</header>
<main class="site-main">
<div class="container-wide">
<div class="main-layout">
<div class="map-container">
<section class="map-section card">
<h2><i class="fa-regular fa-map"></i> Bản đồ hành chính</h2>
<img id="staticMapImage" src="images/vietnam.jpg"
alt="Bản đồ hành chính - Vui lòng chọn tỉnh để xem chi tiết">
<div class="map-buttons-wrapper">
<button id="showInteractiveMapBtn" class="map-button">
<i class="fa-solid fa-up-right-from-square"></i> Mở Bản đồ Tương tác
</button>
</div>
</section>
</div>
<div class="search-container">
<section class="search-section card">
<h2><i class="fa-solid fa-magnifying-glass"></i> Tra cứu chi tiết</h2>
<div class="search-options">
<label>
<input type="radio" name="searchMode" id="searchCommune" value="commune" checked>
<span>Tra cứu Xã/Phường</span>
</label>
<label>
<input type="radio" name="searchMode" id="searchProvince" value="province">
<span>Tra cứu Tỉnh/Thành phố</span>
</label>
<label>
<input type="radio" name="searchMode" id="searchCulture" value="culture">
<span>Tra cứu Văn hóa</span>
<span id="cultureLoadingSpinner" class="culture-loading-spinner hidden
Open service 35.157.26.135:80 · tracuuhanhchinh.vn
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:40 GMT Location: https://tracuuhanhchinh.vn/ Server: Netlify X-Nf-Request-Id: 01KETEMTHRFJRBY1SX17BG1S90 Content-Length: 42 Connection: close Redirecting to https://tracuuhanhchinh.vn/
Open service 35.157.26.135:443 · sparkgames.live
2026-01-13 01:13
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3625
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:13:28 GMT
Etag: "98af73eccc2997f8402f058e6bc58b33-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEMFBD5ERSW07ZESXWNQJN
Connection: close
Page title: Coming soon on SparkGames
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<title>Coming soon on SparkGames</title>
<link href="https://fonts.googleapis.com/css2?family=Orbitron&display=swap" rel="stylesheet" />
<style>
@font-face {
font-family: 'Garet';
src: url('Garet-Regular.ttf') format('truetype');
font-weight: normal;
font-style: normal;
}
* {
margin: 0;
padding: 0;
box-sizing: border-box;
}
body {
background-color: #000;
color: #00bfff;
font-family: 'Segoe UI', Tahoma, Geneva, Verdana, sans-serif;
display: flex;
justify-content: center;
align-items: center;
height: 100vh;
overflow: hidden;
position: relative;
}
.rain {
position: absolute;
width: 100%;
height: 100%;
top: 0;
left: 0;
overflow: hidden;
z-index: 0;
}
.drop {
position: absolute;
bottom: 100%;
width: 2px;
height: 60px;
background: rgba(0, 191, 255, 0.5);
animation: fall linear infinite;
}
@keyframes fall {
to {
transform: translateY(110vh);
opacity: 0;
}
}
.container {
z-index: 1;
text-align: center;
background: rgba(0, 191, 255, 0.05);
padding: 10px 20px;
border: 2px solid rgba(0, 191, 255, 0.2);
border-radius: 20px;
box-shadow: 0 0 30px rgba(0, 191, 255, 0.2);
max-width: 400px;
width: 90%;
}
.coming-soon {
font-family: 'Orbitron', sans-serif;
font-size: 1.2rem;
color: #00bfff;
margin-bottom: 15px;
animation: glowPulse 2s ease-in-out infinite;
}
.logo {
max-width: 100%;
height: auto;
margin-bottom: 10px;
}
.loader {
width: 100px;
height: 5px;
margin: 10px auto 20px auto;
background: #00bfff;
animation: pulse 1.5s infinite ease-in-out;
border-radius: 5px;
}
@keyframes pulse {
0%, 100% {
opacity: 0.1;
}
50% {
opacity: 1;
}
}
.powered {
font-family: 'Orbitron', sans-serif;
font-size: 1.2rem;
margin-top: 0;
color: #00bfff;
animation: glowPulse 2s ease-in-out infinite;
}
@keyframes glowPulse {
0%, 100% {
text-shadow:
0 0 5px #00bfff,
0 0 10px #00bfff,
0 0 20px #00bfff,
0 0 40px #00bfff;
}
50% {
text-shadow:
0 0 2px #00bfff,
0 0 5px #00bfff,
0 0 10px #00bfff,
0 0 20px #00bfff;
}
}
</style>
</head>
<body>
<div class="rain" id="rain"></div>
<div class="container">
<div class="coming-soon">Coming soon</div>
<img class="logo" src="LogoText.png" alt="SparkGames Logo" />
<div class="loader"></div>
<div class="powered">Gaming is global. So are we.</div>
</div>
<script>
const rainContainer = document.getElementById('rain');
const drops = 100;
for (let i = 0; i < drops; i++) {
const drop = document.createElement('div');
drop.classList.add('drop');
drop.style.left = Math.random() * 100 + 'vw';
drop.style.animationDuration = (Math.random() * 1 + 1) + 's';
drop.style.animationDelay = Math.random() * 2 + 's';
rainContainer.appendChild(drop);
}
</script>
</body>
</html>
Open service 35.157.26.135:80 · sparkgames.live
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:36 GMT Location: https://sparkgames.live/ Server: Netlify X-Nf-Request-Id: 01KETEMPZZ1NVFND39W4WNH6R7 Content-Length: 39 Connection: close Redirecting to https://sparkgames.live/
Open service 35.157.26.135:443 · www.badhaiplay.com
2026-01-13 01:13
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 601
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:13:14 GMT
Etag: "c92e809064818e3427d0a8f41ba9c0d9-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEM126774XMX3Z16038S4B
Connection: close
Page title: BadhaiPlay Interactive Greeting Cards App
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/png" href="/Logo_01_BadhaiPlay Logo_1st.PNG" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>BadhaiPlay Interactive Greeting Cards App</title>
<script type="module" crossorigin src="/assets/index-CHZ4FpK9.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-KZ5UAxnj.css">
<script async src="https://bolt.new/badge.js?s=e6deb008-6839-440c-aa95-00c6da4951a4"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.badhaiplay.com
2026-01-13 01:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:21 GMT Location: https://www.badhaiplay.com/ Server: Netlify X-Nf-Request-Id: 01KETEM8DFT28YK8WBC3GPBKQQ Content-Length: 42 Connection: close Redirecting to https://www.badhaiplay.com/
Open service 35.157.26.135:80 · www.novexconsulting.com
2026-01-13 01:12
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:09 GMT Location: https://www.novexconsulting.com/ Server: Netlify X-Nf-Request-Id: 01KETEKWZV8RMECCC1YWVD3CRX Content-Length: 47 Connection: close Redirecting to https://www.novexconsulting.com/
Open service 35.157.26.135:443 · www.novexconsulting.com
2026-01-13 01:12
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:13:02 GMT Location: https://novexconsulting.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEKNK0P1W3AVVNPTJPKCG0 Content-Length: 43 Connection: close Redirecting to https://novexconsulting.com/
Open service 35.157.26.135:443 · www.wwcompliance.com
2026-01-13 01:12
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:12:35 GMT Location: https://wwcompliance.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEJVEEWHZ1DSZ90AF9C7GP Content-Length: 40 Connection: close Redirecting to https://wwcompliance.com/
Open service 35.157.26.135:80 · www.wwcompliance.com
2026-01-13 01:12
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:12:42 GMT Location: https://www.wwcompliance.com/ Server: Netlify X-Nf-Request-Id: 01KETEK2MZFWBMHXGAVCF1KMXC Content-Length: 44 Connection: close Redirecting to https://www.wwcompliance.com/
Open service 35.157.26.135:443 · www.compose.diamonds
2026-01-13 01:12
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:12:34 GMT Location: https://compose.diamonds/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEJTF2E6QS9CSZ2DWBF75S Content-Length: 40 Connection: close Redirecting to https://compose.diamonds/
Open service 35.157.26.135:80 · www.compose.diamonds
2026-01-13 01:12
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:12:43 GMT Location: https://www.compose.diamonds/ Server: Netlify X-Nf-Request-Id: 01KETEK2ZQ0GE6961NDHG2HZZV Content-Length: 44 Connection: close Redirecting to https://www.compose.diamonds/
Open service 35.157.26.135:80 · compose.diamonds
2026-01-13 01:12
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:12:42 GMT Location: https://compose.diamonds/ Server: Netlify X-Nf-Request-Id: 01KETEK295J36E2MZ5AVG8ENRJ Content-Length: 40 Connection: close Redirecting to https://compose.diamonds/
Open service 35.157.26.135:443 · app.catination.com
2026-01-13 01:12
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1579
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:12:25 GMT
Etag: "b280d576bc14fc3c81a2c576b9dd6d8b-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEJHRGYKJN6PPWMA1YHRKG
Connection: close
Page title: Catination
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta
name="viewport"
content="width=device-width, initial-scale=1, viewport-fit=cover"
/>
<title>Catination</title>
<!-- Favicon -->
<link rel="icon" href="/favicon.ico" />
<!-- Icons (FontAwesome) -->
<link
rel="stylesheet"
href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/6.4.0/css/all.min.css"
/>
<!-- Tailwind -->
<script src="https://cdn.tailwindcss.com"></script>
<!-- ----------------------- -->
<!-- PWA Manifest & Theme -->
<!-- ----------------------- -->
<link rel="manifest" href="/manifest.json" />
<meta name="theme-color" content="#4C0073" />
<!-- ----------------------- -->
<!-- iOS PWA Fullscreen Mode -->
<!-- ----------------------- -->
<meta name="apple-mobile-web-app-capable" content="yes" />
<meta name="mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-status-bar-style" content="black-translucent" />
<meta name="apple-mobile-web-app-title" content="Catination" />
<link rel="apple-touch-icon" href="/catination-app-logo.png" />
<link rel="apple-touch-startup-image" href="/catination-app-logo.png" />
<script type="module" crossorigin src="/assets/index-BnSDzSSw.js"></script>
</head>
<body>
<!-- React App Root -->
<div id="root"></div>
<!-- Main Entry Script -->
<!-- DO NOT register service worker here -->
<!-- SW registration is handled inside React (App.jsx) -->
</body>
</html>
Open service 35.157.26.135:80 · www.404cne.com.ar
2026-01-13 01:11
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:20 GMT Location: https://www.404cne.com.ar/ Server: Netlify X-Nf-Request-Id: 01KETEGHWEMYDVKB1Q1FV1EYEV Content-Length: 41 Connection: close Redirecting to https://www.404cne.com.ar/
Open service 35.157.26.135:443 · www.radlinguist.com
2026-01-13 01:11
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:10 GMT Location: https://radlinguist.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEG8H5KCN25S2TGZ0G63ZM Content-Length: 39 Connection: close Redirecting to https://radlinguist.com/
Open service 35.157.26.135:80 · www.radlinguist.com
2026-01-13 01:11
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:18 GMT Location: https://www.radlinguist.com/ Server: Netlify X-Nf-Request-Id: 01KETEGGB76V24RR7E2QH18188 Content-Length: 43 Connection: close Redirecting to https://www.radlinguist.com/
Open service 35.157.26.135:80 · 404cne.com.ar
2026-01-13 01:11
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:18 GMT Location: https://404cne.com.ar/ Server: Netlify X-Nf-Request-Id: 01KETEGGEF06EYE5HTR6NG5AC8 Content-Length: 37 Connection: close Redirecting to https://404cne.com.ar/
Open service 35.157.26.135:443 · 404cne.com.ar
2026-01-13 01:11
HTTP/1.1 200 OK Age: 89 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 60410 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:11 GMT Etag: "q6fk703nri1adm" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: RSC,Next-Router-State-Tree,Next-Router-Prefetch,Accept-Encoding X-Content-Type-Options: nosniff X-Nextjs-Date: Tue, 13 Jan 2026 01:11:08 GMT X-Nf-Request-Id: 01KETEG8WZ1SD2BATF19Z1M2WJ X-Powered-By: Next.js Connection: close Page title: ERROR 404 CONEXIÓN NO ENCONTRADA - Psicología, historias reales y conversaciones sin caretas <!DOCTYPE html><html lang="es" class="scroll-smooth"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/6c25f6e897d845a3-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/e4af272ccee01ff0-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" as="image" imageSrcSet="/_next/image?url=%2Fheader.png&w=64&q=75 1x, /_next/image?url=%2Fheader.png&w=128&q=75 2x" fetchPriority="high"/><link rel="preload" as="image" imageSrcSet="/_next/image?url=%2Flogo.jpg&w=640&q=75 1x, /_next/image?url=%2Flogo.jpg&w=828&q=75 2x" fetchPriority="high"/><link rel="stylesheet" href="/_next/static/css/f3fa5dfd5abcc635.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-cad3cddb4b951cae.js"/><script src="/_next/static/chunks/fd9d1056-87da80e0c187477b.js" async=""></script><script src="/_next/static/chunks/117-baab43fc83142998.js" async=""></script><script src="/_next/static/chunks/main-app-f1e2f05f66ca4fbd.js" async=""></script><script src="/_next/static/chunks/726-a584457244464de2.js" async=""></script><script src="/_next/static/chunks/app/page-613a5ac3499272a4.js" async=""></script><script src="/_next/static/chunks/app/layout-f73e58d5c8cb3237.js" async=""></script><link rel="icon" type="image/x-icon" href="/favicons/favicon.ico"/><link rel="icon" type="image/png" sizes="16x16" href="/favicons/favicon-16x16.png"/><link rel="icon" type="image/png" sizes="32x32" href="/favicons/favicon-32x32.png"/><link rel="icon" type="image/png" sizes="48x48" href="/favicons/favicon-48x48.png"/><link rel="icon" type="image/png" sizes="64x64" href="/favicons/favicon-64x64.png"/><link rel="icon" type="image/png" sizes="128x128" href="/favicons/favicon-128x128.png"/><link rel="icon" type="image/png" sizes="256x256" href="/favicons/favicon-256x256.png"/><link rel="icon" type="image/png" sizes="512x512" href="/favicons/favicon-512x512.png"/><link rel="apple-touch-icon" sizes="57x57" href="/favicons/apple-touch-icon-57x57.png"/><link rel="apple-touch-icon" sizes="114x114" href="/favicons/apple-touch-icon-114x114.png"/><link rel="apple-touch-icon" sizes="120x120" href="/favicons/apple-touch-icon-120x120.png"/><link rel="apple-touch-icon" sizes="180x180" href="/favicons/apple-touch-icon.png"/><title>ERROR 404 CONEXIÓN NO ENCONTRADA - Psicología, historias reales y conversaciones sin caretas</title><meta name="description" content="Programa de streaming sobre psicología, historias reales y conversaciones sin caretas. Jueves 19:30 hs. #Psicologia #Error404ConexionNoEncontrada #expectativa"/><meta name="keywords" content="Error 404 Conexión No Encontrada,psicología,streaming,podcast,conversaciones"/><meta property="og:title" content="ERROR 404 CONEXIÓN NO ENCONTRADA - Psicología, historias reales y conversaciones sin caretas"/><meta property="og:description" content="Programa de streaming sobre psicología, historias reales y conversaciones sin caretas. Jueves 19:30 hs."/><meta property="og:locale" content="es_AR"/><meta property="og:type" content="website"/><meta name="twitter:card" content="summary_large_image"/><meta name="twitter:title" content="ERROR 404 CONEXIÓN NO ENCONTRADA"/><meta name="twitter:description" content="Psicología, historias reales y conversaciones sin caretas"/><meta name="next-size-adjust"/><script src="/_next/static/chunks/polyfills-42372ed130431b0a.js" noModule=""></script></head><body class="__variable_f367f3 __variable_d758cf font-sans bg-cne-black text-cne-white antialiased"><nav class="fixed top-0 left-0 right-0 z-50 transition-all duration-300 bg-cne-black/95 backdrop-blur-md"><div class="container mx-auto px-4 sm:px-6 lg:px-8"><div class="flex items-center justify-between h-20"><a class="flex items-center gap-2 sm:gap-3 font-display text-base sm:text-lg md:text-xl font-bold text-cne-yellow hover:text-cne-white transition-colors" href="#hero"><img alt="ERROR 404 Logo" fetchPriorit
Open service 35.157.26.135:443 · www.404cne.com.ar
2026-01-13 01:11
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:10 GMT Location: https://404cne.com.ar/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEG8CCZN0HDJRCYSNS8TJS Content-Length: 37 Connection: close Redirecting to https://404cne.com.ar/
Open service 35.157.26.135:443 · srecanrodjendanrebice.live
2026-01-13 01:10
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 14
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 5771
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:10:56 GMT
Etag: "250115484d410e94342f746fe874e407-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEFTRDNXAP1HX63RX1ATRV
Connection: close
Page title: Srećan rođendan Rebice!
<!DOCTYPE html>
<html lang="sr">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no">
<title>Srećan rođendan Rebice!</title>
<link rel="stylesheet" href="style.css">
</head>
<body>
<div class="container">
<!-- Intro slide -->
<section class="slide intro-slide" data-slide="0">
<div class="intro-content">
<p class="subtitle">Jedan sasvim običan dan<br>u životu Rebice hehe</p>
<div class="scroll-hint">
<span>→</span>
</div>
</div>
</section>
<!-- Slide 1: Jutro - Teretana -->
<section class="slide" data-slide="1">
<div class="slide-label">☀️ jutro</div>
<div class="image-container" data-audio="audio/1-jutro.mp3">
<img src="images/1-jutro.png" alt="Jutro">
</div>
<button class="audio-button" data-audio="audio/1-jutro.mp3">
<span class="btn-text">stisni me da čuješ sliku 🔊</span>
</button>
<p class="caption">Treba fitnes trener biti, uzimati pre-workout i piti Nocco</p>
</section>
<!-- Slide 2: Pre podne - B2B -->
<section class="slide" data-slide="2">
<div class="slide-label">💼 pre podne</div>
<div class="image-container" data-audio="audio/2-prepodne.mp3">
<img src="images/2-prepodne.png" alt="Pre podne">
</div>
<button class="audio-button" data-audio="audio/2-prepodne.mp3">
<span class="btn-text">stisni me da čuješ sliku 🔊</span>
</button>
<p class="caption">Kad je b2b mora da se radi hehehe</p>
</section>
<!-- Slide 3: Pauza - MaxBet -->
<section class="slide" data-slide="3">
<div class="slide-label">☕ pauza</div>
<div class="image-container" data-audio="audio/3-pauza.mp3">
<img src="images/3-pauza.png" alt="Pauza">
</div>
<button class="audio-button" data-audio="audio/3-pauza.mp3">
<span class="btn-text">stisni me da čuješ sliku 🔊</span>
</button>
<p class="caption">Ako igraš da dobiješ, ne možeš dobiti hehehe</p>
</section>
<!-- Slide 4: Rekreacija - Bicikl -->
<section class="slide" data-slide="4">
<div class="slide-label">🚴 popodnevna rekreacija</div>
<div class="image-container" data-audio="audio/4-rekreacija.mp3">
<img src="images/4-rekreacija.png" alt="Rekreacija">
</div>
<button class="audio-button" data-audio="audio/4-rekreacija.mp3">
<span class="btn-text">stisni me da čuješ sliku 🔊</span>
</button>
<p class="caption">U životu ima samo uspona a Padova je grad u Italiji</p>
</section>
<!-- Slide 5: Posle posla - Rakija -->
<section class="slide" data-slide="5">
<div class="slide-label">🍻 posle posla</div>
<div class="image-container" data-audio="audio/4-posleposla.mp3">
<img src="images/4-posleposla.png" alt="Posle posla">
</div>
<button class="audio-button" data-audio="audio/4-posleposla.mp3">
<span class="btn-text">stisni me da čuješ sliku 🔊</span>
</button>
<p class="caption">Jebao vas epam, jedva sam dočekao da odem hehe. Dobra rakija Prika, al bolje B traka.</p>
</section>
<!-- Slide 6: Pred spavanje - Harry Potter -->
<section class="slide" data-slide="6">
<div class="slide-label">🌙 pred spavanje</div>
<div class="image-container" data-audio="audio/6-spavanje.mp3">
<img src="images/6-spavanje.png" alt="Pred spavanje">
</div>
<button class="audio-button" data-audio="audio/6-spavanje.mp3">
<span class="btn-text"
Open service 35.157.26.135:80 · srecanrodjendanrebice.live
2026-01-13 01:10
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:04 GMT Location: https://srecanrodjendanrebice.live/ Server: Netlify X-Nf-Request-Id: 01KETEG2KXWCZ5R0C942GGTM1K Content-Length: 50 Connection: close Redirecting to https://srecanrodjendanrebice.live/
Open service 35.157.26.135:80 · www.nfda.org.ng
2026-01-13 01:10
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:11:02 GMT Location: https://www.nfda.org.ng/ Server: Netlify X-Nf-Request-Id: 01KETEG0ENTDEW1BV056DME1PC Content-Length: 39 Connection: close Redirecting to https://www.nfda.org.ng/
Open service 35.157.26.135:443 · www.nfda.org.ng
2026-01-13 01:10
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:10:52 GMT Location: https://nfda.org.ng/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEFQ4XGTCHZRTRYQ1BSV3S Content-Length: 35 Connection: close Redirecting to https://nfda.org.ng/
Open service 35.157.26.135:443 · www.monarktek.io
2026-01-13 01:09
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:09:47 GMT Location: https://monarktek.io/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETEDQ3BK1TN6DVFZWV5E9WV Content-Length: 36 Connection: close Redirecting to https://monarktek.io/
Open service 35.157.26.135:443 · monarktek.io
2026-01-13 01:09
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1457
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:09:46 GMT
Etag: "eeef54965012235d56251a776f17728f-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEDPPRH488NZA4SVMK9Q71
Connection: close
Page title: Monarktek Corporation - MilyMe App
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<link rel="icon" href="/assets/favicon-BEfTeT4Z.png" type="image/png">
<title>Monarktek Corporation - MilyMe App</title>
<meta name="description" content="Bringing back community - Revolutionizing local connections through AI-powered community building. MilyMe connects people for gigs, projects, events, and meaningful relationships." />
<meta name="author" content="Monarktek Corporation" />
<meta property="og:title" content="Monarktek Corporation - MilyMe App" />
<meta property="og:description" content="Bringing back community - Revolutionizing local connections through AI-powered community building. MilyMe connects people for gigs, projects, events, and meaningful relationships." />
<meta property="og:type" content="website" />
<meta property="og:image" content="/lovable-uploads/990d59cd-78ac-4d13-805b-2e39f743a77b.png" />
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:site" content="@lovable_dev" />
<meta name="twitter:image" content="/lovable-uploads/990d59cd-78ac-4d13-805b-2e39f743a77b.png" />
<script type="module" crossorigin src="/assets/index-DPJWKyvf.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-UoFPAlR4.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · monarktek.io
2026-01-13 01:09
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:09:54 GMT Location: https://monarktek.io/ Server: Netlify X-Nf-Request-Id: 01KETEDY9YWE63800QCVRKY91V Content-Length: 36 Connection: close Redirecting to https://monarktek.io/
Open service 35.157.26.135:80 · www.monarktek.io
2026-01-13 01:09
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:09:55 GMT Location: https://www.monarktek.io/ Server: Netlify X-Nf-Request-Id: 01KETEDZ2SG9K3ZYBGB57VXR4R Content-Length: 40 Connection: close Redirecting to https://www.monarktek.io/
Open service 35.157.26.135:443 · renansapia.adv.br
2026-01-13 01:09
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 55333
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:09:13 GMT
Etag: "6a8091d176021cefa7f6ddba2603ea55-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETECPD6RMQHZS4FXEW7HC45
Connection: close
Page title: Advocacia | Defesa de Direitos Trabalhistas e Previdenciários
<!DOCTYPE html><html lang="pt-BR" class="scroll-smooth"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/0484562807a97172-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/b957ea75a84b6ea7-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/eafabf029ad39a43-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="stylesheet" href="/_next/static/css/1a52e1a61f278f9c.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-4b5ff8d359dde197.js"/><script src="/_next/static/chunks/4bd1b696-a25418325034b528.js" async=""></script><script src="/_next/static/chunks/684-93ef5381cf46565f.js" async=""></script><script src="/_next/static/chunks/main-app-9f4f66c0efa5e0b9.js" async=""></script><script src="/_next/static/chunks/802-d69ef10db5f70343.js" async=""></script><script src="/_next/static/chunks/app/layout-c08cc7339329ed7c.js" async=""></script><script src="/_next/static/chunks/660-e3b168940032c45d.js" async=""></script><script src="/_next/static/chunks/app/page-9b21887f09fe5a83.js" async=""></script><meta name="next-size-adjust" content=""/><title>Advocacia | Defesa de Direitos Trabalhistas e Previdenciários</title><meta name="description" content="Advogado especialista em direito trabalhista e previdenciário. Defesa de seus direitos com seriedade e competência."/><link rel="icon" href="/favicon.ico" type="image/x-icon" sizes="16x16"/><script>document.querySelectorAll('body link[rel="icon"], body link[rel="apple-touch-icon"]').forEach(el => document.head.appendChild(el))</script><script src="/_next/static/chunks/polyfills-42372ed130431b0a.js" noModule=""></script></head><body class="__className_44151c antialiased"><div hidden=""><!--$--><!--/$--></div><div class="flex flex-col min-h-dvh bg-background"><header class="sticky top-0 z-50 w-full bg-background text-foreground shadow-md"><div class="container mx-auto flex h-20 items-center justify-between px-4"><a class="flex items-center gap-2 font-bold text-lg" href="/"><svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="lucide lucide-scale h-6 w-6 text-primary"><path d="m16 16 3-8 3 8c-.87.65-1.92 1-3 1s-2.13-.35-3-1Z"></path><path d="m2 16 3-8 3 8c-.87.65-1.92 1-3 1s-2.13-.35-3-1Z"></path><path d="M7 21h10"></path><path d="M12 3v18"></path><path d="M3 7h2c2 0 5-1 7-2 2 1 5 2 7 2h2"></path></svg><span>Renan Sapia | Advocacia</span></a><nav class="hidden md:flex items-center space-x-6 text-sm font-medium"><a class="transition-colors hover:text-primary" href="#">Início</a><a class="transition-colors hover:text-primary" href="#practice-areas">Áreas de Atuação</a><a class="transition-colors hover:text-primary" href="#about">Sobre</a><a class="transition-colors hover:text-primary" href="#contact">Contato</a></nav><div class="md:hidden"><button class="inline-flex items-center justify-center gap-2 whitespace-nowrap rounded-md text-sm font-medium ring-offset-background transition-colors focus-visible:outline-none focus-visible:ring-2 focus-visible:ring-ring focus-visible:ring-offset-2 disabled:pointer-events-none disabled:opacity-50 [&_svg]:pointer-events-none [&_svg]:size-4 [&_svg]:shrink-0 hover:bg-accent hover:text-accent-foreground h-10 w-10" type="button" aria-haspopup="dialog" aria-expanded="false" aria-controls="radix-«R1lrb»" data-state="closed"><svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="lucide lucide-menu h-6 w-6"><line x1="4" x2="20" y1="12" y2="12"></line><line x1="4" x2="20" y1="6" y2="6"></line><line x1="4" x2="20" y1="18" y2="18"></line></svg><span class="sr-only">Abrir menu</span></button></div></div></header><main class
Open service 35.157.26.135:80 · renansapia.adv.br
2026-01-13 01:09
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:09:21 GMT Location: https://renansapia.adv.br/ Server: Netlify X-Nf-Request-Id: 01KETECY8DX4B0HBP6DCYCMET5 Content-Length: 41 Connection: close Redirecting to https://renansapia.adv.br/
Open service 35.157.26.135:80 · avocatclaudiaonica.ro
2026-01-13 01:09
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:09:17 GMT Location: https://avocatclaudiaonica.ro/ Server: Netlify X-Nf-Request-Id: 01KETECTAQB3MD6H9724W0CWB9 Content-Length: 45 Connection: close Redirecting to https://avocatclaudiaonica.ro/
Open service 35.157.26.135:443 · avocatclaudiaonica.ro
2026-01-13 01:09
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 755
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:09:10 GMT
Etag: "1ff8e2b9c3f50666df0623c162542bb4-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETECKH0AN6GGFBRQRJ50FEG
Connection: close
Page title: Claudia-Anca Onica - Avocat definitiv Timișoara
<!doctype html>
<html lang="ro">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Claudia-Anca Onica - Avocat definitiv Timișoara</title>
<meta name="description" content="Cabinet Avocat Claudia-Anca Onica - Avocat definitiv cu 10+ ani experiență în Timișoara. Servicii juridice premium: drept civil, penal, familiei, comercial, executare silită, dreptul muncii." />
<script type="module" crossorigin src="/assets/index-DCiCe2OD.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DkCcGROv.css">
</head>
<body class="theme--xlight">
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · controlprenataltijuana.com
2026-01-13 01:08
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 17275
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:08:26 GMT
Etag: "20861ff0fcd54ca801effaf16ddc37c6-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEB8BQQWBA74H9WBYS71KT
Connection: close
Page title: Dr. Jaime Rivera | Ginecología y Obstetricia
<!DOCTYPE html>
<html lang="es" class="scroll-smooth">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Dr. Jaime Rivera | Ginecología y Obstetricia</title>
<!-- Tailwind CSS (Estilos) -->
<script src="https://cdn.tailwindcss.com"></script>
<!-- Iconos Lucide -->
<script src="https://unpkg.com/lucide@latest"></script>
<!-- Fuente Google -->
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;600;700&display=swap" rel="stylesheet">
<style>
body { font-family: 'Inter', sans-serif; }
.fade-in { animation: fadeIn 0.5s ease-out forwards; }
@keyframes fadeIn { from { opacity: 0; transform: translateY(10px); } to { opacity: 1; transform: translateY(0); } }
</style>
</head>
<body class="bg-slate-50 text-slate-700 selection:bg-rose-200">
<!-- Navbar -->
<nav class="bg-white/90 backdrop-blur-md sticky top-0 z-50 border-b border-rose-100 shadow-sm">
<div class="max-w-6xl mx-auto px-4 py-4 flex justify-between items-center">
<div class="flex items-center gap-2">
<i data-lucide="heart" class="text-rose-400 fill-rose-400 w-6 h-6"></i>
<div class="flex flex-col">
<span class="text-lg font-bold text-slate-800 leading-tight">Dr. Jaime Rivera</span>
<span class="text-xs text-rose-500 font-medium tracking-wide">Ginecología y Obstetricia</span>
</div>
</div>
<div class="hidden md:flex gap-8 text-sm font-medium text-slate-500">
<a href="#inicio" class="hover:text-rose-400 transition-colors">Inicio</a>
<a href="#trimestres" class="hover:text-rose-400 transition-colors">Etapas</a>
<a href="#calculadora" class="hover:text-rose-400 transition-colors">Calculadora</a>
<a href="#contacto" class="hover:text-rose-400 transition-colors">Contacto</a>
</div>
<a href="https://www.doctoralia.com.mx/jaime-raul-rivera-cordova/ginecologo/tijuana" target="_blank" class="bg-rose-400 text-white px-5 py-2 rounded-full text-sm hover:bg-rose-500 transition-all shadow-md shadow-rose-200 font-medium">
Agendar Cita
</a>
</div>
</nav>
<!-- Hero -->
<header id="inicio" class="relative pt-20 pb-32 px-4 bg-gradient-to-b from-rose-50 via-white to-slate-50 overflow-hidden">
<div class="absolute top-0 right-0 -mr-20 -mt-20 w-96 h-96 bg-teal-50 rounded-full blur-3xl opacity-60"></div>
<div class="absolute bottom-0 left-0 -ml-20 -mb-20 w-80 h-80 bg-rose-100 rounded-full blur-3xl opacity-60"></div>
<div class="max-w-4xl mx-auto text-center relative z-10">
<span class="inline-block py-1 px-3 rounded-full bg-rose-100 text-rose-500 text-xs font-bold tracking-wider mb-6">
CONTROL PRENATAL INTEGRAL
</span>
<h1 class="text-5xl md:text-6xl font-bold text-slate-800 mb-6 leading-tight">
Cuidando el milagro de la vida, <br/>
<span class="text-transparent bg-clip-text bg-gradient-to-r from-rose-400 to-rose-600">paso a paso.</span>
</h1>
<p className="text-lg text-slate-500 mb-10 max-w-2xl mx-auto leading-relaxed">
Un embarazo saludable comienza con el mejor cuidado. Acompañamiento profesional y humano para ti y tu bebé.
</p>
<div class="flex flex-col sm:flex-row justify-center gap-4">
<a href="#trimestres" class="flex items-center justify-center gap-2 bg-slate-800 text-white px-8 py-3 rounded-full hover:bg-slate-700 transition-all shadow-lg hover:shadow-xl hover:-translate-y-1">
Ver Etapas <i data-lucide="chevron-down" class="w-4 h-4"></i>
</a>
<a href="#calculadora" class="flex items-center justify-center gap-2 bg-white text-slate-700 border border-slate-200 px
Open service 35.157.26.135:80 · controlprenataltijuana.com
2026-01-13 01:08
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:08:34 GMT Location: https://controlprenataltijuana.com/ Server: Netlify X-Nf-Request-Id: 01KETEBGAYHZ3C95VP4PEN7N6V Content-Length: 50 Connection: close Redirecting to https://controlprenataltijuana.com/
Open service 35.157.26.135:80 · goodvibesonly.software
2026-01-13 01:07
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:08:03 GMT Location: https://goodvibesonly.software/ Server: Netlify X-Nf-Request-Id: 01KETEAHSAW1D7W8DTF6BVTMSJ Content-Length: 46 Connection: close Redirecting to https://goodvibesonly.software/
Open service 35.157.26.135:443 · goodvibesonly.software
2026-01-13 01:07
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 893
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:07:54 GMT
Etag: "1845cb915aa8682f76fda25d1c0103d3-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETEA9C4HZEYG5Z6A9FW8E3M
Connection: close
Page title: Good Vibes Only Software
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<title>Good Vibes Only Software</title>
<meta name="description" content="Good Vibes Only Software — software and app development." />
<link rel="stylesheet" href="assets/css/styles.css" />
</head>
<body>
<header class="header">
<h1>Good Vibes Only Software</h1>
<p>Software & App Development</p>
</header>
<main class="hero">
<h2>Clean software. Calm vibes.</h2>
<p>We design and build modern software and applications with clarity, performance, and good energy.</p>
<a class="cta" href="mailto:vibes@goodvibesonly.software">Contact us</a>
</main>
<footer class="footer">
<p>© <span id="year"></span> Good Vibes Only Software LLC</p>
</footer>
<script src="assets/js/main.js"></script>
</body>
</html>
Open service 35.157.26.135:80 · dennistretyakov.com
2026-01-13 01:07
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:07:59 GMT Location: https://dennistretyakov.com/ Server: Netlify X-Nf-Request-Id: 01KETEADE5H8GDRN3Q4R2GHTJH Content-Length: 43 Connection: close Redirecting to https://dennistretyakov.com/
Open service 35.157.26.135:443 · dennistretyakov.com
2026-01-13 01:07
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 5295
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:07:50 GMT
Etag: "001ecce0f45a97358e4cb08aa23ee483-ssl"
Referrer-Policy: same-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETEA4V1B6VZ7MJPG5JXWEGA
X-Xss-Protection: 1; mode=block
Connection: close
Page title: Dennis Tretyakov
<!DOCTYPE html><html lang="en"><head><meta charSet="UTF-8"/><meta name="viewport" content="width=device-width, initial-scale=1.0"/><link rel="preload" as="image" imageSrcSet="/assets/a758bca59b2682235b263ab6119f3d92247521a9.64.webp 64w, /assets/a758bca59b2682235b263ab6119f3d92247521a9.256.webp 256w, /assets/a758bca59b2682235b263ab6119f3d92247521a9.512.webp 512w"/><script async="" src="https://www.googletagmanager.com/gtag/js?id=G-MQ3SQHEQ6G"></script><title>Dennis Tretyakov</title><meta name="description" content="Dennis Tretyakov - Software Architect, Full-stack Developer and Consultant"/><link rel="preconnect" href="https://fonts.googleapis.com"/><link rel="preconnect" href="https://fonts.gstatic.com" crossorigin=""/><link rel="icon" href="/assets/a758bca59b2682235b263ab6119f3d92247521a9.256.png"/><script>window.dataLayer = window.dataLayer || []; function gtag(){dataLayer.push(arguments);} gtag('js', new Date()); gtag('config', 'G-MQ3SQHEQ6G');</script><link href="https://fonts.googleapis.com/css2?family=Lato:ital,wght@0,400;0,700;1,400;1,700&family=Neuton:wght@700&display=swap" rel="stylesheet"/><script type="module" src="/assets/index-Yb9owMdr.js"></script><link rel="stylesheet" href="/assets/index-DhxCwUyh.css"/></head><body><main class="_home_pqusx_1"><header><span class="_img_1vwyi_1" style="max-width:512px;max-height:100vh"><span class="_plh_1vwyi_6" style="padding-top:100%;background-image:url(data:image/webp;base64,UklGRp4BAABXRUJQVlA4WAoAAAAQAAAAHwAAHwAAQUxQSNcAAAABgFPb1vLo/t9X/3XAAaeMm99QooAcoQuGCueDO/DTHQURocBtG2VMx/AI5DCxQCNbrm8h3NbLrAHYBGVoDPrLOyNzGHlf9mFMCVik0zcZXCALPb2nKWwJd3YMPmcXTB+468AWeHygy1mlhuNhnCOD/p6eNdBz34dBgnT1x/VolSIxmNCxJjpOYDB6MNaFyMcImP3p+mqG9vlP11fndsZAAQOzOZ0CjvOVKlYXRgUiL4EiBh10Ry/RO9LPRT9X/V7o90q/l/q9lt+F/K7kdym/6//5F+R/BQBWUDggoAAAALAFAJ0BKiAAIAA/OYy8Vi8pJiOwGAgB4CcJaQAIEC6PFq10GNOHGB2V7lVxCp8E6Ghlpa4IAAD++b2AZM9e4NpVOMogrrP0hiv4Jd0Q6H2bEq95wLGpG4zgKf8fBklPMwbimrXl9sIoO4nuOTkqOh4uCG3deB8EKAu/fs3vbpS4iadsWH6THhNwYeLS/V7ghV4AlT469MXQUlBYWdgAAAA=)"><img src="/assets/a758bca59b2682235b263ab6119f3d92247521a9.512.webp" srcSet="/assets/a758bca59b2682235b263ab6119f3d92247521a9.64.webp 64w, /assets/a758bca59b2682235b263ab6119f3d92247521a9.256.webp 256w, /assets/a758bca59b2682235b263ab6119f3d92247521a9.512.webp 512w" alt="D" style="margin-top:-100%"/></span></span></header><h1>Dennis Tretyakov</h1><p>Software Architect, Full-stack Developer, and Consultant</p><p>I do software since early 2000s, typically in React / .NET ecosystems . I'm a big fan of <a href="https://cleancoders.com/" target="_blank">clean coders</a>, <abbr title="Test Driven Development">TDD</abbr> and Agile.</p><p>You can find me on <a target="_blank" href="https://www.linkedin.com/in/dennistretyakov">Linked In</a> or drop me a line to <a href="mailto:tretyakov@live.com">tretyakov@live.com</a>.</p><p>At the moment I work for <a href="https://www.ctco.lv/" target="_blank">C.T.Co</a>.</p><h2>blog</h2><ul class="_postLinks_pqusx_23"><li><a href="/key-vault-for-aspnet-core-app-secrets-on-azure-and-local-dev-env" data-discover="true">Key Vault for aspnet core app secrets on Azure and local dev environment</a></li><li><a href="/graphql-subscriptions-with-hot-chocolate" data-discover="true">GraphQL subscriptions with HotChocolate</a></li><li><a href="/sse-cost-efficient-real-time-updates-for-web-apps" data-discover="true">Server-Sent Events — cost-efficient real time updates for web apps</a></li><li><a href="/csharp-primary-constructors-and-gc" data-discover="true">C# Primary Constructor and Garbage Collector concern</a></li><li><a href="/walk-through-creating-first-azure-function-with-dotnet" data-discover="true">Walk-through creating first azure function with dotnet</a></li><li><a href="/id-token-validation-in-dotnet" data-discover="true">ID Token validation in dotnet</a></li><li><a href="/writing-first-roslyn-analyzer-and-codefix-provider" data-discover="true">Writing first Roslyn Analyzer and CodeFix Provider</a></li><li><a href="/a-cleaner-way-for-configuring-di-container-in-dotnet-with-service-annotations" data-
Open service 35.157.26.135:80 · www.qubithr.io
2026-01-13 01:05
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:05:49 GMT Location: https://www.qubithr.io/ Server: Netlify X-Nf-Request-Id: 01KETE6ESJBAKA6H7AEGV11FM8 Content-Length: 38 Connection: close Redirecting to https://www.qubithr.io/
Open service 35.157.26.135:443 · www.qubithr.io
2026-01-13 01:05
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:05:39 GMT Location: https://qubithr.io/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE65D46H94226N3YB68J5Q Content-Length: 34 Connection: close Redirecting to https://qubithr.io/
Open service 35.157.26.135:80 · www.cost5d.com
2026-01-13 01:05
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:05:29 GMT Location: https://www.cost5d.com/ Server: Netlify X-Nf-Request-Id: 01KETE5V9KEQC49SYW1GKHT635 Content-Length: 38 Connection: close Redirecting to https://www.cost5d.com/
Open service 35.157.26.135:443 · www.cost5d.com
2026-01-13 01:05
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:05:20 GMT Location: https://cost5d.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE5JBY263PDCPEXJJJEXYP Content-Length: 34 Connection: close Redirecting to https://cost5d.com/
Open service 35.157.26.135:80 · vaultoapp.com
2026-01-13 01:04
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:05:02 GMT Location: https://vaultoapp.com/ Server: Netlify X-Nf-Request-Id: 01KETE517M772RVW3S76VXM0S1 Content-Length: 37 Connection: close Redirecting to https://vaultoapp.com/
Open service 35.157.26.135:443 · vaultoapp.com
2026-01-13 01:04
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 15757
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:04:54 GMT
Etag: "48dafabd5e9d92b841e794c1a5fa160f-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE4SFWDZA4WMFX7NVE51JD
Connection: close
Page title: Vaulto — Insurance Made Simple
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<meta name="description" content="Vaulto helps you store, view, and track your insurance policies in one place. Read-only. No advice. No selling.">
<title>Vaulto — Insurance Made Simple</title>
<link rel="icon" type="image/png" href="assets/vaulto-logo.png">
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Libre+Baskerville:ital,wght@0,400;0,700;1,400&family=Inter:wght@400;500;600&display=swap" rel="stylesheet">
<link rel="stylesheet" href="styles.css">
</head>
<body>
<!-- Header with gold band -->
<header class="header">
<div class="header-container">
<a href="/" class="logo">
<img src="assets/vaulto-logo.png" alt="Vaulto" class="logo-image">
<span class="logo-text">Vaulto</span>
</a>
<nav class="nav">
<a href="#features" class="nav-link">Features</a>
<a href="#how-it-works" class="nav-link">How It Works</a>
<a href="#pricing" class="nav-link">Pricing</a>
<a href="https://app.vaultoapp.com" class="nav-cta">Open Dashboard</a>
</nav>
<button class="mobile-menu-btn" aria-label="Menu">
<span></span>
<span></span>
<span></span>
</button>
</div>
</header>
<!-- Mobile Navigation -->
<div class="mobile-nav">
<a href="#features" class="mobile-nav-link">Features</a>
<a href="#how-it-works" class="mobile-nav-link">How It Works</a>
<a href="#pricing" class="mobile-nav-link">Pricing</a>
<a href="https://app.vaultoapp.com" class="mobile-nav-cta">Open Dashboard</a>
</div>
<!-- Hero Section -->
<section class="hero">
<div class="hero-container">
<div class="trust-badge">
<svg class="trust-icon" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2">
<rect x="3" y="11" width="18" height="11" rx="2" ry="2"></rect>
<path d="M7 11V7a5 5 0 0 1 10 0v4"></path>
</svg>
<span>Read-only. No advice. No selling.</span>
</div>
<h1 class="hero-headline">Insurance Made Simple</h1>
<p class="hero-subheadline">Vaulto helps you store, view, and track your insurance policies in one place.</p>
<a href="https://app.vaultoapp.com" class="hero-cta">Open Dashboard</a>
</div>
</section>
<!-- Features Section -->
<section id="features" class="features">
<div class="container">
<div class="section-header">
<h2 class="section-title">Everything in One Place</h2>
<p class="section-subtitle">A clear, organised view of your insurance policies — nothing more, nothing less.</p>
</div>
<div class="features-grid">
<div class="feature-card">
<div class="feature-icon">
<svg viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2">
<path d="M14 2H6a2 2 0 0 0-2 2v16a2 2 0 0 0 2 2h12a2 2 0 0 0 2-2V8z"></path>
<polyline points="14 2 14 8 20 8"></polyline>
<line x1="16" y1="13" x2="8" y2="13"></line>
<line x1="16" y1="17" x2="8" y2="17"></line>
<polyline points="10 9 9 9 8 9"></polyline>
</svg>
</div>
<h3 class="feature-title">Policy Overview</h3>
<p class="feature-description">View all your insurance policies at a glance. Provider names, policy numbers, coverage amounts, and renewal dates — clearly organised.</p>
</div>
<div class="feature-card">
<div class="feature-icon">
<svg viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2">
<path d="M21 15v4a2 2 0 0 1-2 2H5a2 2 0 0 1-2-2v-4"></path>
<polyline points="17 8 12 3 7 8"></polyline>
<line x1="12" y1="3" x2="12" y2="15"></line>
</svg>
</div>
<h3 class="feature-title">Docume
Open service 35.157.26.135:80 · jmlha.com
2026-01-13 01:04
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:45 GMT Location: https://jmlha.com/ Server: Netlify X-Nf-Request-Id: 01KETE4G6AJGM5BQ3DJ0VKXW3Q Content-Length: 33 Connection: close Redirecting to https://jmlha.com/
Open service 35.157.26.135:443 · jmlha.com
2026-01-13 01:04
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1781
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:04:37 GMT
Etag: "b645558575ceb0f151c67abc97dff383-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE48848G8DEW3MCMVPM138
Connection: close
Page title: تطبيق الطلبات
<!doctype html>
<html lang="ar" dir="rtl">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/icon.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0, viewport-fit=cover" />
<meta name="theme-color" content="#16a34a" />
<meta name="description" content="تطبيق طلب الطعام والوجبات" />
<!-- PWA Configuration -->
<link rel="manifest" href="/manifest.json" />
<link rel="apple-touch-icon" href="/icon-192.png" />
<link rel="apple-touch-icon" sizes="192x192" href="/icon-192.png" />
<link rel="apple-touch-icon" sizes="512x512" href="/icon-512.png" />
<!-- iOS Specific -->
<meta name="apple-mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-status-bar-style" content="default" />
<meta name="apple-mobile-web-app-title" content="الطلبات" />
<!-- Android Specific -->
<meta name="mobile-web-app-capable" content="yes" />
<title>تطبيق الطلبات</title>
<script type="module" crossorigin src="/assets/index-3v0wA4mS.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DL6vmtzn.css">
<script async src="https://bolt.new/badge.js?s=c3ed6df6-0785-420a-804a-9bc654af7c94"></script></head>
<body>
<div id="root"></div>
<script>
if ('serviceWorker' in navigator) {
window.addEventListener('load', () => {
navigator.serviceWorker.register('/sw.js')
.then((registration) => {
console.log('ServiceWorker registered:', registration);
})
.catch((error) => {
console.log('ServiceWorker registration failed:', error);
});
});
}
</script>
</body>
</html>
Open service 35.157.26.135:80 · bellyfullwellness.com
2026-01-13 01:04
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:17 GMT Location: https://bellyfullwellness.com/ Server: Netlify X-Nf-Request-Id: 01KETE3NDZFZ61GWPHE21BSB94 Content-Length: 45 Connection: close Redirecting to https://bellyfullwellness.com/
Open service 35.157.26.135:443 · bellyfullwellness.com
2026-01-13 01:04
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3580
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:04:09 GMT
Etag: "1df59c10ce0c31cbe31d2789cbdd9415-ssl"
Permissions-Policy: camera=(), microphone=(), geolocation=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETE3DPYY3VFW7XRAG8PNC25
X-Xss-Protection: 1; mode=block
Connection: close
Page title: BellyFull Wellness - Natural Wellness & Peptide Enhancement
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/heart.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- Resource Hints -->
<link rel="preconnect" href="https://fonts.googleapis.com" />
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin />
<link rel="preconnect" href="https://res.cloudinary.com" />
<link rel="dns-prefetch" href="https://www.googletagmanager.com" />
<!-- Primary Meta Tags -->
<title>BellyFull Wellness - Natural Wellness & Peptide Enhancement</title>
<meta name="title" content="BellyFull Wellness - Natural Wellness & Peptide Enhancement" />
<meta name="description" content="Discover optimized wellness with BellyFull. Natural supplements including peptide enhancement, cellular support, appetite control, and comprehensive multivitamins for complete health." />
<meta name="keywords" content="wellness supplements, peptide enhancement, cellular health, appetite control, recovery support, natural supplements, holistic wellness, multivitamin, metabolic support" />
<meta name="author" content="BellyFull Wellness" />
<meta name="robots" content="index, follow" />
<!-- Canonical URL -->
<link rel="canonical" href="https://bellyfullwellness.com/" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://bellyfullwellness.com/" />
<meta property="og:title" content="BellyFull Wellness - Natural Wellness & Peptide Enhancement" />
<meta property="og:description" content="Discover optimized wellness with BellyFull. Natural supplements including peptide enhancement, cellular support, appetite control, and comprehensive multivitamins for complete health." />
<meta property="og:image" content="https://bellyfullwellness.com/image.png" />
<meta property="og:site_name" content="BellyFull Wellness" />
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image" />
<meta property="twitter:url" content="https://bellyfullwellness.com/" />
<meta property="twitter:title" content="BellyFull Wellness - Natural Wellness & Peptide Enhancement" />
<meta property="twitter:description" content="Discover optimized wellness with BellyFull. Natural supplements including peptide enhancement, cellular support, appetite control, and comprehensive multivitamins for complete health." />
<meta property="twitter:image" content="https://bellyfullwellness.com/image.png" />
<!-- Fonts with display=swap for performance -->
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700&display=swap" rel="stylesheet">
<!-- Google tag (gtag.js) - Deferred for performance -->
<script defer src="https://www.googletagmanager.com/gtag/js?id=G-QXNE90FDMS"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-QXNE90FDMS');
</script>
<script type="module" crossorigin src="/assets/index-BnHNxtMq.js"></script>
<link rel="modulepreload" crossorigin href="/assets/react-vendor-DmVfbTbk.js">
<link rel="modulepreload" crossorigin href="/assets/data-vendor-BbUuvexb.js">
<link rel="modulepreload" crossorigin href="/assets/ui-vendor-BR7mc8FX.js">
<link rel="stylesheet" crossorigin href="/assets/index-NfQhEyl_.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · esprevia.com
2026-01-13 01:04
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:03 GMT Location: https://www.esprevia.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE37729S43WY62230PZQPH Content-Length: 40 Connection: close Redirecting to https://www.esprevia.com/
Open service 35.157.26.135:80 · esprevia.com
2026-01-13 01:04
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:10 GMT Location: https://esprevia.com/ Server: Netlify X-Nf-Request-Id: 01KETE3DVXGFVT2P892SPWFGAN Content-Length: 36 Connection: close Redirecting to https://esprevia.com/
Open service 35.157.26.135:443 · moshtube.com
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 393
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:58 GMT
Etag: "7cc2aee9a6194b48845b0f41d926b9c1-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE32RY8RN6TJ75717J98Q1
Connection: close
Page title: Moshtube
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Moshtube</title>
<script type="module" crossorigin src="/assets/index--1lUpONR.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-PcvpX2vs.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · moshtube.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:06 GMT Location: https://moshtube.com/ Server: Netlify X-Nf-Request-Id: 01KETE3A86SP6Y1A7GWR2AJCN4 Content-Length: 36 Connection: close Redirecting to https://moshtube.com/
Open service 35.157.26.135:443 · www.dvrsonorg.org
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:58 GMT Location: https://dvrsonorg.org/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE323A4SW6H00NEWQ4T8HS Content-Length: 37 Connection: close Redirecting to https://dvrsonorg.org/
Open service 35.157.26.135:80 · www.dvrsonorg.org
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:06 GMT Location: https://www.dvrsonorg.org/ Server: Netlify X-Nf-Request-Id: 01KETE3AMJKDC88DTE51YQ14WH Content-Length: 41 Connection: close Redirecting to https://www.dvrsonorg.org/
Open service 35.157.26.135:443 · theaurigen.com
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 29128
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:58 GMT
Etag: "0d988937e58316a08b48f12b1d167c51-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE328SAE440S9K6HM0Z3RR
Connection: close
Page title: THE AURIGEN COLLECTIVE
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>THE AURIGEN COLLECTIVE</title>
<!-- Primary Meta -->
<meta name="title" content="THE AURIGEN COLLECTIVE — Real Estate, Capital, Guidance" />
<meta name="description" content="The Aurigen Collective architects wealth strategies at the intersection of real estate intelligence, capital structure, and elite investor guidance." />
<!-- Open Graph -->
<meta property="og:type" content="website" />
<meta property="og:title" content="THE AURIGEN COLLECTIVE — Real Estate, Capital, Guidance" />
<meta property="og:description" content="Institutional-grade strategy for off-market deals, distressed assets, and long-horizon wealth architecture." />
<meta property="og:url" content="https://theaurigen.com/" />
<!-- Favicons (keep yours) -->
<link rel="icon" type="image/x-icon" href="/favicon.ico" />
<link rel="apple-touch-icon" sizes="180x180" href="/apple-touch-icon.png" />
<link rel="icon" type="image/png" sizes="32x32" href="/favicon-32x32.png" />
<link rel="icon" type="image/png" sizes="16x16" href="/favicon-16x16.png" />
<link rel="manifest" href="/site.webmanifest" />
<!-- Fonts -->
<link rel="preconnect" href="https://fonts.googleapis.com" />
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin />
<link href="https://fonts.googleapis.com/css2?family=Cinzel:wght@400;600;700&family=Inter:wght@300;400;500;600&family=Great+Vibes&display=swap" rel="stylesheet" />
<!-- IMPORTANT: use relative path to avoid “raw text” when paths differ -->
<link rel="stylesheet" href="./styles.css" />
</head>
<body>
<div class="page">
<!-- HEADER -->
<header class="site-header">
<div class="max-w nav">
<div class="brand-mark">
<div class="pyramid-icon" aria-hidden="true"></div>
<div>
<div class="brand-text-main">THE AURIGEN COLLECTIVE</div>
<div class="brand-text-sub">Legacy • Wealth • Precision</div>
</div>
</div>
<nav class="nav-links" aria-label="Primary">
<a href="#what-we-do">What We Do</a>
<a href="#method">Method</a>
<a href="#ascension-ladder">Ascension</a>
<a href="#why-aurigen">Why Aurigen</a>
<a href="#team">Team</a>
<a href="#voices">Testimonials</a>
<a href="#track-record">Deals</a>
<a href="#guarantee">Guarantee</a>
<a href="#begin">Begin</a>
</nav>
<button class="nav-toggle" type="button" aria-label="Toggle navigation" aria-expanded="false" aria-controls="mobile-nav">
<span class="nav-toggle-box" aria-hidden="true">
<span class="nav-toggle-line"></span>
<span class="nav-toggle-line"></span>
<span class="nav-toggle-line"></span>
</span>
</button>
</div>
<div class="max-w mobile-nav" id="mobile-nav" aria-label="Mobile">
<a href="#what-we-do">What We Do</a>
<a href="#method">Method</a>
<a href="#ascension-ladder">Ascension</a>
<a href="#why-aurigen">Why Aurigen</a>
<a href="#team">Team</a>
<a href="#voices">Testimonials</a>
<a href="#track-record">Deals</a>
<a href="#guarantee">Guarantee</a>
<a href="#begin">Begin</a>
</div>
</header>
<main>
<!-- HERO -->
<section class="hero" id="top">
<div class="hero-media" aria-hidden="true">
<!-- Put your MP4 in the same folder as index.html and name it exactly like this -->
<video
class="hero-video"
autoplay
muted
loop
playsinline
preload="metadata"
poster="./hero-poster.jpg"
>
<source src="./cinematic_aerial_financial_district_at_dusk.mp4" type="video/mp4" />
</video>
<div class="hero-overlay"></div>
<div class="hero-grain"></div>
<!-- Fal
Open service 35.157.26.135:80 · theaurigen.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:05 GMT Location: https://theaurigen.com/ Server: Netlify X-Nf-Request-Id: 01KETE39FQRHWSE3BBZTETE3YP Content-Length: 38 Connection: close Redirecting to https://theaurigen.com/
Open service 35.157.26.135:80 · www.theaurigen.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:05 GMT Location: https://www.theaurigen.com/ Server: Netlify X-Nf-Request-Id: 01KETE39E6WYAMMG6E3JAKAGAH Content-Length: 42 Connection: close Redirecting to https://www.theaurigen.com/
Open service 35.157.26.135:443 · www.theaurigen.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:57 GMT Location: https://theaurigen.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE31JW4XYP1TNJBB94BPKA Content-Length: 38 Connection: close Redirecting to https://theaurigen.com/
Open service 35.157.26.135:443 · www.vabahongkong.ee
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:56 GMT Location: https://vabahongkong.ee/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE30W5FBGHDPE5EVRKB5S4 Content-Length: 39 Connection: close Redirecting to https://vabahongkong.ee/
Open service 35.157.26.135:80 · vabahongkong.ee
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:03 GMT Location: https://vabahongkong.ee/ Server: Netlify X-Nf-Request-Id: 01KETE37PFH0EEBF1T6CE5NKCY Content-Length: 39 Connection: close Redirecting to https://vabahongkong.ee/
Open service 35.157.26.135:443 · vabahongkong.ee
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 15707
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 681
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:55 GMT
Etag: "aa4d51b7a453c0738d292887384f89aa-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE30063TDBQH7C0VNX13M7
Connection: close
Page title: VabaHongKong OÜ
<!DOCTYPE html>
<html lang="et">
<head>
<meta charset="UTF-8">
<title>VabaHongKong OÜ</title>
<link rel="icon" href="icon.png" type="image/png">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<link rel="stylesheet" href="https://cdn.jsdelivr.net/npm/water.css@2/out/dark.css">
</head>
<body>
<h1 style="color: #ffd612">VabaHongKong OÜ</h1>
<h2>E-post</h2>
<p><a href="mailto:tere[♪]vabahongkong.ee">tere♪ vabahongkong.ee</a></p>
<p>PGP: BD7C 8ED4 6647 654B BF6F 9E8D 86B7 8478 6D33 E103 (<a href="https://keys.openpgp.org/search?q=BD7C8ED46647654BBF6F9E8D86B784786D33E103">keys.openpgp.org</a>)</p>
</body>
</html>
Open service 35.157.26.135:80 · www.vabahongkong.ee
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:04:05 GMT Location: https://www.vabahongkong.ee/ Server: Netlify X-Nf-Request-Id: 01KETE3932P9D2QCN22497EVEE Content-Length: 43 Connection: close Redirecting to https://www.vabahongkong.ee/
Open service 35.157.26.135:80 · www.meinepacks-live.de
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:55 GMT Location: https://www.meinepacks-live.de/ Server: Netlify X-Nf-Request-Id: 01KETE2ZFPFTPE66EA4TAE7FN7 Content-Length: 46 Connection: close Redirecting to https://www.meinepacks-live.de/
Open service 35.157.26.135:443 · www.meinepacks-live.de
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:47 GMT Location: https://meinepacks-live.de/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE2QKT6BJPNMKACWE1QQQD Content-Length: 42 Connection: close Redirecting to https://meinepacks-live.de/
Open service 35.157.26.135:80 · autowfleet.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:53 GMT Location: https://autowfleet.com/ Server: Netlify X-Nf-Request-Id: 01KETE2XBBWF26K991BWG5S7QA Content-Length: 38 Connection: close Redirecting to https://autowfleet.com/
Open service 35.157.26.135:443 · autowfleet.com
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 37356
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:43 GMT
Etag: "8e0bfc0de0f95cc508da78957bd39764-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE2M2QFZPQE30C74E7EYAR
Connection: close
Page title: Autow Fleet Services - 24 Hour Truck & Trailer Repair | Nashville, Birmingham, Knoxville
<!DOCTYPE html>
<html lang="en-US" prefix="og: http://ogp.me/ns#">
<head>
<!-- Google tag (gtag.js) -->
<script async src="https://www.googletagmanager.com/gtag/js?id=G-ZKB2KK0VZ1"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-ZKB2KK0VZ1');
</script>
<!-- Global site tag (gtag.js) - Google Analytics -->
<script async src="https://www.googletagmanager.com/gtag/js?id=UA-105719471-2"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'UA-105719471-2');
</script>
<meta name="viewport" content="initial-scale=1.0">
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width">
<link rel="shortcut icon" type="image/x-icon" href="/wp-content/uploads/2018/02/waypoint-red.png">
<link rel="apple-touch-icon" href="/wp-content/uploads/2018/02/waypoint-red.png"/>
<link href="https://fonts.googleapis.com/css?family=Lato:300,400,400i,700" rel="stylesheet">
<script defer src="https://pro.fontawesome.com/releases/v5.0.9/js/all.js" integrity="" crossorigin="anonymous"></script>
<title>Autow Fleet Services - 24 Hour Truck & Trailer Repair | Nashville, Birmingham, Knoxville</title>
<meta name="description" content="Professional 24-hour truck and trailer repair services across Tennessee and Alabama. Serving Nashville, Birmingham, and Knoxville with expert fleet maintenance, diagnostics, and emergency roadside assistance."/>
<!-- This site is optimized with the Yoast SEO plugin v9.0.3 - https://yoast.com/wordpress/plugins/seo/ -->
<link rel="canonical" href="https://autowfleet.com/"/>
<meta property="og:locale" content="en_US"/>
<meta property="og:type" content="website"/>
<meta property="og:title" content="Autow Fleet Services - 24 Hour Truck & Trailer Repair"/>
<meta property="og:description" content="Professional 24-hour truck and trailer repair services across Tennessee and Alabama. Expert fleet maintenance, diagnostics, and emergency roadside assistance."/>
<meta property="og:url" content="https://autowfleet.com/"/>
<meta property="og:site_name" content="Autow Fleet Services"/>
<meta property="og:image" content="https://autowfleet.com/wp-content/uploads/2018/02/nav-logo.png"/>
<meta name="twitter:card" content="summary_large_image"/>
<meta name="twitter:title" content="Autow Fleet Services - 24 Hour Truck & Trailer Repair"/>
<meta name="twitter:description" content="Professional 24-hour truck and trailer repair services across Tennessee and Alabama. Expert fleet maintenance, diagnostics, and emergency roadside assistance."/>
<script type="application/ld+json">{"@context":"https://schema.org","@type":"WebSite","@id":"#website","url":"https://autowfleet.com\/","name":"Autow Fleet Services","potentialAction":{"@type":"SearchAction","target":"https://autowfleet.com\/?s={search_term_string}","query-input":"required name=search_term_string"}}</script>
<meta name="google-site-verification" content="4zVvk4lsvH5MXNSPXaBaHu0pmSYWNt1ncKzlosIMPr8"/>
<!-- / Yoast SEO plugin. -->
<link rel="dns-prefetch" href="s.w.org/"/>
<script type="text/javascript">
window._wpemojiSettings = {"baseUrl":"https://s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https://s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.26"}};
!function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch
Open service 35.157.26.135:80 · www.unes.work
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:43 GMT Location: https://www.unes.work/ Server: Netlify X-Nf-Request-Id: 01KETE2KJDY6GGZYSRZKVX66CV Content-Length: 37 Connection: close Redirecting to https://www.unes.work/
Open service 35.157.26.135:443 · www.unes.work
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:35 GMT Location: https://unes.work/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE2BNDG9PNPE1RC9725J10 Content-Length: 33 Connection: close Redirecting to https://unes.work/
Open service 35.157.26.135:443 · www.turbulence-smp.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:35 GMT Location: https://turbulence-smp.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE2BWBB9N06XSTJ4E7D4JK Content-Length: 42 Connection: close Redirecting to https://turbulence-smp.com/
Open service 35.157.26.135:80 · www.turbulence-smp.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:43 GMT Location: https://www.turbulence-smp.com/ Server: Netlify X-Nf-Request-Id: 01KETE2KYWBYP4298HAG6WF10X Content-Length: 46 Connection: close Redirecting to https://www.turbulence-smp.com/
Open service 35.157.26.135:80 · godsyouthmovement.org
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:38 GMT Location: https://godsyouthmovement.org/ Server: Netlify X-Nf-Request-Id: 01KETE2ETBYA5ZJ9VMB6TJDVDT Content-Length: 45 Connection: close Redirecting to https://godsyouthmovement.org/
Open service 35.157.26.135:443 · godsyouthmovement.org
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 11121
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:29 GMT
Etag: "b08e1edde1b67d52c1fb17b0536dfd09-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE264HDFK51FYDHYND267R
Connection: close
Page title: God’s Youth — You’re Not Too Young
<!DOCTYPE html>
<html lang="en">
<head>
<title>God’s Youth — You’re Not Too Young</title>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<link rel="icon" href="images/gods-youth-logo.png" />
<script src="https://cdn.tailwindcss.com"></script>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700;800&family=Poppins:wght@600;700;800&display=swap" rel="stylesheet">
<style>
:root{--bg:#ffffff;--bg2:#fef9f5;--ink:#111;--muted:#444;--line:rgba(200,200,200,.4);--primary:#b71c1c;--accent:#ffb300}
.gradient-bg{background:linear-gradient(90deg,#b71c1c,#ffb300,#000000)}
.gradient-text{background:linear-gradient(90deg,#b71c1c,#ffb300,#000000);-webkit-background-clip:text;-webkit-text-fill-color:transparent}
html{scroll-behavior:smooth}
.btn-glow{box-shadow:0 10px 30px rgba(183,28,28,.25)}
.card{transition:transform .25s ease, box-shadow .25s ease}
.card:hover{transform:translateY(-4px); box-shadow:0 12px 30px rgba(0,0,0,.08)}
.shine{position:relative;overflow:hidden}
.shine:before{content:'';position:absolute;inset:-150% -150%;background:linear-gradient(120deg,transparent,rgba(255,255,255,.25),transparent);transform:rotate(15deg);animation:shine 6s linear infinite}
@keyframes shine{0%{transform:translateX(-60%) rotate(15deg)}100%{transform:translateX(60%) rotate(15deg)}}
.headline-underline:after{content:'';display:block;width:80px;height:4px;background:linear-gradient(90deg,#ffb300,#b71c1c,#000);margin:.6rem auto 0;border-radius:9999px}
</style>
</head>
<body class="bg-[var(--bg)] text-[var(--ink)]">
<div class="w-full text-center text-sm text-white py-2 gradient-bg">🔥 God’s Youth · <strong>You’re not too young to be used by God</strong></div>
<header class="sticky top-0 z-50 bg-white/90 backdrop-blur border-b border-[var(--line)]">
<div class="max-w-7xl mx-auto px-6 py-4 flex items-center justify-between">
<a class='flex items-center gap-3' href='/'>
<img src="images/gods-youth-logo.png" alt="God's Youth logo" class="w-12 h-12 object-contain">
<div>
<div class="font-display text-xl font-bold tracking-wide gradient-text">God’s Youth</div>
<div class="text-[10px] uppercase tracking-[.14em] text-black">YOU’RE NOT TOO YOUNG TO BE USED BY GOD</div>
</div>
</a>
<!-- Single Menu Button (shows on ALL sizes) -->
<button id="menuBtn" aria-label="Open menu" class="inline-flex items-center justify-center rounded-xl border border-[var(--line)] w-11 h-11">
<svg id="iconOpen" xmlns="http://www.w3.org/2000/svg" class="h-5 w-5" fill="none" viewBox="0 0 24 24" stroke="currentColor"><path stroke-linecap="round" stroke-linejoin="round" stroke-width="2" d="M4 6h16M4 12h16M4 18h16"/></svg>
<svg id="iconClose" xmlns="http://www.w3.org/2000/svg" class="h-5 w-5 hidden" fill="none" viewBox="0 0 24 24" stroke="currentColor"><path stroke-linecap="round" stroke-linejoin="round" stroke-width="2" d="M6 18L18 6M6 6l12 12"/></svg>
</button>
</div>
<!-- Dropdown Menu (All sizes) -->
<div id="mobileMenu" class="hidden border-t border-[var(--line)] bg-white/95 backdrop-blur">
<div class="max-w-7xl mx-auto px-6 py-3 grid gap-2 text-sm">
<a class='py-2' href='/'>Home</a>
<a class='py-2' href='/ministries'>Ministries</a>
<a class='py-2' href='/watch'>Watch</a>
<a class='py-2' href='/book'>Books</a>
<a class='py-2' href='/team'>Team</a>
<a class='py-2' href='/partnerships'>Partnerships</a>
<a class='py-2' href='/contact'>Contact</a>
<a class='py-2' href='/donate'>Donate</a>
</div>
</div>
</header>
<section class="relative gradient-bg text-white">
<div class="pointer-events-none absolute inset-0 overflow-hidden">
<span class="absolute -top-20 -left-20 w-72 h-72 rounded-full blur-3xl opacity-30" style="background:#ffb300;"></span>
<span class="absolute -bottom-24 -right-10 w-96 h-96 rounded-full blur-3xl opacity-25" style="background:#000000;"></span>
</div>
<d
Open service 35.157.26.135:443 · www.foodvery.com.do
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:28 GMT Location: https://foodvery.com.do/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE25EG8KFKDX6QB4BPV89P Content-Length: 39 Connection: close Redirecting to https://foodvery.com.do/
Open service 35.157.26.135:80 · nekodraconis.com
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:36 GMT Location: https://nekodraconis.com/ Server: Netlify X-Nf-Request-Id: 01KETE2D65EHR5NYESBCKBEZYA Content-Length: 40 Connection: close Redirecting to https://nekodraconis.com/
Open service 35.157.26.135:443 · nekodraconis.com
2026-01-13 01:03
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 6097 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 728 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 01:03:28 GMT Etag: "a40e9bd91e0a8a47737379288cdbe714-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE257WVV17PZY1JFJVPQZ5 Connection: close Page title: Neko Draconis, LLC <!DOCTYPE html> <head> <title>Neko Draconis, LLC</title> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <link href="https://fonts.googleapis.com/css2?family=Crimson+Text:wght@400;700&display=swap" rel="stylesheet"> <link href="https://fonts.googleapis.com/css2?family=Open+Sans:wght@300;700&display=swap" rel="stylesheet"> <link rel="stylesheet" href="index.css"> </head> <body> <div class="container"> <h1>Neko Draconis, LLC</h1> <p>Established August 2020</p> <p>Software Development and Consulting</p> <br> <br> <br> <br> <p><i>We are not accepting inquiries at this time.</i></p> <p class="copyright">© 2020 Neko Draconis, LLC. All rights reserved.</p> </div> </body>
Open service 35.157.26.135:443 · audit.waterfronthospital.co.uk
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 4
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 13598
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:25 GMT
Etag: "020d17f2d6bff615d4f25e38c29f11d1-ssl"
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETE2270T4GRQVN6741KEMRD
X-Xss-Protection: 1; mode=block
Connection: close
Page title: Waterfront Hospital Audit Tool
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no">
<meta name="apple-mobile-web-app-capable" content="yes">
<meta name="apple-mobile-web-app-status-bar-style" content="default">
<title>Waterfront Hospital Audit Tool</title>
<link rel="stylesheet" href="styles.css">
<link rel="manifest" href="manifest.json">
<link rel="apple-touch-icon" href="icon-192.png">
</head>
<body>
<div id="app">
<!-- Login Screen -->
<div id="login-screen" class="screen active">
<div class="login-container">
<div class="hospital-header">
<img src="https://www.waterfronthospital.co.uk/wp-content/uploads/2025/03/Waterfront-Private-Hospital-Master-Logo-Reversed.png"
alt="Waterfront Private Hospital"
class="hospital-logo">
<h1>Waterfront Private Hospital</h1>
<h2>Clinical Audit System</h2>
</div>
<div class="login-form">
<label for="staff-name">Select Your Name:</label>
<select id="staff-name" class="staff-select">
<option value="">-- Select Staff Member --</option>
<option value="Cezary K">Cezary K</option>
<option value="Christina I">Christina I</option>
<option value="Gleb S">Gleb S</option>
<option value="Inez A">Inez A</option>
<option value="Islay R">Islay R</option>
<option value="Kerry Anne C">Kerry Anne C</option>
<option value="Laura G">Laura G</option>
<option value="Oksana S">Oksana S</option>
<option value="Piel R">Piel R</option>
<option value="Sybil S">Sybil S</option>
<option value="OTHER">OTHER</option>
</select>
<button id="login-btn" class="primary-btn" disabled>Sign In</button>
</div>
</div>
</div>
<!-- Main Menu -->
<div id="main-menu" class="screen">
<div class="header">
<h1>Clinical Audits</h1>
<div class="user-info">
<span id="current-user"></span>
<button id="logout-btn" class="small-btn">Sign Out</button>
</div>
</div>
<div class="audit-categories">
<div class="category-card" data-category="perioperative">
<h3>🏥 Peri-operative Environment</h3>
<p>Surgical safety, team briefs, accountability</p>
<span class="audit-count">6 audits</span>
</div>
<div class="category-card" data-category="clinical">
<h3>🩺 Clinical</h3>
<p>Resuscitation equipment, VTE assessment</p>
<span class="audit-count">2 audits</span>
</div>
<div class="category-card" data-category="patient-experience">
<h3>😊 Patient Experience</h3>
<p>Privacy, dignity, consent</p>
<span class="audit-count">3 audits</span>
</div>
<div class="category-card" data-category="infection-prevention">
<h3>🧼 Infection Prevention</h3>
<p>Hand hygiene, environment, surgical scrub</p>
<span class="audit-count">6 audits</span>
</div>
<div class="category-card" data-category="medicines">
<h3>💊 Medicines Management</h3>
<p>Controlled drugs, medical gases, security</p>
<span class="audit-count">4 audits</span>
</div>
Open service 35.157.26.135:80 · audit.waterfronthospital.co.uk
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:33 GMT Location: https://audit.waterfronthospital.co.uk/ Server: Netlify X-Nf-Request-Id: 01KETE29V7FFDJQTG196VQXBNJ Content-Length: 54 Connection: close Redirecting to https://audit.waterfronthospital.co.uk/
Open service 35.157.26.135:443 · sentiminds-insight.dartisan.tech
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1017
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:25 GMT
Etag: "cb294e56437d2a420a5c066e72f13717-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE21X0CPMM864EW19MH06J
Connection: close
Page title: Community Sentiment Analyzer
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/favicon.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Community Sentiment Analyzer</title>
<meta name="description" content="Analyze community feedback with AI-powered sentiment analysis and actionable insights" />
<meta name="author" content="Community Sentiment Analyzer" />
<meta property="og:title" content="Community Sentiment Analyzer" />
<meta property="og:description" content="Analyze community feedback with AI-powered sentiment analysis and actionable insights" />
<meta property="og:type" content="website" />
<meta name="twitter:card" content="summary_large_image" />
<script type="module" crossorigin src="/assets/index-DLs6otxC.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-C6R889Kr.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · sentiminds-insight.dartisan.tech
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:33 GMT Location: https://sentiminds-insight.dartisan.tech/ Server: Netlify X-Nf-Request-Id: 01KETE29NHKNFD5YE7M2DG42AW Content-Length: 56 Connection: close Redirecting to https://sentiminds-insight.dartisan.tech/
Open service 35.157.26.135:443 · zanardiniengenharia.com.br
2026-01-13 01:03
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1124
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:02 GMT
Etag: "3de1004fb473f87836872d9bc3f1b29d-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE1BTWAHB0E4BGYJARPJDQ
Connection: close
Page title: Zanardini Engenharia
<!DOCTYPE html>
<html lang="en">
<link rel="sitemap" type="application/xml" title="Sitemap" href="/sitemap.xml">
<script type="module" crossorigin src="/assets/index-DYNkQm6K.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-fB9MJ_EB.css">
<head>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Roboto:wght@400;500;600;700&display=swap" rel="stylesheet">
<meta charset="UTF-8" />
<meta http-equiv="Content-Security-Policy" content="script-src 'self' 'unsafe-eval' 'unsafe-inline' *; object-src 'none';">
<link rel="icon" type="image/webp" href="/card/LSF-Z.webp" />
<link rel="icon" type="image/png" href="/card/LSF-Z.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Zanardini Engenharia</title>
<meta name="description" content="Especialistas em Planos de Rigging, Alocação de Profissionais, Laudos Técnicos (NR-12) e Laudos Mecânicos. Fale conosco!" />
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · zanardiniengenharia.com.br
2026-01-13 01:03
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:11 GMT Location: https://zanardiniengenharia.com.br/ Server: Netlify X-Nf-Request-Id: 01KETE1M7KZ2PGGWRCDT7EJQ67 Content-Length: 50 Connection: close Redirecting to https://zanardiniengenharia.com.br/
Open service 35.157.26.135:443 · www.sheffieldtrades.co.uk
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:02 GMT Location: https://sheffieldtrades.co.uk/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE1BKQN6VAAQ5NTEDZCX82 Content-Length: 45 Connection: close Redirecting to https://sheffieldtrades.co.uk/
Open service 35.157.26.135:80 · sheffieldtrades.co.uk
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:09 GMT Location: https://sheffieldtrades.co.uk/ Server: Netlify X-Nf-Request-Id: 01KETE1JRE2W6TTGVQMMDD9XMS Content-Length: 45 Connection: close Redirecting to https://sheffieldtrades.co.uk/
Open service 35.157.26.135:443 · sheffieldtrades.co.uk
2026-01-13 01:02
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 18812
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:03:01 GMT
Etag: "8e9f6e65adbe8558a843242067785e5b-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE1B2838559QSY4TGX5WCM
Connection: close
Page title: Sheffield Trades & Labour Club | Community Pub & Events
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Sheffield Trades & Labour Club | Community Pub & Events</title>
<link rel="icon" type="image/png" href="images/SheffieldTrades_logo.png">
<link rel="apple-touch-icon" href="images/SheffieldTrades_logo.png">
<script src="https://cdn.tailwindcss.com"></script>
<link href="https://unpkg.com/aos@2.3.1/dist/aos.css" rel="stylesheet">
<script src="https://unpkg.com/aos@2.3.1/dist/aos.js"></script>
<script src="https://cdn.jsdelivr.net/npm/feather-icons/dist/feather.min.js"></script>
<script src="https://unpkg.com/feather-icons"></script>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Playfair+Display:wght@400;700&family=Roboto:wght@300;400;500;700&display=swap" rel="stylesheet">
<style>
body {
font-family: 'Roboto', sans-serif;
}
.hero {
background-image: linear-gradient(rgba(0, 0, 0, 0.7), rgba(0, 0, 0, 0.7)), url('images/Club_hero_img.jpeg');
background-size: cover;
background-position: center;
}
.special-card {
transition: all 0.3s ease;
}
.special-card:hover {
transform: translateY(-5px);
box-shadow: 0 10px 25px rgba(0, 0, 0, 0.2);
}
</style>
</head>
<body class="bg-gray-100">
<!-- Navigation -->
<nav class="bg-red-800 text-white shadow-lg">
<div class="container mx-auto px-4 py-3">
<div class="flex justify-between items-center">
<div class="flex items-center space-x-2">
<img src="images/SheffieldTrades_logo.png" alt="Sheffield Trades & Labour Club Logo" class="h-8 w-8">
<span class="font-bold text-xl font-serif">Sheffield Trades & Labour Club</span>
</div>
<div class="hidden md:flex space-x-6">
<a href="#" class="hover:text-yellow-300 transition">Home</a>
<a href="#contact" class="hover:text-yellow-300 transition">Contact</a>
<a class='hover:text-yellow-300 transition' href='/booking'>Make a Booking</a>
</div>
<button class="md:hidden focus:outline-none" id="menu-toggle">
<i data-feather="menu"></i>
</button>
</div>
<!-- Mobile menu -->
<div class="md:hidden hidden pt-4" id="mobile-menu">
<a href="#" class="block py-2 hover:text-yellow-300 transition">Home</a>
<a href="#contact" class="block py-2 hover:text-yellow-300 transition">Contact</a>
<a class='block py-2 hover:text-yellow-300 transition' href='/booking'>Make a Booking</a>
</div>
</div>
</nav>
<!-- Hero Section -->
<section class="hero text-white py-20">
<div class="container mx-auto px-4 text-center" data-aos="fade-up">
<h1 class="text-4xl md:text-6xl font-serif font-bold mb-6">Welcome to Sheffield Trades & Labour Club</h1>
<p class="text-xl mb-8 max-w-2xl mx-auto">A community hub for good drinks, great company, and unbeatable deals in the heart of Sheffield</p>
<div class="flex flex-wrap justify-center gap-4">
<a href="#specials" class="bg-yellow-500 hover:bg-yellow-600 text-gray-900 font-bold py-3 px-6 rounded-lg transition duration-300">View Our Specials</a>
<a href="#events" class="bg-red-700 hover:bg-red-800 text-white font-bold py-3 px-6 rounded-lg transition duration-300">Upcoming Events</a>
<a href="#contact" class="bg-transparent hover:bg-white hover:text-gray-900 border-2 border-white text-white font-bold py-3 px-6 rounded-lg transition duration-300">Contact Us</a>
</div>
</div>
</section>
<!-- Daily Specials -->
<section
Open service 35.157.26.135:80 · www.sheffieldtrades.co.uk
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:03:10 GMT Location: https://www.sheffieldtrades.co.uk/ Server: Netlify X-Nf-Request-Id: 01KETE1M1NA3QJKV5HGG8F1P7T Content-Length: 49 Connection: close Redirecting to https://www.sheffieldtrades.co.uk/
Open service 35.157.26.135:443 · davidandthearchitect.com
2026-01-13 01:02
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 13844
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:02:51 GMT
Etag: "32d41afa9f111f4413b3bb7458ad7b4d-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE10SVZJX5AZMHPWCB9DRJ
Connection: close
Page title: The Presence Series — An Octave of Return
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8"/>
<meta content="width=device-width, initial-scale=1" name="viewport"/>
<title>The Presence Series — An Octave of Return</title>
<meta content="Eight books trace a single wave: from Oversoul recognition to Grace returning to Silence. The Presence Series by David Ronald Nethercott." name="description"/>
<link href="https://fonts.googleapis.com" rel="preconnect"/>
<link crossorigin="" href="https://fonts.gstatic.com" rel="preconnect"/>
<link href="https://fonts.googleapis.com/css2?family=Lora:wght@400;600;700&family=Inter:wght@400;600&display=swap" rel="stylesheet"/>
<style>
:root{
--bg:#f7f7f5; /* warm grey */
--cream:#f9f3e8; /* page tone */
--text:#222; /* soft charcoal */
--muted:#666; /* secondary copy */
--line:#eadfc6; /* rules/borders */
--accent:#6b705c;/* sage accent */
--gold:#c7a96b; /* subtle gold for numerals and glyphs */
--card:#ffffff;
--shadow:0 10px 30px rgba(0,0,0,.08);
--max:1200px;
--radius:18px;
}
*{box-sizing:border-box}
html,body{margin:0;padding:0;background:var(--bg);color:var(--text);font-family:"Inter", system-ui, -apple-system, Segoe UI, Roboto, Arial, sans-serif;}
a{color:inherit;text-decoration:none}
.wrap{max-width:var(--max);margin:0 auto;padding:24px}
/* HERO (stars + clouds banner) */
.hero{position:relative;isolation:isolate;aspect-ratio:16/6;width:100%;border-radius:var(--radius);overflow:hidden;box-shadow:var(--shadow);background:#cfcfcf}
.hero img{position:absolute;inset:0;width:100%;height:100%;object-fit:cover;filter:contrast(1) brightness(.95)}
.hero::after{content:"";position:absolute;inset:0;background:linear-gradient(90deg, rgba(0,0,0,.35), rgba(0,0,0,.15) 40%, rgba(0,0,0,.35));mix-blend-mode:normal;pointer-events:none}
.heroContent{position:absolute;inset:0;display:grid;place-items:center;text-align:center;padding:24px;z-index:1;color:#fff}
.seriesTitle{font-family:Lora, serif;font-weight:700;letter-spacing:.5px;font-size:clamp(34px,5vw,64px);margin:0 0 10px}
.seriesByline{font-family:Lora, serif;font-weight:600;font-size:clamp(14px,2vw,20px);opacity:.9;margin:0}
.pill{margin-top:14px;display:inline-block;padding:8px 14px;border:1px solid rgba(255,255,255,.55);border-radius:999px;font-size:14px;letter-spacing:.3px}
/* INTRO */
.intro{margin:32px auto 8px;max-width:900px;text-align:center}
.intro h2{font-family:Lora, serif;font-weight:700;font-size:clamp(22px,3.2vw,34px);margin:0 0 8px}
.intro p{margin:0 auto;color:var(--muted);line-height:1.7;font-size:clamp(15px,2vw,18px)}
/* SERIES MAP */
.section{padding:40px 0;border-bottom:1px solid var(--line)}
.section:last-of-type{border-bottom:none}
h2{font-family:Lora, serif;font-weight:700;font-size:clamp(22px,3vw,30px);margin:0 0 10px}
.copy{max-width:80ch;color:var(--text);font-size:18px;line-height:1.6}
.series-list{margin-top:20px;display:grid;gap:18px}
.series-item{padding:18px;border:1px solid var(--line);border-radius:16px;background:#fff7e9cc}
.num{color:var(--gold);font-weight:700;margin-right:.5ch}
.subtitle{color:var(--muted);font-size:16px;margin-top:4px}
/* BOOK GRID */
.book-grid{display:grid;gap:24px;margin-top:28px}
@media(min-width:680px){.book-grid{grid-template-columns:repeat(2,1fr)}}
@media(min-width:980px){.book-grid{grid-template-columns:repeat(4,1fr)}}
.card{display:flex;flex-direction:column;border:1px solid var(--line);border-radius:var(--radius);overflow:hidden;background:var(--card);box-shadow:var(--shadow)}
.cover{aspect-ratio:3/4;background:#ddd center/cover no-repeat;display:flex;align-items:center;justify-content:center;color:var(--gold);font-size:40px}
.meta{padding:16px}
.title{font-family:Lora, serif;font-weight:700;font-size:18px;line-height:1.3;margin:0 0 6px}
.series{font-variant:small-caps;color:var(--muted);letter-spacing:.06em;font-size:12px}
.desc{font-size:15px;color:var(--muted);margin:10px 0 14px;min-
Open service 35.157.26.135:80 · davidandthearchitect.com
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:58 GMT Location: https://davidandthearchitect.com/ Server: Netlify X-Nf-Request-Id: 01KETE181DNWWSJ15EWR9WA413 Content-Length: 48 Connection: close Redirecting to https://davidandthearchitect.com/
Open service 35.157.26.135:443 · wms.nissin-ion.co.kr
2026-01-13 01:02
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 477
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:02:45 GMT
Etag: "fe1ad3d018434a38940a23c817b731e1-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE0V22PFM5MFB0Q3R9HFER
Connection: close
Page title: 일신이온
<!doctype html>
<html lang="ko">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/x-icon" href="/assets/favicon-C7lsaFJT.ico" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>일신이온</title>
<script type="module" crossorigin src="/assets/index-aHLRBEdd.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DpNsjNtQ.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · wms.nissin-ion.co.kr
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:52 GMT Location: https://wms.nissin-ion.co.kr/ Server: Netlify X-Nf-Request-Id: 01KETE12CR7CC8K474XKNY76Q3 Content-Length: 44 Connection: close Redirecting to https://wms.nissin-ion.co.kr/
Open service 35.157.26.135:443 · app.markbase.xyz
2026-01-13 01:02
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 9719
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:02:44 GMT
Etag: "8ba420e9e33ad2277fdb613baff65c63-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE0SY8CP99ATSCX7874P4Q
Connection: close
Page title: Markbase - Share your Obsidian notes online
<!doctype html><html lang="en" class="h-full bg-gray-50"><head><meta charset="utf-8"/><link rel="icon" href="/favicon-512x512.png"/><meta name="viewport" content="width=device-width,initial-scale=1"/><meta name="theme-color" content="#000000"/><meta name="description" content="Web site created using create-react-app"/><link rel="apple-touch-icon" href="/favicon-512x512.png"/><link rel="manifest" href="/manifest.json"/><link rel="stylesheet" href="https://rsms.me/inter/inter.css"/><script>var _rollbarConfig={accessToken:"bc25c0759ccc441fba23b023cd9258a0",captureUncaught:!0,captureUnhandledRejections:!0,payload:{environment:"production"}};!function(r){function e(n){if(o[n])return o[n].exports;var t=o[n]={exports:{},id:n,loaded:!1};return r[n].call(t.exports,t,t.exports,e),t.loaded=!0,t.exports}var o={};e.m=r,e.c=o,e.p="",e(0)}([function(r,e,o){"use strict";var n=o(1),t=o(4);(_rollbarConfig=_rollbarConfig||{}).rollbarJsUrl=_rollbarConfig.rollbarJsUrl||"https://cdnjs.cloudflare.com/ajax/libs/rollbar.js/2.4.6/rollbar.min.js",_rollbarConfig.async=void 0===_rollbarConfig.async||_rollbarConfig.async;var a=n.setupShim(window,_rollbarConfig),l=t(_rollbarConfig);window.rollbar=n.Rollbar,a.loadFull(window,document,!_rollbarConfig.async,_rollbarConfig,l)},function(r,e,o){"use strict";function n(r){return function(){try{return r.apply(this,arguments)}catch(r){try{console.error("[Rollbar]: Internal error",r)}catch(r){}}}}function t(r,e){this.options=r,this._rollbarOldOnError=null;var o=i++;this.shimId=function(){return o},"undefined"!=typeof window&&window._rollbarShims&&(window._rollbarShims[o]={handler:e,messages:[]})}function a(r){return n((function(){var e=this,o=Array.prototype.slice.call(arguments,0),n={shim:e,method:r,args:o,ts:new Date};window._rollbarShims[this.shimId()].messages.push(n)}))}var l=o(2),i=0,s=o(3).bind(null,(function(r,e){return new t(r,e)}));t.prototype.loadFull=function(r,e,o,t,a){var l=!1,i=e.createElement("script"),s=e.getElementsByTagName("script")[0],c=s.parentNode;i.crossOrigin="",i.src=t.rollbarJsUrl,o||(i.async=!0),i.onload=i.onreadystatechange=n((function(){if(!(l||this.readyState&&"loaded"!==this.readyState&&"complete"!==this.readyState)){i.onload=i.onreadystatechange=null;try{c.removeChild(i)}catch(r){}l=!0,function(){var e;if(void 0===r._rollbarDidLoad){e=new Error("rollbar.js did not load");for(var o,n,t,l,i=0;o=r._rollbarShims[i++];)for(o=o.messages||[];n=o.shift();)for(t=n.args||[],i=0;i<t.length;++i)if("function"==typeof(l=t[i])){l(e);break}}"function"==typeof a&&a(e)}()}})),c.insertBefore(i,s)},t.prototype.wrap=function(r,e,o){try{var n;if(n="function"==typeof e?e:function(){return e||{}},"function"!=typeof r)return r;if(r._isWrap)return r;if(!r._rollbar_wrapped&&(r._rollbar_wrapped=function(){o&&"function"==typeof o&&o.apply(this,arguments);try{return r.apply(this,arguments)}catch(o){var e=o;throw e&&("string"==typeof e&&(e=new String(e)),e._rollbarContext=n()||{},e._rollbarContext._wrappedSource=r.toString(),window._rollbarWrappedError=e),e}},r._rollbar_wrapped._isWrap=!0,r.hasOwnProperty))for(var t in r)r.hasOwnProperty(t)&&(r._rollbar_wrapped[t]=r[t]);return r._rollbar_wrapped}catch(e){return r}};for(var c="log,debug,info,warn,warning,error,critical,global,configure,handleUncaughtException,handleUnhandledRejection,captureEvent,captureDomContentLoaded,captureLoad".split(","),d=0;d<c.length;++d)t.prototype[c[d]]=a(c[d]);r.exports={setupShim:function(r,e){if(r){var o=e.globalAlias||"Rollbar";if("object"==typeof r[o])return r[o];r._rollbarShims={},r._rollbarWrappedError=null;var t=new s(e);return n((function(){e.captureUncaught&&(t._rollbarOldOnError=r.onerror,l.captureUncaughtExceptions(r,t,!0),l.wrapGlobals(r,t,!0)),e.captureUnhandledRejections&&l.captureUnhandledRejections(r,t,!0);var n=e.autoInstrument;return!1!==e.enabled&&(void 0===n||!0===n||"object"==typeof n&&n.network)&&r.addEventListener&&(r.addEventListener("load",t.captureLoad.bind(t)),r.addEventListener("DOMContentLoaded",t.captureDomContentLoaded.bind(t))),r[o]=t,t}))()}},Rollbar:s}},function(r,e){"use strict";function o(r,e,o,n)
Open service 35.157.26.135:80 · app.markbase.xyz
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:52 GMT Location: https://app.markbase.xyz/ Server: Netlify X-Nf-Request-Id: 01KETE11RJD46223CV8FH6E8DF Content-Length: 40 Connection: close Redirecting to https://app.markbase.xyz/
Open service 35.157.26.135:80 · www.washpointpartners.com
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:45 GMT Location: https://www.washpointpartners.com/ Server: Netlify X-Nf-Request-Id: 01KETE0VFF86YQ28HSN4RPFMYH Content-Length: 49 Connection: close Redirecting to https://www.washpointpartners.com/
Open service 35.157.26.135:443 · www.washpointpartners.com
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:36 GMT Location: https://washpointpartners.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE0JRY3X3VKX627CX6ZECC Content-Length: 45 Connection: close Redirecting to https://washpointpartners.com/
Open service 35.157.26.135:443 · www.exback-healererwin.ca
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:25 GMT Location: https://exback-healererwin.ca/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETE07GJPNVWERZ553JHM09P Content-Length: 45 Connection: close Redirecting to https://exback-healererwin.ca/
Open service 35.157.26.135:80 · www.exback-healererwin.ca
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:33 GMT Location: https://www.exback-healererwin.ca/ Server: Netlify X-Nf-Request-Id: 01KETE0FDM4DCWDTJ4W211SF3P Content-Length: 49 Connection: close Redirecting to https://www.exback-healererwin.ca/
Open service 35.157.26.135:443 · randy.ch
2026-01-13 01:02
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 29230
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:02:20 GMT
Etag: "9c5a3fd6b2b8c289af1c4d90e34e56ff-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETE02RQENWGQQM46DJGEE2R
Connection: close
Page title: randy.ch/en
<!DOCTYPE html>
<!--[if IE 8 ]><html class="no-js oldie ie8" lang="en"> <![endif]-->
<!--[if IE 9 ]><html class="no-js oldie ie9" lang="en"> <![endif]-->
<!--[if (gte IE 9)|!(IE)]><!--><html class="no-js" lang="en"> <!--<![endif]-->
<head>
<!--- basic page needs
================================================== -->
<meta charset="utf-8">
<title>randy.ch/en</title>
<meta name="description" content="portfolio">
<meta name="author" content="Randy Chen">
<!-- mobile specific metas
================================================== -->
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1">
<!-- CSS
================================================== -->
<link rel="stylesheet" href="css/base.css">
<link rel="stylesheet" href="css/vendor.css">
<link rel="stylesheet" href="css/main.css">
<link rel="stylesheet" href="css/timeline.css">
<!-- script
================================================== -->
<script src="js/modernizr.js"></script>
<script src="js/pace.min.js"></script>
<!-- favicons
================================================== -->
<link rel="shortcut icon" href="favicon.ico" type="image/x-icon">
<link rel="icon" href="favicon.ico" type="image/x-icon">
</head>
<!-- Google tag (gtag.js) -->
<script async src="https://www.googletagmanager.com/gtag/js?id=G-1Q3GPXPF8B"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-1Q3GPXPF8B');
</script>
<!-- LOADING -->
<body id="top">
<!-- <div id="loading">
<div id="spinner"></div>
</div>
<div id="box">
<div class="box1 onlywide animated bounceOutLeft" style="animation-delay:1.7s;"></div>
<div class="box2 onlywide animated bounceOutLeft" style="animation-delay:1.8s;"></div>
<div class="box2 onlywide animated bounceOutLeft" style="animation-delay:1.9s;"></div>
<div class="box2 animated bounceOutRight" style="animation-delay:1.9s;"></div>
<div class="box2 onlywide animated bounceOutRight" style="animation-delay:1.8s;"></div>
<div class="box2 onlywide animated bounceOutRight" style="animation-delay:1.7s;"></div>
</div> -->
<!-- header
================================================== -->
<header>
<!-- <div class="header-logo">
<a href="index.html"></a>
</div> -->
<a id="header-menu-trigger" href="#0">
<span class="header-menu-text">Menu</span>
<span class="header-menu-icon"></span>
</a>
<nav id="menu-nav-wrap">
<a href="#0" class="close-button" title="close"><span>Close</span></a>
<h3>Hello!</h3>
<ul class="nav-list">
<li class="current"><a class="smoothscroll" href="#home" title="">Home</a></li>
<li><a class="smoothscroll" href="#about" title="">About</a></li>
<li><a class="smoothscroll" href="#portfolio" title="">Works</a></li>
<li><a class="smoothscroll" href="#achievements" title="">Achievements</a></li>
<li><a class="smoothscroll" href="#contact" title="">Contact</a></li>
</ul>
<ul class="header-social-list">
<li>
<a href="https://www.linkedin.com/in/randythechen"><i class="fa fa-linkedin"></i></a>
</li>
<li>
<a href="https://www.instagram.com/dechines/"><i class="fa fa-instagram"></i></a>
</li>
<li>
<a href="https://www.behance.net/randychen5"><i class="fa fa-behance"></i></a>
</li>
</ul>
</nav> <!-- end #menu-nav-wrap -->
</header> <!-- end header -->
<!-- home
================================================== -->
<section id="home">
<div class="overlay"></div>
<div class="home-content-table">
<div class="home-content-tablecell">
<div class="row">
<div class="col-twelve">
<!-- <h1 class="animate-intro">
randy.ch/en
</h1> -->
<h1 class="typewrite animate-intro" style="letter-spacing:-0.8px; font-family: 'Josefin Sans';" data-period="2000" data-type='[ "/atty", "
Open service 35.157.26.135:80 · randy.ch
2026-01-13 01:02
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:02:27 GMT Location: https://randy.ch/ Server: Netlify X-Nf-Request-Id: 01KETE09PH5P1AFRAACRC158KA Content-Length: 32 Connection: close Redirecting to https://randy.ch/
Open service 35.157.26.135:80 · www.truecarevirtualsolutions.com
2026-01-13 01:01
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:01:49 GMT Location: https://www.truecarevirtualsolutions.com/ Server: Netlify X-Nf-Request-Id: 01KETDZ4AQHJHGBBD8R1FX7MQP Content-Length: 56 Connection: close Redirecting to https://www.truecarevirtualsolutions.com/
Open service 35.157.26.135:443 · www.truecarevirtualsolutions.com
2026-01-13 01:01
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:01:40 GMT Location: https://truecarevirtualsolutions.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDYVNTQGWE5S4Q1SGV9SFQ Content-Length: 52 Connection: close Redirecting to https://truecarevirtualsolutions.com/
Open service 35.157.26.135:80 · www.wetechcareenterprises.com
2026-01-13 01:01
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:01:11 GMT Location: https://www.wetechcareenterprises.com/ Server: Netlify X-Nf-Request-Id: 01KETDXZEV5FN4F5S0G8WR1V71 Content-Length: 53 Connection: close Redirecting to https://www.wetechcareenterprises.com/
Open service 35.157.26.135:443 · www.wetechcareenterprises.com
2026-01-13 01:01
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:01:03 GMT Location: https://wetechcareenterprises.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDXQKN95NY5Y7HDRXT3NY5 Content-Length: 49 Connection: close Redirecting to https://wetechcareenterprises.com/
Open service 35.157.26.135:443 · likvidacevozidel.info
2026-01-13 01:00
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 4
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 17326
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 01:00:53 GMT
Etag: "79242694d323020aeb58720161c4928a-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDXEA2HBYDSVBNRMV3RE0B
Connection: close
Page title: Ekologická likvidace vozidel Ústí nad Labem - Odtah Zdarma
<!DOCTYPE html>
<html lang="cs">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Ekologická likvidace vozidel Ústí nad Labem - Odtah Zdarma</title>
<meta name="description"
content="Ekologická likvidace autovraků v Ústeckém kraji. Odtah zdarma, protokol o likvidaci ihned, vyplacení hotovosti na ruku. Volejte non-stop.">
<meta name="robots" content="index, follow">
<meta name="keywords" content="likvidace vozidel, likvidace vozidel usti nad labem, decin">
<meta name="author" content="Ladislav Staněk">
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Outfit:wght@300;400;600;700&display=swap" rel="stylesheet">
<link rel="stylesheet" href="style.css">
</head>
<body>
<header>
<div class="container header-content">
<div class="logo">Ekologická likvidace vozidel <span class="highlight">Ústí nad Labem a okolí</span></div>
<nav>
<ul>
<li><a href="#jak-to-funguje">Jak to funguje</a></li>
<li><a href="#mapa">Kudy k nám</a></li>
<li><a href="#kontakt" class="btn btn-primary">Zlikvidovat auto</a></li>
</ul>
</nav>
</div>
</header>
<section class="hero">
<div class="container hero-content">
<div class="hero-text">
<div class="hero-contacts-top">
<div class="contact-block primary">
<span class="label">Likvidace vozidel</span>
<a href="tel:+420725446610" class="phone">+420 725 446 610</a>
</div>
<div class="contact-block secondary">
<span class="label">Sháníte náhradní díl?</span>
<a href="tel:+420739633544" class="phone">+420 739 633 544</a>
<a href="https://www.instagram.com/levnedily/" target="_blank" class="instagram-link">📷
Sledujte nás na Instagramu</a>
<a href="https://www.facebook.com/groups/2232693186912302/user/100080627977635" target="_blank"
class="facebook-link">👥 Sledujte nás na Facebooku</a>
</div>
</div>
<h1>Zbavte se starého auta <span class="text-green">výhodně a ekologicky</span></h1>
<p>Odtah zdarma po celém Ústeckém kraji. Vystavíme protokol o likvidaci.</p>
<div class="cta-group">
<a href="tel:+420725446610" class="btn btn-primary">📞 Zavolat ihned</a>
<a href="#kontakt" class="btn btn-secondary">Nezávazná poptávka</a>
</div>
<div class="hero-locations">
<p><strong>Působíme v celém Ústeckém kraji:</strong></p>
<p>Ústí nad Labem, Děčín, Teplice, Most, Litoměřice, Chomutov, Lovosice, Roudnice nad Labem, Bílina,
Varnsdorf, Klášterec nad Ohří, Krupka, Rumburk, Litvínov, Žatec, Louny, Kadaň, Duchcov, Dubí,
Jirkov, Podbořany, Šluknov, Česká Kamenice, Jílové, Štětí, Úštěk, Benešov nad Ploučnicí,
Chlumec, Trmice, Velké Březno, Povrly, Libouchec, Tisá, Petrovice, Chabařovice, Hostomice,
Světec, Hrob, Osek, Lom, Meziboří, Horní Jiřetín, Velemín, Třebenice, Libochovice, Budyně nad
Ohří, Terezín, Bohušovice nad Ohří, Travčice, Křešice, Polepy, Hoštka, Velemyšleves, Vroutek,
Kryry, Lubenec, Peruc, Postoloprty, Lenešice, Dobroměřice, Cítoliby, Jimlín, Zlonice, Černčice,
Koštice, Klapý, Dlažkovice, Třebívlice...
Open service 35.157.26.135:80 · likvidacevozidel.info
2026-01-13 01:00
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:01:02 GMT Location: https://likvidacevozidel.info/ Server: Netlify X-Nf-Request-Id: 01KETDXP96VP52KHCPBRC8KTSG Content-Length: 45 Connection: close Redirecting to https://likvidacevozidel.info/
Open service 35.157.26.135:80 · sitemaps.mydripnurse.com
2026-01-13 01:00
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:01:00 GMT Location: https://sitemaps.mydripnurse.com/ Server: Netlify X-Nf-Request-Id: 01KETDXMGJTCT1YXGJ1BA71135 Content-Length: 48 Connection: close Redirecting to https://sitemaps.mydripnurse.com/
Open service 35.157.26.135:443 · sitemaps.mydripnurse.com
2026-01-13 01:00
HTTP/1.1 404 Not Found
Age: 4
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3449
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 01:00:51 GMT
Etag: 1768265640-ssl
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDXBQ9ZFBV7GFZXY8YPBQH
Connection: close
Page title: Page not found
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Page not found</title>
<style>
:root {
--colorRgbFacetsTeal600: 2 128 125;
--colorTealAction: var(--colorRgbFacetsTeal600);
--colorRgbFacetsNeutralLight200: 233 235 237;
--colorHr: var(--colorRgbFacetsNeutralLight200);
--colorRgbFacetsNeutralLight700: 53 58 62;
--colorGrayDarkest: var(--colorRgbFacetsNeutralLight700);
--colorGrayLighter: var(--colorRgbFacetsNeutralLight200);
--colorText: var(--colorGrayDarkest);
--effectShadowLightShallow: 0 1px 10px 0 rgb(53 58 62 / 6%),
0 2px 4px 0 rgb(53 58 62 / 8%);
--colorRgbFacetsNeutralDark900: 6 11 16;
}
body {
font-family: system-ui, -apple-system, BlinkMacSystemFont, "Segoe UI",
Roboto, Helvetica, Arial, sans-serif, "Apple Color Emoji",
"Segoe UI Emoji", "Segoe UI Symbol";
background: white;
overflow: hidden;
margin: 0;
padding: 0;
line-height: 1.5;
color: rgb(var(--colorText));
}
@media (prefers-color-scheme: dark) {
body {
background: rgb(var(--colorRgbFacetsNeutralDark900));
}
}
h1 {
margin: 0;
font-size: 1.375rem;
line-height: 1;
}
h1 + p {
margin-top: 8px;
}
.main {
position: relative;
display: flex;
flex-direction: column;
align-items: center;
justify-content: center;
height: 100vh;
width: 100vw;
}
.card {
position: relative;
width: 75%;
max-width: 364px;
padding: 24px;
background: white;
border-radius: 8px;
box-shadow: var(--effectShadowLightShallow);
border: 1px solid rgb(var(--colorGrayLighter));
}
a {
margin: 0;
font-weight: 600;
color: rgb(var(--colorTealAction));
text-decoration-skip-ink: all;
text-decoration-thickness: 1px;
text-underline-offset: 2px;
text-decoration-color: rgb(var(--colorTealAction) / 0.5);
transition: text-decoration-color 0.15s ease-in-out;
}
a:hover,
a:focus-visible {
text-decoration-color: rgb(var(--colorTealAction));
}
p:last-of-type {
margin-bottom: 0;
}
hr {
border: 0;
height: 1px;
background: rgb(var(--colorHr));
margin-top: 16px;
margin-bottom: 16px;
}
.your-site {
font-size: 0.875rem;
}
</style>
</head>
<body>
<div class="main">
<div class="card">
<h1>Page not found</h1>
<p>
Looks like you’ve followed a broken link or entered a URL that doesn’t
exist on this site.
</p>
<hr />
<p class="your-site">
If this is your site, and you weren’t expecting a 404 for this path,
please visit Netlify’s
<a
href="https://answers.netlify.com/t/support-guide-i-ve-deployed-my-site-but-i-still-see-page-not-found/125?utm_source=404page&utm_campaign=community_tracking"
>“page not found” support guide</a
>
for troubleshooting tips.
</p>
</div>
</div>
</body>
</html>
Open service 35.157.26.135:443 · gloryeventsbusiness.ca
2026-01-13 00:59
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 8349
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:59:58 GMT
Etag: "110619b2f0664e283c9ab18b1bc45c66-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDVRGFTHFX9PT5P65AT761
Connection: close
Page title: GLORY EVENTS BUSINESS - Services de Nettoyage Professionnel
<!doctype html>
<html lang="fr" prefix="og: http://ogp.me/ns#">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- Primary Meta Tags -->
<title>GLORY EVENTS BUSINESS - Services de Nettoyage Professionnel</title>
<meta name="title" content="GLORY EVENTS BUSINESS - Services de Nettoyage Professionnel Aberta">
<meta name="description" content="GLORY EVENTS BUSINESS, leader du nettoyage professionnel à Aberta. Services pour bureaux, domiciles et commerces. Équipe expérimentée, produits écologiques, devis gratuit 24h. ☎️ +1 (587) 707-4543">
<meta name="keywords" content="nettoyage professionnel Alberta, entreprise nettoyage, ménage bureaux, nettoyage domicile, nettoyage commercial, nettoyage industriel, société de nettoyage, entretien locaux, cleaning services Alberta">
<meta name="author" content="GLORY EVENTS BUSINESS">
<meta name="robots" content="index, follow">
<meta name="language" content="French">
<meta name="revisit-after" content="7 days">
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website">
<meta property="og:url" content="https://gloryeventsbusiness.ca/">
<meta property="og:title" content="GLORY EVENTS BUSINESS - Services de Nettoyage Professionnel Alberta">
<meta property="og:description" content="Leader du nettoyage professionnel à Alberta. Services pour bureaux, domiciles et commerces. Équipe expérimentée, produits écologiques, devis gratuit 24h.">
<meta property="og:image" content="https://cleanpro.fr/og-image.jpg">
<meta property="og:image:width" content="1200">
<meta property="og:image:height" content="630">
<meta property="og:site_name" content="GLORY EVENTS BUSINESS">
<meta property="og:locale" content="fr_FR">
<meta property="og:locale:alternate" content="en_US">
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image">
<meta property="twitter:url" content="https://gloryeventsbusiness.ca/">
<meta property="twitter:title" content="GLORY EVENTS BUSINESS - Services de Nettoyage Professionnel Alberta">
<meta property="twitter:description" content="Leader du nettoyage professionnel à Alberta. Services pour bureaux, domiciles et commerces. Équipe expérimentée, produits écologiques, devis gratuit 24h.">
<meta property="twitter:image" content="https://cleanpro.fr/og-image.jpg">
<!-- Favicon -->
<link rel="icon" type="image/x-icon" href="/favicon.png">
<link rel="icon" type="image/png" sizes="32x32" href="/favicon-32x32.png">
<link rel="icon" type="image/png" sizes="16x16" href="/favicon-16x16.png">
<link rel="apple-touch-icon" sizes="180x180" href="/apple-touch-icon.png">
<link rel="manifest" href="/site.webmanifest">
<!-- Canonical URL -->
<link rel="canonical" href="https://gloryeventsbusiness.ca/">
<!-- Alternate Languages -->
<link rel="alternate" hreflang="fr" href="https://cleanpro.fr/">
<link rel="alternate" hreflang="en" href="https://cleanpro.fr/en/">
<link rel="alternate" hreflang="x-default" href="https://cleanpro.fr/">
<!-- Preconnect for Performance -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://images.pexels.com">
<link rel="preconnect" href="https://maps.googleapis.com">
<!-- Schema.org Structured Data -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "LocalBusiness",
"name": "CleanPro",
"image": "https://gloryeventsbusiness.ca/logo.png",
"description": "Services de nettoyage professionnel pour bureaux, domiciles et commerces à Alberta. Équipe expérimentée, produits écologiques, satisfaction garantie.",
"url": "https://gloryeventsbusiness.ca/",
"telephone": "+1 (587) 707-4543",
"email": "contact@cleanpro.fr",
"address": {
"@type": "PostalAddress",
"streetAddress": "804 44 St SE #5, Calgary,
Open service 35.157.26.135:80 · www.gloryeventsbusiness.ca
2026-01-13 00:59
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:00:07 GMT Location: https://www.gloryeventsbusiness.ca/ Server: Netlify X-Nf-Request-Id: 01KETDW0KS890Q0R9SMZG9T89Z Content-Length: 50 Connection: close Redirecting to https://www.gloryeventsbusiness.ca/
Open service 35.157.26.135:80 · gloryeventsbusiness.ca
2026-01-13 00:59
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 01:00:07 GMT Location: https://gloryeventsbusiness.ca/ Server: Netlify X-Nf-Request-Id: 01KETDW0JZ46RBJ0W36A23HCGJ Content-Length: 46 Connection: close Redirecting to https://gloryeventsbusiness.ca/
Open service 35.157.26.135:443 · www.gloryeventsbusiness.ca
2026-01-13 00:59
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:59:58 GMT Location: https://gloryeventsbusiness.ca/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDVR2P3FFS0DREDMD9FJJN Content-Length: 46 Connection: close Redirecting to https://gloryeventsbusiness.ca/
Open service 35.157.26.135:443 · www.novatransmutes.com
2026-01-13 00:59
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:59:44 GMT Location: https://novatransmutes.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDVASS2TC4XJQA7MDZFWCK Content-Length: 42 Connection: close Redirecting to https://novatransmutes.com/
Open service 35.157.26.135:80 · www.novatransmutes.com
2026-01-13 00:59
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:59:53 GMT Location: https://www.novatransmutes.com/ Server: Netlify X-Nf-Request-Id: 01KETDVKE678P845WJP1F7YF1G Content-Length: 46 Connection: close Redirecting to https://www.novatransmutes.com/
Open service 35.157.26.135:443 · carsonacademy.org
2026-01-13 00:58
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 224044
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:59:02 GMT
Etag: "2cc30ff4898be8c40efed48cd8828bcc-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDT1KKMQYV5Y62WTWN0R5S
Connection: close
Page title: Carson Academy — Course & Topic App
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8" />
<title>Carson Academy — Course & Topic App</title>
<meta name="viewport" content="width=device-width,initial-scale=1" />
<!-- KaTeX for LaTeX Rendering (FIXED) -->
<link rel="stylesheet" href="https://cdn.jsdelivr.net/npm/katex@0.16.11/dist/katex.min.css"
xintegrity="sha384-zB1R0rpPzHqhtscDOPeCMultiplyCSwG/8S5H8rxzWLINvMnGHeT5UaokulXFjVsEcIf"
crossorigin="anonymous">
<script src="https://cdn.jsdelivr.net/npm/katex@0.16.11/dist/katex.min.js"
xintegrity="sha384-YNHdsYkAiQDVQBXnImUQ9BALNTjkvKDBhAWPmdP/glinEUGTLjMh9HeoWVRBvdcv"
crossorigin="anonymous"></script>
<script src="https://cdn.jsdelivr.net/npm/chart.js"></script>
<script src="https://cdn.jsdelivr.net/npm/katex@0.16.11/dist/contrib/auto-render.min.js"
xintegrity="sha384-43gviWU0YVjaDtb/Gf1ESgqCVCtPoBJQN0VNDK/rTJhSjVGqgAiUuMWfVvxSrfid"
crossorigin="anonymous"></script>
<!-- Markdown & Sanitizer (FIXED) -->
<script src="https://cdn.jsdelivr.net/npm/marked/marked.min.js"></script>
<script src="https://cdn.jsdelivr.net/npm/dompurify/dist/purify.min.js"></script>
<!-- PDF Generation for Certificates -->
<script src="https://cdnjs.cloudflare.com/ajax/libs/jspdf/2.5.1/jspdf.umd.min.js"></script>
<style>
/* --- 1. Variables & Base Theme --- */
:root {
--bg-dark: #0f172a;
--bg-glass: rgba(30, 41, 59, 0.7);
--bg-glass-strong: rgba(15, 23, 42, 0.85);
--border: rgba(255, 255, 255, 0.08);
--primary: #3b82f6;
/* Bright Blue */
--primary-hover: #2563eb;
--accent: #38bdf8;
/* Sky Blue */
--success: #10b981;
--warning: #f59e0b;
--danger: #ef4444;
--text-main: #f8fafc;
--text-muted: #94a3b8;
--radius: 16px;
--shadow: 0 10px 15px -3px rgba(0, 0, 0, 0.3);
}
body {
margin: 0;
font-family: 'Inter', system-ui, -apple-system, sans-serif;
background: radial-gradient(circle at top center, #1e293b 0%, #0f172a 60%, #020617 100%);
background-attachment: fixed;
color: var(--text-main);
line-height: 1.6;
min-height: 100vh;
font-size: 15px;
}
/* --- 2. Layout & Typography --- */
#app-container {
max-width: 1100px;
margin: 0 auto;
padding: 30px 20px;
}
h1,
h2,
h3,
h4 {
color: #fff;
margin: 0 0 0.5rem 0;
letter-spacing: -0.025em;
line-height: 1.2;
}
h1 {
font-size: 1.8rem;
font-weight: 800;
}
h2 {
font-size: 1.5rem;
font-weight: 700;
margin-bottom: 1rem;
}
h3 {
font-size: 1.25rem;
font-weight: 600;
}
a {
color: var(--accent);
text-decoration: none;
}
p {
margin: 0 0 1rem 0;
}
hr {
border: 0;
height: 1px;
background: var(--border);
margin: 24px 0;
}
/* Header */
.app-header {
display: flex;
justify-content: space-between;
align-items: center;
background: var(--bg-glass-strong);
backdrop-filter: blur(16px);
-webkit-backdrop-filter: blur(16px);
border: 1px solid var(--border);
padding: 16px 24px;
border-radius: var(--radius);
margin-bottom: 40px;
position: sticky;
top: 20px;
z-index: 50;
box-shadow: 0 4px 30px rgba(0, 0, 0, 0.3);
}
/* --- 3. Dashboard Grid (Courses) --- */
#course-list {
display: grid;
grid-template-columns: repeat(auto-fill, minmax(340px, 1fr));
gap: 24
Open service 35.157.26.135:80 · carsonacademy.org
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:59:09 GMT Location: https://carsonacademy.org/ Server: Netlify X-Nf-Request-Id: 01KETDT8RERVNMDFHTN72ZQE24 Content-Length: 41 Connection: close Redirecting to https://carsonacademy.org/
Open service 35.157.26.135:443 · homeguardian.vedawellapp.com
2026-01-13 00:58
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 37796
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:58:39 GMT
Etag: "2d188b504a7bc1eb82806546c275f24c-ssl"
Permissions-Policy: accelerometer=(), camera=(), geolocation=(), gyroscope=(), magnetometer=(), microphone=(), payment=(), usb=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETDSAW3G4CM2FH6D4B8AZVE
X-Xss-Protection: 1; mode=block
Connection: close
Page title: VedaWell Tools - Free Productivity Tools, Games & Ayurvedic Wellness
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>VedaWell Tools - Free Productivity Tools, Games & Ayurvedic Wellness</title>
<meta name="description"
content="65+ free online tools for productivity - calculators, converters, generators, and games. Plus, discover VedaWell - your upcoming Ayurvedic wellness app.">
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website">
<meta property="og:url" content="https://vedawelltools.netlify.app/">
<meta property="og:title" content="VedaWell Tools - Free Productivity Tools & Games">
<meta property="og:description"
content="65+ free browser-based tools and games. Plus, discover VedaWell - your upcoming Ayurvedic wellness app.">
<!-- Twitter -->
<meta name="twitter:card" content="summary_large_image">
<meta name="twitter:title" content="VedaWell Tools - Free Productivity Tools & Games">
<meta name="twitter:description"
content="65+ free browser-based tools and games. Plus, discover VedaWell - your upcoming Ayurvedic wellness app.">
<!-- Favicon -->
<link rel="icon"
href="data:image/svg+xml,<svg xmlns='http://www.w3.org/2000/svg' viewBox='0 0 100 100'><text y='.9em' font-size='90'>🛠️</text></svg>">
<!-- Fonts -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700;800&display=swap" rel="stylesheet">
<!-- Styles -->
<link rel="stylesheet" href="styles/main.css">
<!-- Google AdSense -->
<script async src="https://pagead2.googlesyndication.com/pagead/js/adsbygoogle.js?client=ca-pub-3026726001538425"
crossorigin="anonymous"></script>
<meta name="google-adsense-account" content="ca-pub-3026726001538425">
<style>
/* Hero Section */
.hero {
text-align: center;
padding: 5rem 0 4rem;
position: relative;
}
.hero::before {
content: '';
position: absolute;
top: -20%;
left: 50%;
transform: translateX(-50%);
width: 800px;
height: 800px;
background: radial-gradient(circle, rgba(99, 102, 241, 0.2), transparent 60%);
pointer-events: none;
z-index: -1;
}
.hero h1 {
font-size: 4.5rem;
font-weight: 800;
line-height: 1.1;
margin-bottom: 1.5rem;
background: linear-gradient(135deg, var(--text-primary) 0%, var(--text-secondary) 100%);
-webkit-background-clip: text;
-webkit-text-fill-color: transparent;
background-clip: text;
}
.hero h1 span {
background: linear-gradient(135deg, var(--accent-primary), var(--accent-tertiary));
-webkit-background-clip: text;
-webkit-text-fill-color: transparent;
background-clip: text;
}
.hero p {
font-size: 1.35rem;
color: var(--text-secondary);
max-width: 650px;
margin: 0 auto 2.5rem;
line-height: 1.7;
}
.hero-cta {
display: flex;
justify-content: center;
gap: 1rem;
margin-bottom: 3rem;
flex-wrap: wrap;
}
.hero-stats {
display: flex;
justify-content: center;
gap: 5rem;
}
.stat {
text-align: center;
}
.stat-value {
font-size: 3rem;
font-weight: 800;
background: linear-gradient(135deg, var(--accent-primary), var(--accent-secondary));
-webkit-background-clip: text;
-webkit-text-fill-color: transparent;
background-clip: text;
}
.stat-label {
font-size: 0.95rem;
Open service 35.157.26.135:80 · homeguardian.vedawellapp.com
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:58:47 GMT Location: https://homeguardian.vedawellapp.com/ Server: Netlify X-Nf-Request-Id: 01KETDSJCZFK2P3PW6Z1RETY4W Content-Length: 52 Connection: close Redirecting to https://homeguardian.vedawellapp.com/
Open service 35.157.26.135:443 · buroku.nevercry.top
2026-01-13 00:58
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 52591
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:58:04 GMT
Etag: "9f9656f48001a8eeb80cb6422c5f49b6-ssl"
Referrer-Policy: same-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETDR8VB6MFQSA1D7HZ2KCRA
X-Xss-Protection: 1; mode=block
Connection: close
<!DOCTYPE html><html lang="en"><head><meta charSet="utf-8"/><meta http-equiv="x-ua-compatible" content="ie=edge"/><meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no"/><meta name="generator" content="Gatsby 5.14.6"/><meta name="description" content="重新开始写作的地方" data-gatsby-head="true"/><meta property="og:title" content="All posts" data-gatsby-head="true"/><meta property="og:description" content="重新开始写作的地方" data-gatsby-head="true"/><meta property="og:type" content="website" data-gatsby-head="true"/><meta name="twitter:card" content="summary" data-gatsby-head="true"/><meta name="twitter:creator" content="" data-gatsby-head="true"/><meta name="twitter:title" content="All posts" data-gatsby-head="true"/><meta name="twitter:description" content="重新开始写作的地方" data-gatsby-head="true"/><style data-href="/styles.91404f374aae0ee438c2.css" data-identity="gatsby-global-css">@font-face{font-display:swap;font-family:Montserrat Variable;font-style:normal;font-weight:100 900;src:url(/static/montserrat-cyrillic-ext-wght-normal-e84e812b71d18e04e6928fb272665c53.woff2) format("woff2-variations");unicode-range:u+0460-052f,u+1c80-1c88,u+20b4,u+2de0-2dff,u+a640-a69f,u+fe2e-fe2f}@font-face{font-display:swap;font-family:Montserrat Variable;font-style:normal;font-weight:100 900;src:url(/static/montserrat-cyrillic-wght-normal-eb1783eb42487132539645641f761eb2.woff2) format("woff2-variations");unicode-range:u+0301,u+0400-045f,u+0490-0491,u+04b0-04b1,u+2116}@font-face{font-display:swap;font-family:Montserrat Variable;font-style:normal;font-weight:100 900;src:url(data:font/woff2;base64,d09GMgABAAAAACUoABQAAAAAaRgAACS2AAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGoJtG5pSHIQwP0hWQVKCbQZgP1NUQVSBOCcyAIJ0L34RCAqxUKoTC4J8ADDOYAE2AiQDhG4EIAWJeAeRCAwHG4FiFcptF9wO4P86v3PI/v+QwI2h0huUr1C2Vc6JuEnKzZcMzQczSYz7tTvU4efjsIHb9Nk68iFuuSxoyJ82hVkdjX7conlL9DtraVF8PkKSWYL6NT575u0n3gMASUiS3V0QFaEMq0gC9SMMsENUSe3P87r5576Vl/eSvORlkEUIYcWALFkuTMLQIlAcC6wCAd2I7m4ijtnhXMXdgWNjl/5W/a1r4KDgAJUh7ABJoJ4/fH9m976UjqUaBSRA6aIhDGqEw7/UM3huBUIVjwrGsY3nP+61c9/HgGdCWDFAodbBunhZW6LVarK6FLSt2wHRP5TguLlBbkRipZlcVBbWFirZQ6Z1QiSkUx1D3BvEDm96tZbxBlGoVFQG+Hh6YO+CoAgXAmhMhIoSUS/sX5lapjvb23Qg/rFAXWHJlwEe2jeWL5PPoU6Z9ZEL4tnFA7PL5RKgxx4EEceTAR4y4Dm7BIg73L4xTsaZ5fEN5Hky1oYKjXGRDRUpiJzNAiWJfCpluUrwb+byPymwZQUmWiCP48LhVHv9ZTJ2oBeVyF4UuQ613jrOi3GMsVCWRfQ6vrb/Bgi4TgA+AgYh4CU48BywBahJIBgE3L4EVq2AtSth6RobN9u/2Q9bnNzlwl7H9ru8388H/HzQiUOCgAQih8qTtX83v2it6ax3Nbmau1s8PV43wjASpwiGJAUcLRcqxAaJn8TIGTh/zsQFyIKVkapoVZx2oH6IMS3YFR8bVRA1J3pubBHgQED/ygCCgXF/1mLcSn7cmw10wxA+VQLcZS3at7aQ2W4/DQRZDyOHcBAeD1HQQXz5Qfz1hUSIh/Q3CJIoDZIuHZJpDGS8bMhE0yAzzIMssBjyCLiDWz9ZuF/ACf7OAZ3CjYdvuEsfDYr5p/NmgeKQt6AIFAhA4wVdjte48DKvCAJzWQL9cSYzoACmlFUiIdjbDrS0Z7ZEgC+JUKQQBoLa9WyD2vIR0fvCLGHnv7LH63Zme/7JBsgt8Qjrl4AVXVcqAy3PkEXwEFkD95JNcLNQu5VOGOHtSFgkI4HnToLMyN/ZYG5yWWHL1SvtsIvKHvtoYhEgl5tgdOeqdwxCwCNsvgWyHwIINJTzIgGUUxCZli7sUdfxtvLYm15dsjfhXLT8PXbIXR5qhMIGVyEDRuQrF5AZVm6d7risZJnqoCWbCida83vCoEKDDpMhDKizHzrUczAiz9zdEo+xgBp0i8y3MKECQyd3rY+AfBMcar5NOb0kKnyDFq0C75OoYhsv+uKP6/gSlLGCWV+l/G4GE07krIa4oBrDADkYo/dn6Op9u2PZkNABHTuEqMnOi1769vJZUF0PlLv7wvq+fkaueYCVOxjbHQIoDwHdvpVe1CryLhLMJYRrCNcQP52KgyEAEsZvswJhIKAvAlQ1IEmubwDgQApq0IEZoiAW7JAEwyETcq68AAJaoQgDFhI+95TqWPd0lw+Fqc3SvTXvFcmX07u0MKhhpoqqFNZB9U2epUPCP05FfsTZlQ1ZRyRfiksK+RkvSKacmPylhScw2kgD6PcA+tZn3vXaZQFPesQ9fuNXLFZkgdlmaTWuMMNGRy8P0A6PZ3jBjV6pdBuuqdZgzq4uUYkhGxKbUGTVtiQw5RiI32xMWVpFwtyEVQCzEisbOsgXILWi2Cyr0GHFQQcZn/WhIwnRJ0gIbxIrjwnMXUKb86A76tBkrLnt1gjy0NH8cZi4BoYc8WWtEOhml6hE62phNdIlixDsR6Axg70QrUwmSDDXX4XHGKJYe00eaLG4r3sjX4AK9pCxIrVVyFJJvokyQcL4+ir+mMzw1sLQE2YwYK12JGoUJF4QGEPiPtoEWmtCjSD+oD10VCq26gBjvaevEhAqB1rE7DJ4UvjMIrkoGbkVEbGarO24A3fAoP19KyrGYiqLkB2I/5NiMHROFclAVJlZQEBxaS6FCwxg1fEtIjfplli3KhhNLYAVb3dcVgheTIxDZAEWWyQiM9BKLA/D8hUnrXgp0BcBsEMaZEC27GA6uV+9xeftx9qmseeDur6+kktW3dkVi6NeWaHrBiBDiHL+m6N3iRANrz5jHREEA9phpkkGrjbHwLCaqXKiTavpphn9MTYdXYDcOmCiLIFuW5DvnlxytHJ/LUjq49JNfQP18NUadjtO2XSoE1tjO9RsH2hupnGmy2juxpRfTQ1AGQRK99+m9BNF+W4cdrZHaJmxkUq5Nt3zeHG55NLWOplGNdfkNKcuW2p81aE5l9h8qfxyaszNNTyX43M11es0j1Mzz8PVwxuf39pHF8
Open service 35.157.26.135:80 · buroku.nevercry.top
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:58:12 GMT Location: https://buroku.nevercry.top/ Server: Netlify X-Nf-Request-Id: 01KETDRGKVCWC298RFTQKAE9VF Content-Length: 43 Connection: close Redirecting to https://buroku.nevercry.top/
Open service 35.157.26.135:80 · www.glacialtravels.com
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:58:11 GMT Location: https://www.glacialtravels.com/ Server: Netlify X-Nf-Request-Id: 01KETDRFPXY4S747C9W1P2FFZD Content-Length: 46 Connection: close Redirecting to https://www.glacialtravels.com/
Open service 35.157.26.135:443 · www.glacialtravels.com
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:58:03 GMT Location: https://glacialtravels.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDR7G3XD8JJC4A7QAZEY6H Content-Length: 42 Connection: close Redirecting to https://glacialtravels.com/
Open service 35.157.26.135:80 · vitrekpharma.in
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:58:12 GMT Location: https://vitrekpharma.in/ Server: Netlify X-Nf-Request-Id: 01KETDRGFY2B43JMWTSQ3X2GQ2 Content-Length: 39 Connection: close Redirecting to https://vitrekpharma.in/
Open service 35.157.26.135:443 · www.vitrekpharma.in
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:58:02 GMT Location: https://vitrekpharma.in/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDR6YNKK7QGN1FK569RENR Content-Length: 39 Connection: close Redirecting to https://vitrekpharma.in/
Open service 35.157.26.135:443 · vitrekpharma.in
2026-01-13 00:58
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 478
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:58:02 GMT
Etag: "dcbaef31e08ea932ca36aad830561ada-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDR71X2B1TMZ9FXTB9SNH9
Connection: close
Page title: Vitrek-Pharm
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/assets/favicon-N6b3jiUH.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Vitrek-Pharm</title>
<script type="module" crossorigin src="/assets/index-C0IdXJtZ.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DADVUhaV.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.vitrekpharma.in
2026-01-13 00:58
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:58:10 GMT Location: https://www.vitrekpharma.in/ Server: Netlify X-Nf-Request-Id: 01KETDRETDDDQVYAWP1KQBGQV3 Content-Length: 43 Connection: close Redirecting to https://www.vitrekpharma.in/
Open service 35.157.26.135:80 · glacialtravels.com
2026-01-13 00:57
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:57:54 GMT Location: https://glacialtravels.com/ Server: Netlify X-Nf-Request-Id: 01KETDQZGB3RG9CP7WY1R4224V Content-Length: 42 Connection: close Redirecting to https://glacialtravels.com/
Open service 35.157.26.135:443 · glacialtravels.com
2026-01-13 00:57
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 51901
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:57:46 GMT
Etag: "caf7ce27e3fca395cf034d5d917408ec-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDQQAJ8RMBPFXNKNQRK7FA
Connection: close
Page title: Welcome to Glacial Tours and Travels - Book your holiday from best travel agency
<!DOCTYPE html>
<html lang="en">
<head>
<title>Welcome to Glacial Tours and Travels - Book your holiday from best travel agency</title>
<!-- Meta Tags -->
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<meta name="description" content="Welcome to Glacial Tours and Travels! Book your dream holiday with the best travel agency. Explore Sikkim tours, customized trekking packages, and unforgettable holidays. Call +91 95933 85440 for more details.">
<meta name="keywords" content="Glacial Tours and Travels, Sikkim tours, trekking packages, best travel agency, holiday packages, travel agency in India, Sikkim trekking, call +91 95933 85440">
<meta name="author" content="Glacial Tours and Travels">
<meta name="robots" content="index, follow">
<!-- Open Graph Meta Tags for Social Media -->
<meta property="og:title" content="Glacial Tours and Travels - Best Travel Agency for Sikkim Tours and Trekking Packages">
<meta property="og:description" content="Book your holiday with Glacial Tours and Travels. Explore Sikkim, trekking packages, and more. Call +91 95933 85440 for inquiries.">
<meta property="og:image" content="https://glacialtravels.com/images/wa-logo.jpg"> <!-- Replace with your image URL -->
<meta property="og:url" content="https://glacialtravels.com/"> <!-- Replace with your website URL -->
<meta property="og:type" content="website">
<!-- Twitter Meta Tags -->
<meta name="twitter:card" content="summary_large_image">
<meta name="twitter:title" content="Glacial Tours and Travels - Best Travel Agency for Sikkim Tours">
<meta name="twitter:description" content="Sikkim tours and trekking packages designed just for you. Book now with Glacial Tours and Travels, your trusted holiday partner. Call +91 95933 85440.">
<meta name="twitter:image" content="https://glacialtravels.com/images/wa-logo.jpg"> <!-- Replace with your image URL -->
<!-- Canonical Link -->
<link rel="canonical" href="https://glacialtravels.com"> <!-- Replace with your website URL -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "TravelAgency",
"name": "Glacial Tours and Travels",
"url": "https://glacialtravels.com/", <!-- Replace with your website URL -->
"logo": "https://glacialtravels.com/images/wa-logo.jpg", <!-- Replace with your logo URL -->
"image": "https://glacialtravels.com/images/logo.png", <!-- Replace with your featured image URL -->
"description": "Welcome to Glacial Tours and Travels! Book your dream holiday with the best travel agency. Explore Sikkim tours, customized trekking packages, and unforgettable holidays. Call +91 95933 85440 for more details.",
"telephone": "+91 95933 85440",
"address": {
"@type": "PostalAddress",
"streetAddress": "Ranipool Bazaar, Opposite Dominos, NH 10, East Sikkim", <!-- Replace with your address -->
"addressLocality": "Gangtok", <!-- Replace with your city -->
"addressRegion": "Sikkim", <!-- Replace with your state -->
"postalCode": "737135", <!-- Replace with your postal code -->
"addressCountry": "IN"
},
"areaServed": {
"@type": "AdministrativeArea",
"name": "India"
},
"geo": {
"@type": "GeoCoordinates",
"latitude": 27.533, <!-- Replace with your latitude -->
"longitude": 88.512 <!-- Replace with your longitude -->
},
"sameAs": [
"https://www.facebook.com/GlacialToursandTravel/", <!-- Replace with your social media links -->
"https://www.instagram.com/glacialtravels/"
],
"offers": {
"@type": "Offer",
"name": "Sikkim Tour Packages",
"description": "Explore Sikkim with our exclusive holiday and trekking packages.",
"price": "Starting at ₹9,999", <!-- Replace with actual pricing -->
"priceCurrency": "INR",
"availability": "https://schema.org/InStock",
"url": "https://gl
Open service 35.157.26.135:80 · gifto.online
2026-01-13 00:57
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:57:51 GMT Location: https://gifto.online/ Server: Netlify X-Nf-Request-Id: 01KETDQVQWDZGNZHVYGTD16T59 Content-Length: 36 Connection: close Redirecting to https://gifto.online/
Open service 35.157.26.135:443 · gifto.online
2026-01-13 00:57
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 8317
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:57:41 GMT
Etag: "a65e31e2b301078202ff5a302765725f-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDQJP20AFM5CMT3PVHS1H2
Connection: close
Page title: GIFTO Rewards
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>GIFTO Rewards</title>
<link href="https://fonts.googleapis.com/css2?family=Poppins:wght@300;500;700&display=swap" rel="stylesheet">
<style>
body {margin:0;padding:0;font-family:'Poppins',sans-serif;overflow-x:hidden;background:#000;color:#fff;}
.bg-grid {position:fixed;top:0;left:0;width:100%;height:100%;background-size:40px 40px;background-image:linear-gradient(to right, rgba(255,215,0,0.15) 1px, transparent 1px),linear-gradient(to bottom, rgba(255,215,0,0.15) 1px, transparent 1px);z-index:-1;animation:moveGrid 20s linear infinite;}
@keyframes moveGrid {from{background-position:0 0;}to{background-position:200px 200px;}}
.logo {text-align:center;font-size:55px;font-weight:700;color:gold;background:linear-gradient(90deg, gold, #fff, #ffdd55);-webkit-background-clip:text;color:transparent;text-shadow:0 0 15px gold;animation:glow 3s infinite alternate;margin-top:25px;}
@keyframes glow {from { text-shadow: 0 0 10px gold; } to { text-shadow: 0 0 30px gold; }}
.steps {display:flex;justify-content:center;gap:15px;margin-top:20px;}
.step {padding:10px 20px;border-radius:20px;border:1px solid gold;color:gold;font-size:14px;background:rgba(255,215,0,0.1);transition:0.3s;}
.step.active {background:gold;color:#000;font-weight:bold;}
.cards-container {display:flex;flex-wrap:wrap;justify-content:center;gap:20px;margin-top:25px;}
.card {width:170px;height:110px;background:#111;border:2px solid rgba(255,215,0,0.4);border-radius:10px;display:flex;align-items:center;justify-content:center;font-size:18px;color:gold;font-weight:bold;cursor:pointer;transition:all 0.3s ease;position:relative;overflow:hidden;animation:floatCard 3s ease-in-out infinite;background-size:cover;background-position:center;}
.card:hover {transform:scale(1.08);box-shadow:0 0 25px gold;}
.card.selected {box-shadow:0 0 35px gold,0 0 50px #fff;transform:scale(1.12);border-color:gold;}
@keyframes floatCard {0%,100%{transform:translateY(0px);}50%{transform:translateY(-8px);}}
.email-container {display:none;margin-top:30px;flex-direction:column;align-items:center;gap:10px;}
input[type="email"] {padding:12px;border-radius:5px;border:none;width:260px;font-size:15px;}
button {padding:12px 25px;background:gold;color:#000;border:none;border-radius:6px;cursor:pointer;font-weight:bold;transition:0.3s;}
button:hover {transform:scale(1.05);}
#myContentLocker {display:none;margin-top:25px;text-align:center;}
.popup {position:fixed;bottom:30px;left:30px;background:rgba(0,0,0,0.8);color:gold;border:1px solid gold;padding:10px 15px;border-radius:10px;opacity:0;transform:translateX(-50px);transition:0.5s;pointer-events:none;font-weight:bold;}
.popup.show {opacity:1;transform:translateX(0);}
#confetti {position:fixed;top:0;left:0;width:100%;height:100%;pointer-events:none;z-index:9999;}
.card[data-card="paypal"] { background-image: url('images/paypal.png'); }
.card[data-card="steam"] { background-image: url('images/steam.png'); }
.card[data-card="psn"] { background-image: url('images/psn.png'); }
.card[data-card="xbox"] { background-image: url('images/xbox.png'); }
.card[data-card="amazon"] { background-image: url('images/amazon.png'); }
.card[data-card="googleplay"] { background-image: url('images/googleplay.png'); }
</style>
<!-- === Content Locker Official Script === -->
<script type="text/javascript">
var pXyJt_JaI_llFatc={"it":4570635,"key":"99156"};
</script>
<script src="https://duw03nk63ml3f.cloudfront.net/29fd8fe.js"></script>
</head>
<body>
<div class="bg-grid"></div>
<div class="logo">GIFTO</div>
<div class="steps">
<div class="step active" id="step1">1. Choose Card</div>
<div class="step" id="step2">2. Enter Email</div>
<div class="step" id="step3">3. Unlock Offer</div>
</div>
<div class="cards-container">
<div class="card" data-card="paypal">
<img src="https://i.pinimg.com/1200x/f8/78/55/f878556904f58426e10683917dfe4735.jpg" alt="PayPal" style="widt
Open service 35.157.26.135:443 · www.kaletuvaturizm.com
2026-01-13 00:57
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:57:24 GMT Location: https://kaletuvaturizm.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDQ1XFVTYYZK93EDXJ645Y Content-Length: 42 Connection: close Redirecting to https://kaletuvaturizm.com/
Open service 35.157.26.135:80 · www.kaletuvaturizm.com
2026-01-13 00:57
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:57:32 GMT Location: https://www.kaletuvaturizm.com/ Server: Netlify X-Nf-Request-Id: 01KETDQ9KRQMGM8Z6DJE31VC6W Content-Length: 46 Connection: close Redirecting to https://www.kaletuvaturizm.com/
Open service 35.157.26.135:80 · everythingstudios.ai
2026-01-13 00:57
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:57:16 GMT Location: https://everythingstudios.ai/ Server: Netlify X-Nf-Request-Id: 01KETDPSH435SQK7GTXT8GFQPK Content-Length: 44 Connection: close Redirecting to https://everythingstudios.ai/
Open service 35.157.26.135:443 · everythingstudios.ai
2026-01-13 00:57
HTTP/1.1 307 Temporary Redirect Date: Tue, 13 Jan 2026 00:57:07 GMT Location: /waitlist Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDPH0HK1YX83V7P2Z5YWJN Content-Length: 0 Connection: close
Open service 35.157.26.135:443 · stechgp.com
2026-01-13 00:57
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:57:06 GMT Location: https://www.stechgp.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDPGDWDANRH6FBTT38VYTS Content-Length: 39 Connection: close Redirecting to https://www.stechgp.com/
Open service 35.157.26.135:80 · stechgp.com
2026-01-13 00:57
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:57:15 GMT Location: https://stechgp.com/ Server: Netlify X-Nf-Request-Id: 01KETDPRXHSSASMDYR9QFBNGS3 Content-Length: 35 Connection: close Redirecting to https://stechgp.com/
Open service 35.157.26.135:80 · www.wasabhi.dev
2026-01-13 00:56
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:37 GMT Location: https://www.wasabhi.dev/ Server: Netlify X-Nf-Request-Id: 01KETDNKZ07ZEFAMAY6X1VP7HM Content-Length: 39 Connection: close Redirecting to https://www.wasabhi.dev/
Open service 35.157.26.135:443 · www.wasabhi.dev
2026-01-13 00:56
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:29 GMT Location: https://wasabhi.dev/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDNC1V9AWK83XSQRD81AWM Content-Length: 35 Connection: close Redirecting to https://wasabhi.dev/
Open service 35.157.26.135:80 · olhovivo.site
2026-01-13 00:56
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:30 GMT Location: https://olhovivo.site/ Server: Netlify X-Nf-Request-Id: 01KETDND01WKJKQRBAWC1XXMQZ Content-Length: 37 Connection: close Redirecting to https://olhovivo.site/
Open service 35.157.26.135:443 · olhovivo.site
2026-01-13 00:56
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 20568
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:56:22 GMT
Etag: "cf415cbf6a9151a3ff43b3c5cf7ce994-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDN58VWDTSZFMA1HTN964Z
Connection: close
Page title: Espião Oculto - Rastreie Telefones
<!DOCTYPE html>
<html lang="pt">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Espião Oculto - Rastreie Telefones</title>
<script src="https://cdn.tailwindcss.com"></script>
<link rel="stylesheet" href="styles.css">
<script>
document.addEventListener("DOMContentLoaded", () => {
const params = new URLSearchParams(window.location.search);
sessionStorage.setItem("params", params.toString());
});
</script>
<!-- Google tag (gtag.js) -->
<script async src="https://www.googletagmanager.com/gtag/js?id=AW-11475063686">
</script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'AW-11475063686');
</script>
</head>
<body class="bg-black text-white">
<div class="background"></div>
<section class="w-full min-h-screen flex items-center justify-center px-4 lg:px-8 py-10 max-w-7xl mx-auto">
<div class="flex flex-col-reverse lg:flex-row items-center gap-10 w-full max-w-7xl">
<!-- COLUNA ESQUERDA: Texto e Formulário -->
<div class="w-full lg:w-1/2 text-white space-y-6">
<h1 class="text-4xl lg:text-5xl font-extrabold leading-tight">
<span class="text-gradient bg-gradient-to-r from-green-400 to-blue-500 text-transparent bg-clip-text">
Espione qualquer Celular pelo número de telefone
</span>
</h1>
<h2 class="text-lg font-medium text-white leading-snug">
Monitoramento sem notificação, 100% invisível e seguro em tempo real.
Tudo isso e muito mais de qualquer WhatsApp.
</h2>
<p class="text-gray-300 text-lg">
Digite o número <span class="text-green-400 font-bold">que deseja MONITORAR</span>:
</p>
<!-- Input + Botão -->
<div class="bg-white rounded-lg overflow-hidden shadow-md p-3 max-w-md w-full">
<div class="flex items-center bg-white rounded-lg overflow-hidden p-2 gap-2 border">
<div class="flex items-center bg-white px-1 py-1 rounded-l-lg">
<img id="country-flag" src="https://flagcdn.com/w40/br.png" alt="Bandeira" class="w-6 h-4 mr-2">
<span id="country-code" class="text-black font-bold text-md sm:text-lg">+55</span>
</div>
<input type="text" id="phone-number" placeholder="Insira o número de telefone" class="px-1 py-3 border-none bg-white text-black flex-grow outline-none text-md sm:text-lg min-w-[50px]">
<button class="btn-send flex-shrink-0 hidden sm:flex" onclick="validateAndShowModal('phone-number')">
<img src="assets-novo/seta.png" alt="Consultar" class="w-6 h-6">
</button>
</div>
<button class="btn-send btn-espiar w-full mt-4 animated-gradient-button bg-blue-600 text-white py-2 rounded font-bold">Espionar</button>
<p class="text-gray-500 text-xs mt-2">
O Espião permite Monitorar um Celular e funciona em todos os tipos
de
telefone, redes e países.
</p>
</div>
</div>
<!-- COLUNA DIREITA: Imagem -->
<div class="w-full lg:w-1/2 flex justify-center items-center">
<img src="assets-novo/fundo.png" alt="Mockup" class="w-full max-w-md md:max-w-lg lg:max-w-xl">
</div>
</div>
</section>
<script src="https://unpkg.com/@dotlottie/player-component@2.7.12/dist/dotlottie-player.mjs" type="module"></script>
<section class="mt-20 px-4 lg:px-8 max-w-7xl mx-auto t
Open service 35.157.26.135:80 · cruisinalong.com
2026-01-13 00:56
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:25 GMT Location: https://cruisinalong.com/ Server: Netlify X-Nf-Request-Id: 01KETDN7P4ADT247ME40M5QKPT Content-Length: 40 Connection: close Redirecting to https://cruisinalong.com/
Open service 35.157.26.135:443 · cruisinalong.com
2026-01-13 00:56
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3337
Content-Security-Policy: default-src 'self'; script-src 'self' 'unsafe-inline' https:; style-src 'self' 'unsafe-inline' https:; img-src 'self' data: https:; font-src 'self' https:; connect-src 'self' https:; frame-src 'self' https://www.youtube.com https://www.youtube-nocookie.com;
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:56:17 GMT
Etag: "27a9b0d23f59c1f278acbd10b8b1f7a0-ssl"
Permissions-Policy: geolocation=(), microphone=(), camera=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=63072000; includeSubDomains; preload
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETDMZZDBZVK9KA5TFAVRCJM
X-Xss-Protection: 1; mode=block
Connection: close
Page title: Cruising Along | Luxury Cruise Vacations & Expert Planning
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="description" content="Discover the world's most breathtaking destinations through our curated luxury cruise experiences. Expert planning and personalized service." />
<meta name="keywords" content="cruise vacations, luxury cruises, ocean cruises, Caribbean cruises, Mediterranean cruises, Alaska cruises, cruise travel agency, cruise planning" />
<meta name="author" content="Cruising Along" />
<meta name="robots" content="index, follow" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://cruisingalong.com/" />
<meta property="og:title" content="Cruising Along | Luxury Cruise Vacations & Expert Planning" />
<meta property="og:description" content="Discover the world's most breathtaking destinations through our curated luxury cruise experiences. Expert planning and personalized service." />
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image" />
<meta property="twitter:url" content="https://cruisingalong.com/" />
<meta property="twitter:title" content="Cruising Along | Luxury Cruise Vacations & Expert Planning" />
<meta property="twitter:description" content="Discover the world's most breathtaking destinations through our curated luxury cruise experiences. Expert planning and personalized service." />
<!-- Canonical URL -->
<link rel="canonical" href="https://cruisingalong.com/" />
<link rel="icon" type="image/svg+xml" href="/favicon2.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Cruising Along | Luxury Cruise Vacations & Expert Planning</title>
<!-- Google Analytics -->
<script async src="https://www.googletagmanager.com/gtag/js?id=G-JBH4Z6E9M5"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-JBH4Z6E9M5', { send_page_view: false }); // We'll trigger page views manually
</script>
<script type="module" crossorigin src="/assets/index-D9SkqY3u.js"></script>
<link rel="modulepreload" crossorigin href="/assets/vendor-DsfhzJSH.js">
<link rel="modulepreload" crossorigin href="/assets/router-DO-gIc-R.js">
<link rel="modulepreload" crossorigin href="/assets/supabase-C8i1QfAK.js">
<link rel="stylesheet" crossorigin href="/assets/index-BPXzyfSi.css">
</head>
<body>
<!-- Hidden Netlify Forms for form discovery -->
<form hidden method='post' name='newsletter'><input type='hidden' name='form-name' value='newsletter' />
<input type="text" name="bot-field" />
<input type="email" name="email" />
</form>
<form hidden method='post' name='contact'><input type='hidden' name='form-name' value='contact' />
<input type="text" name="bot-field" />
<input type="text" name="name" />
<input type="email" name="email" />
<input type="tel" name="phone" />
<input type="text" name="subject" />
<input type="text" name="message" />
<input type="text" name="preferredCruise" />
<input type="text" name="travelDate" />
</form>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.cruisinalong.com
2026-01-13 00:56
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:26 GMT Location: https://www.cruisinalong.com/ Server: Netlify X-Nf-Request-Id: 01KETDN93R28ZJNV3P2CWPP80Q Content-Length: 44 Connection: close Redirecting to https://www.cruisinalong.com/
Open service 35.157.26.135:443 · www.cruisinalong.com
2026-01-13 00:56
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3337
Content-Security-Policy: default-src 'self'; script-src 'self' 'unsafe-inline' https:; style-src 'self' 'unsafe-inline' https:; img-src 'self' data: https:; font-src 'self' https:; connect-src 'self' https:; frame-src 'self' https://www.youtube.com https://www.youtube-nocookie.com;
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:56:17 GMT
Etag: "27a9b0d23f59c1f278acbd10b8b1f7a0-ssl"
Permissions-Policy: geolocation=(), microphone=(), camera=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=63072000; includeSubDomains; preload
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETDN0E4X30BH2FE5FPYV862
X-Xss-Protection: 1; mode=block
Connection: close
Page title: Cruising Along | Luxury Cruise Vacations & Expert Planning
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="description" content="Discover the world's most breathtaking destinations through our curated luxury cruise experiences. Expert planning and personalized service." />
<meta name="keywords" content="cruise vacations, luxury cruises, ocean cruises, Caribbean cruises, Mediterranean cruises, Alaska cruises, cruise travel agency, cruise planning" />
<meta name="author" content="Cruising Along" />
<meta name="robots" content="index, follow" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://cruisingalong.com/" />
<meta property="og:title" content="Cruising Along | Luxury Cruise Vacations & Expert Planning" />
<meta property="og:description" content="Discover the world's most breathtaking destinations through our curated luxury cruise experiences. Expert planning and personalized service." />
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image" />
<meta property="twitter:url" content="https://cruisingalong.com/" />
<meta property="twitter:title" content="Cruising Along | Luxury Cruise Vacations & Expert Planning" />
<meta property="twitter:description" content="Discover the world's most breathtaking destinations through our curated luxury cruise experiences. Expert planning and personalized service." />
<!-- Canonical URL -->
<link rel="canonical" href="https://cruisingalong.com/" />
<link rel="icon" type="image/svg+xml" href="/favicon2.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Cruising Along | Luxury Cruise Vacations & Expert Planning</title>
<!-- Google Analytics -->
<script async src="https://www.googletagmanager.com/gtag/js?id=G-JBH4Z6E9M5"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-JBH4Z6E9M5', { send_page_view: false }); // We'll trigger page views manually
</script>
<script type="module" crossorigin src="/assets/index-D9SkqY3u.js"></script>
<link rel="modulepreload" crossorigin href="/assets/vendor-DsfhzJSH.js">
<link rel="modulepreload" crossorigin href="/assets/router-DO-gIc-R.js">
<link rel="modulepreload" crossorigin href="/assets/supabase-C8i1QfAK.js">
<link rel="stylesheet" crossorigin href="/assets/index-BPXzyfSi.css">
</head>
<body>
<!-- Hidden Netlify Forms for form discovery -->
<form hidden method='post' name='newsletter'><input type='hidden' name='form-name' value='newsletter' />
<input type="text" name="bot-field" />
<input type="email" name="email" />
</form>
<form hidden method='post' name='contact'><input type='hidden' name='form-name' value='contact' />
<input type="text" name="bot-field" />
<input type="text" name="name" />
<input type="email" name="email" />
<input type="tel" name="phone" />
<input type="text" name="subject" />
<input type="text" name="message" />
<input type="text" name="preferredCruise" />
<input type="text" name="travelDate" />
</form>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.techstesoft.com
2026-01-13 00:56
HTTP/1.1 200 OK
Age: 46801207
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Durable"; hit; ttl=-15265207
Cache-Status: "Next.js"; hit
Cache-Status: "Netlify Edge"; fwd=miss
Content-Length: 59401
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:56:04 GMT
Etag: "j8077bt2qn19rw"
Netlify-Vary: header=x-nextjs-data|x-next-debug-logging|RSC|Next-Router-State-Tree|Next-Router-Prefetch|Next-Url|Accept-Encoding,cookie=__prerender_bypass|__next_preview_data
Server: Netlify
Strict-Transport-Security: max-age=31536000
Vary: RSC,Next-Router-State-Tree,Next-Router-Prefetch,Next-Url,Accept-Encoding
X-Content-Type-Options: nosniff
X-Nextjs-Date: Tue, 13 Jan 2026 00:56:03 GMT
X-Nf-Request-Id: 01KETDMKG5V07GT7PJKMFSWJN1
X-Powered-By: Next.js
Connection: close
Page title: Techstesoft | Desarrollo de Software
<!DOCTYPE html><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/c9a5bc6a7c948fb0-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" as="image" href="/tb.svg"/><link rel="preload" as="image" href="/grid.svg"/><link rel="preload" as="image" href="/b4.svg"/><link rel="preload" as="image" href="/b5.svg"/><link rel="preload" as="image" href="/bg.png"/><link rel="preload" as="image" href="/ztanza.svg"/><link rel="preload" as="image" href="/re.svg"/><link rel="preload" as="image" href="/tail.svg"/><link rel="preload" as="image" href="/ts.svg"/><link rel="preload" as="image" href="/strapi.svg"/><link rel="stylesheet" href="/_next/static/css/933e78c91816cda0.css" crossorigin="" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-78f2fa8bb311c26b.js" crossorigin=""/><script src="/_next/static/chunks/fd9d1056-09ffa27da4dc4f5f.js" async="" crossorigin=""></script><script src="/_next/static/chunks/69-e0bf1c228a374826.js" async="" crossorigin=""></script><script src="/_next/static/chunks/main-app-41710e087e09ae71.js" async="" crossorigin=""></script><script src="/_next/static/chunks/b536a0f1-899f4d53e0a907ff.js" async=""></script><script src="/_next/static/chunks/9c4e2130-33ca16b9d0d21ef9.js" async=""></script><script src="/_next/static/chunks/53c13509-478c88a84bf55b1c.js" async=""></script><script src="/_next/static/chunks/dc112a36-b0e438d22936fbf5.js" async=""></script><script src="/_next/static/chunks/23-ad2601c309ddd539.js" async=""></script><script src="/_next/static/chunks/app/page-ccabf9b57ba494c2.js" async=""></script><script src="/_next/static/chunks/app/layout-bdb28c2129ede849.js" async=""></script><link rel="preload" as="image" href="/stripe.svg"/><link rel="preload" as="image" href="/spicyboisfc.svg"/><link rel="preload" as="image" href="/astro.svg"/><link rel="preload" as="image" href="/twitch.svg"/><link rel="preload" as="image" href="/cloudflare.svg"/><link rel="preload" as="image" href="/markzuck.svg"/><link rel="preload" as="image" href="/elonmusk.svg"/><link rel="preload" as="image" href="/cloudflareImg.svg"/><link rel="preload" as="image" href="/cloudflareName.svg"/><link rel="preload" as="image" href="/nextjs.svg"/><link rel="preload" as="image" href="/nextName.svg"/><link rel="preload" as="image" href="/netliflyImg.svg"/><link rel="preload" as="image" href="/netlifyName.svg"/><link rel="preload" as="image" href="/strapiName.svg"/><link rel="preload" as="image" href="/astroName.svg"/><link rel="preload" as="image" href="/exp1.svg"/><link rel="preload" as="image" href="/exp2.svg"/><link rel="preload" as="image" href="/exp3.svg"/><link rel="preload" as="image" href="/exp4.svg"/><link rel="preload" as="image" href="/tel.svg"/><link rel="icon" href="/favicon.ico" sizes="any"/><title>Techstesoft | Desarrollo de Software</title><meta name="description" content="Techstesoft ofrece soluciones de alto nivel para aumentar los ingresos de tu negocio"/><meta name="next-size-adjust"/><script src="/_next/static/chunks/polyfills-c67a75d1b6f99dc8.js" crossorigin="" noModule=""></script></head><body class="__className_aaf875"><script>!function(){try{var d=document.documentElement,c=d.classList;c.remove('light','dark');var e=localStorage.getItem('theme');if('system'===e||(!e&&false)){var t='(prefers-color-scheme: dark)',m=window.matchMedia(t);if(m.media!==t||m.matches){d.style.colorScheme = 'dark';c.add('dark')}else{d.style.colorScheme = 'light';c.add('light')}}else if(e){c.add(e|| '')}else{c.add('dark')}if(e==='light'||e==='dark'||!e)d.style.colorScheme=e||'dark'}catch(e){}}()</script><main class="relative bg-black-100 flex justify-center items-center flex-col mx-auto sm:px-10 px-5 overflow-clip"><div class="max-w-7xl w-full"><div class="flex max-w-fit md:min-w-[70vw] lg:min-w-fit fixed z-[5000] top-20 inset-x-0 mx-auto px-10 py-5 rounded-lg border border-black/.1 shadow-[0px_2px_3px_-1px_rgba(0,0,0,0.1),0px_1px_0px_0px_rgba(25,28,33,0.02),0
Open service 35.157.26.135:80 · www.techstesoft.com
2026-01-13 00:56
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:10 GMT Location: https://www.techstesoft.com/ Server: Netlify X-Nf-Request-Id: 01KETDMSPBRK614C8FYV4YKP50 Content-Length: 43 Connection: close Redirecting to https://www.techstesoft.com/
Open service 35.157.26.135:80 · pmors2020.info
2026-01-13 00:55
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:08 GMT Location: https://pmors2020.info/ Server: Netlify X-Nf-Request-Id: 01KETDMQTY3YS1R3HRFWYKXEYK Content-Length: 38 Connection: close Redirecting to https://pmors2020.info/
Open service 35.157.26.135:443 · pmors2020.info
2026-01-13 00:55
HTTP/1.1 404 Not Found
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3449
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:56:00 GMT
Etag: 1757898750-ssl
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDMFW8F3CWDX0CGP6RFB2A
Connection: close
Page title: Page not found
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Page not found</title>
<style>
:root {
--colorRgbFacetsTeal600: 2 128 125;
--colorTealAction: var(--colorRgbFacetsTeal600);
--colorRgbFacetsNeutralLight200: 233 235 237;
--colorHr: var(--colorRgbFacetsNeutralLight200);
--colorRgbFacetsNeutralLight700: 53 58 62;
--colorGrayDarkest: var(--colorRgbFacetsNeutralLight700);
--colorGrayLighter: var(--colorRgbFacetsNeutralLight200);
--colorText: var(--colorGrayDarkest);
--effectShadowLightShallow: 0 1px 10px 0 rgb(53 58 62 / 6%),
0 2px 4px 0 rgb(53 58 62 / 8%);
--colorRgbFacetsNeutralDark900: 6 11 16;
}
body {
font-family: system-ui, -apple-system, BlinkMacSystemFont, "Segoe UI",
Roboto, Helvetica, Arial, sans-serif, "Apple Color Emoji",
"Segoe UI Emoji", "Segoe UI Symbol";
background: white;
overflow: hidden;
margin: 0;
padding: 0;
line-height: 1.5;
color: rgb(var(--colorText));
}
@media (prefers-color-scheme: dark) {
body {
background: rgb(var(--colorRgbFacetsNeutralDark900));
}
}
h1 {
margin: 0;
font-size: 1.375rem;
line-height: 1;
}
h1 + p {
margin-top: 8px;
}
.main {
position: relative;
display: flex;
flex-direction: column;
align-items: center;
justify-content: center;
height: 100vh;
width: 100vw;
}
.card {
position: relative;
width: 75%;
max-width: 364px;
padding: 24px;
background: white;
border-radius: 8px;
box-shadow: var(--effectShadowLightShallow);
border: 1px solid rgb(var(--colorGrayLighter));
}
a {
margin: 0;
font-weight: 600;
color: rgb(var(--colorTealAction));
text-decoration-skip-ink: all;
text-decoration-thickness: 1px;
text-underline-offset: 2px;
text-decoration-color: rgb(var(--colorTealAction) / 0.5);
transition: text-decoration-color 0.15s ease-in-out;
}
a:hover,
a:focus-visible {
text-decoration-color: rgb(var(--colorTealAction));
}
p:last-of-type {
margin-bottom: 0;
}
hr {
border: 0;
height: 1px;
background: rgb(var(--colorHr));
margin-top: 16px;
margin-bottom: 16px;
}
.your-site {
font-size: 0.875rem;
}
</style>
</head>
<body>
<div class="main">
<div class="card">
<h1>Page not found</h1>
<p>
Looks like you’ve followed a broken link or entered a URL that doesn’t
exist on this site.
</p>
<hr />
<p class="your-site">
If this is your site, and you weren’t expecting a 404 for this path,
please visit Netlify’s
<a
href="https://answers.netlify.com/t/support-guide-i-ve-deployed-my-site-but-i-still-see-page-not-found/125?utm_source=404page&utm_campaign=community_tracking"
>“page not found” support guide</a
>
for troubleshooting tips.
</p>
</div>
</div>
</body>
</html>
Open service 35.157.26.135:443 · grzywacztech.pl
2026-01-13 00:55
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:55:58 GMT Location: https://www.grzywacztech.pl/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDMDGA9X0CBA8KWFM2QE0C Content-Length: 43 Connection: close Redirecting to https://www.grzywacztech.pl/
Open service 35.157.26.135:80 · grzywacztech.pl
2026-01-13 00:55
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:56:05 GMT Location: https://grzywacztech.pl/ Server: Netlify X-Nf-Request-Id: 01KETDMN3CQ1REMXWWXCS3VAX9 Content-Length: 39 Connection: close Redirecting to https://grzywacztech.pl/
Open service 35.157.26.135:443 · safety-net.systems
2026-01-13 00:55
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=31536000,immutable
Cache-Status: "Netlify Edge"; hit
Content-Length: 5114
Content-Security-Policy: default-src 'self'; img-src 'self' data: https: blob:; script-src 'self' 'unsafe-inline' https://www.googletagmanager.com https://www.google-analytics.com; style-src 'self' 'unsafe-inline'; connect-src 'self' https://*.supabase.co wss://*.supabase.co https://www.google-analytics.com; font-src 'self' data:;
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:55:48 GMT
Etag: "c1d90e3595789c19c01af05399220328-ssl"
Permissions-Policy: camera=(), microphone=(), geolocation=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
X-Content-Type-Options: nosniff
X-Nf-Request-Id: 01KETDM42J32HJTK6ECK08J5Z4
X-Xss-Protection: 1; mode=block
Connection: close
Page title: SafetyNet - Enterprise Workplace Safety Management Platform | Incident Reporting & Analytics
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<meta name="theme-color" content="#f97316" />
<!-- Primary Meta Tags -->
<title>SafetyNet - Enterprise Workplace Safety Management Platform | Incident Reporting & Analytics</title>
<meta name="title" content="SafetyNet - Enterprise Workplace Safety Management Platform" />
<meta name="description" content="Comprehensive workplace safety management: incident reporting, safety inspections, OSHA compliance tracking, and predictive analytics. Reduce workplace injuries by 40%. Free trial available." />
<meta name="keywords" content="workplace safety, incident reporting, safety management, OSHA compliance, safety analytics, workplace injuries, safety inspections, corrective actions, CAPA system, safety dashboard" />
<meta name="author" content="SafetyNet" />
<meta name="robots" content="index, follow" />
<link rel="canonical" href="https://yourapp.com/" />
<!-- PWA Manifest -->
<link rel="manifest" href="/manifest.json" />
<!-- Apple Touch Icon -->
<link rel="apple-touch-icon" href="/icon-192.png" />
<meta name="apple-mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-status-bar-style" content="black-translucent" />
<meta name="apple-mobile-web-app-title" content="SafetyNet" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://yourapp.com/" />
<meta property="og:title" content="SafetyNet - Enterprise Workplace Safety Management Platform" />
<meta property="og:description" content="Transform workplace safety with intelligent monitoring, comprehensive incident reporting, and predictive analytics. Join thousands of organizations protecting their teams." />
<meta property="og:image" content="https://yourapp.com/og-image.jpg" />
<meta property="og:site_name" content="SafetyNet" />
<meta property="og:locale" content="en_US" />
<!-- Twitter Card -->
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:url" content="https://yourapp.com/" />
<meta name="twitter:title" content="SafetyNet - Enterprise Workplace Safety Management" />
<meta name="twitter:description" content="Comprehensive workplace safety management with AI-powered insights. Reduce incidents, ensure compliance, protect your team." />
<meta name="twitter:image" content="https://yourapp.com/og-image.jpg" />
<meta name="twitter:creator" content="@safetynet" />
<!-- Schema.org structured data -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "SoftwareApplication",
"name": "SafetyNet",
"applicationCategory": "BusinessApplication",
"description": "Enterprise workplace safety management platform with incident reporting, safety inspections, and analytics",
"operatingSystem": "Web",
"offers": {
"@type": "Offer",
"price": "0",
"priceCurrency": "USD"
},
"aggregateRating": {
"@type": "AggregateRating",
"ratingValue": "4.8",
"ratingCount": "150"
}
}
</script>
<!-- Additional SEO -->
<meta name="geo.region" content="US" />
<meta name="geo.placename" content="United States" />
<meta name="language" content="English" />
<meta http-equiv="X-UA-Compatible" content="IE=edge" />
<!-- Preconnect to external domains for performance -->
<link rel="preconnect" href="https://www.google-analytics.com" />
<link rel="preconnect" href="https://www.googletagmanager.com" />
<link rel="dns-prefetch" href="https://www.google-analytics.com" />
<!-- Google Analytics 4 -->
<script async src="https://www.googletagmanager.com/gtag/js?id=GA_MEASUREMENT_ID"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLaye
Open service 35.157.26.135:80 · safety-net.systems
2026-01-13 00:55
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:55:56 GMT Location: https://safety-net.systems/ Server: Netlify X-Nf-Request-Id: 01KETDMBGMMCW6QPQXAX07MNT1 Content-Length: 42 Connection: close Redirecting to https://safety-net.systems/
Open service 35.157.26.135:443 · xelscapital.com
2026-01-13 00:55
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 25042
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:55:37 GMT
Etag: "f27318e118116581f91213bb994f204a-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDKS58MADERNRWQPXRJY6R
Connection: close
Page title: Exclusive Lifetime Mentorship Program — Xels Capital
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<title>Exclusive Lifetime Mentorship Program — Xels Capital</title>
<meta name="description" content="Exclusive Lifetime Mentorship Program. No fluff — concise coaching, accountability, and data‑driven execution. Join today." />
<meta property="og:title" content="Xels Capital — Exclusive Lifetime Mentorship Program" />
<meta property="og:description" content="Exclusive 1:1 mentorship, daily live trading, private community, and strategies." />
<meta property="og:type" content="website" />
<meta property="og:url" content="https://xels.example" />
<meta property="og:image" content="assets/logo.jpg" />
<meta name="theme-color" content="#0b0f17" />
<link rel="preconnect" href="https://tally.so/r/mYZVeB" crossorigin>
<link href="https://tally.so/r/mYZVeB" rel="stylesheet">
<style>
:root{
--bg:#0a0f18; /* page background */
--bg-2:#0d1422; /* section background */
--card:#111a2c; /* card tiles */
--line:#1b2947; /* borders */
--text:#f1f6ff; /* primary text */
--muted:#a8b6ce; /* secondary text */
--acc:#79e0ff; /* primary accent (buttons/links) */
--acc-2:#95f0d9; /* secondary accent (icons/checks) */
--brand:#ffffff; /* logo/text on dark */
--focus:#c7ff6e; /* focus outline for a11y */
}
*{box-sizing:border-box}
html,body{margin:0;padding:0;background:radial-gradient(1200px 600px at 70% -10%, rgba(105,224,255,.14), transparent 60%), var(--bg); color:var(--text); font-family:Plus Jakarta Sans, Inter, system-ui, -apple-system, Segoe UI, Roboto, Arial, sans-serif;}
a{color:inherit}
.wrap{max-width:1200px;margin:0 auto;padding:28px}
header{display:flex;align-items:center;justify-content:space-between;padding:10px 0;position:sticky;top:0;background:rgba(11,15,23,.7);backdrop-filter:blur(10px);z-index:10;border-bottom:1px solid rgba(255,255,255,.04)}
.brand{display:flex;gap:12px;align-items:center;font-weight:800;letter-spacing:.2px}
.badge{font-size:12px;padding:6px 12px;border:1px solid var(--line);border-radius:999px;color:var(--muted)}
.hero{display:grid;grid-template-columns:1.05fr .95fr;gap:36px;align-items:center;padding:56px 0 12px}
.eyebrow{color:var(--acc);font-weight:700;letter-spacing:.12em;text-transform:uppercase;font-size:12px}
.title{font-size:56px;line-height:1.1;margin:0 0 16px;font-weight:800}
.subtitle{font-size:22px;color:var(--muted);max-width:70ch;line-height:1.4}
.cta{display:flex;gap:14px;margin-top:24px;flex-wrap:wrap}
.btn{padding:16px 22px;border-radius:12px;font-size:16px;border:1px solid var(--line);background:#121829;color:var(--text);text-decoration:none;font-weight:700}
.btn.primary{background:linear-gradient(180deg, var(--acc), #45c3ff);color:#07131f;border:none;box-shadow:0 12px 28px rgba(105,224,255,.22)}
.btn.ghost{background:transparent}
.hero-card{background:linear-gradient(180deg, rgba(255,255,255,.02), transparent), var(--card);border:1px solid var(--line);border-radius:16px;padding:12px;box-shadow:inset 0 0 0 1px rgba(255,255,255,.02)}
.hero-card img{width:100%;border-radius:12px;display:block;aspect-ratio:16/10;object-fit:cover;background:#0c1220}
.section{padding:28px 0 8px}
.grid-3{display:grid;grid-template-columns:repeat(3,1fr);gap:16px;margin-top:18px}
.grid-2{display:grid;grid-template-columns:repeat(2,1fr);gap:18px;margin-top:18px}
.card{background:var(--card);border:1px solid var(--line);box-shadow:0 10px 30px rgba(0,0,0,.25);border-radius:14px;padding:20px}
.card h3{margin:0 0 12px;font-size:24px;font-weight:700}
.card p{margin:0;color:var(--muted);font-size:16px;line-height:1.5}
.pill{display:inline-flex;gap:8px;align-items:center;padding:6px 10px;border:1px solid var(--line);border-radius:999px;font-size:12px;color:var(--muted)}
.bullets{display:grid;gap:8px;margin-top:12px}
.bullets li{li
Open service 35.157.26.135:80 · xelscapital.com
2026-01-13 00:55
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:55:46 GMT Location: https://xelscapital.com/ Server: Netlify X-Nf-Request-Id: 01KETDM1RZTW4WJX8009C73Z80 Content-Length: 39 Connection: close Redirecting to https://xelscapital.com/
Open service 35.157.26.135:443 · www.dantedev.site
2026-01-13 00:55
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:55:10 GMT Location: https://dantedev.site/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDJYHHFPZWRG39VPBRC4Y8 Content-Length: 37 Connection: close Redirecting to https://dantedev.site/
Open service 35.157.26.135:80 · www.dantedev.site
2026-01-13 00:55
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:55:17 GMT Location: https://www.dantedev.site/ Server: Netlify X-Nf-Request-Id: 01KETDK5SXZHFW23EV9076YHB6 Content-Length: 41 Connection: close Redirecting to https://www.dantedev.site/
Open service 35.157.26.135:443 · asaphousecleaning.com
2026-01-13 00:54
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3951
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:54:50 GMT
Etag: "69ad3b43064c27028c1bd38c400cbf10-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDJBTQ6W1CTKTP5SEC35V2
Connection: close
Page title: ASAP House Cleaning | Lake Country House Cleaning Experts | Instant Booking
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- Google tag (gtag.js) -->
<script async src="https://www.googletagmanager.com/gtag/js?id=AW-17710293243"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'AW-17710293243');
</script>
<title>ASAP House Cleaning | Lake Country House Cleaning Experts | Instant Booking</title>
<meta name="description" content="ASAP House Cleaning - Lake Country's premier house cleaning experts. Instant online pricing & booking for Delafield, Pewaukee, Hartland, Oconomowoc. Professional maid service with same-day availability. Book your cleaning in minutes!" />
<meta name="keywords" content="ASAP House Cleaning, Lake Country house cleaning experts, Lake Country house cleaners, Delafield house cleaning, Pewaukee house cleaning, Hartland house cleaning, Oconomowoc house cleaning, instant booking cleaning service, Lake Country maid service, professional house cleaners Lake Country WI" />
<link rel="canonical" href="https://asaphousecleaning.com/" />
<!-- Open Graph Meta Tags -->
<meta property="og:title" content="ASAP House Cleaning | Lake Country House Cleaning Experts" />
<meta property="og:description" content="ASAP House Cleaning - Lake Country's premier house cleaning experts. Instant online pricing & booking for Delafield, Pewaukee, Hartland, Oconomowoc. Professional maid service with same-day availability." />
<meta property="og:type" content="website" />
<meta property="og:url" content="https://asaphousecleaning.com/" />
<meta property="og:site_name" content="ASAP House Cleaning" />
<meta property="og:locale" content="en_US" />
<!-- Twitter Card Meta Tags -->
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:title" content="ASAP House Cleaning | Lake Country House Cleaning Experts" />
<meta name="twitter:description" content="ASAP House Cleaning - Lake Country's premier house cleaning experts. Instant online pricing & booking for Delafield, Pewaukee, Hartland, Oconomowoc. Professional maid service with same-day availability." />
<!-- Local Business Schema -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "LocalBusiness",
"name": "ASAP House Cleaning",
"description": "Professional house cleaning services for all Lake Country, WI with instant online booking and pricing",
"url": "https://asaphousecleaning.com",
"telephone": "(414) 617-1339",
"email": "asaphousecleaningllc@gmail.com",
"address": {
"@type": "PostalAddress",
"addressLocality": "Delafield",
"addressRegion": "WI",
"addressCountry": "US"
},
"geo": {
"@type": "GeoCoordinates",
"latitude": "43.0608",
"longitude": "-88.4037"
},
"areaServed": [
"Delafield",
"Hartland",
"Pewaukee",
"Oconomowoc",
"Nashotah",
"Summit"
],
"priceRange": "$$",
"serviceType": ["House Cleaning", "Deep Cleaning", "Move In/Out Cleaning"],
"keywords": "ASAP House Cleaning, Lake Country house cleaning experts, Delafield house cleaning, Pewaukee house cleaning, Hartland house cleaning, Oconomowoc house cleaning, Lake Country house cleaners, Lake Country maid service"
}
</script>
<script type="module" crossorigin src="/assets/index-CSgoxhKW.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CTe3NFQt.css">
<script async src="https://bolt.new/badge.js?s=fa781227-a2f2-487e-8e21-153d29ca1533"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · asaphousecleaning.com
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:58 GMT Location: https://asaphousecleaning.com/ Server: Netlify X-Nf-Request-Id: 01KETDJK2XB504NNPAWFJDTCXJ Content-Length: 45 Connection: close Redirecting to https://asaphousecleaning.com/
Open service 35.157.26.135:443 · randomwritesrandomlights.com
2026-01-13 00:54
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3736
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:54:23 GMT
Etag: "f691e15c12197f5368f8d70d2bbd2b35-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDHGR04E7PA6F84XCGC8QH
Connection: close
Page title: Random📝Writes ‣ Random⚡️Lights
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Random📝Writes ‣ Random⚡️Lights</title>
<link rel="icon" type="image/png" href="public/ideaFav.png">
<!-- Google Font - Orbitron (for neon sign) -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Orbitron:wght@400;700;900&display=swap" rel="stylesheet">
<link rel="stylesheet" href="src/styles/style.css" />
<link rel="stylesheet" href="src/styles/trafficlightbuttonmenu.css" />
<link rel="stylesheet" href="src/styles/form.css" />
<link rel="stylesheet" href="src/styles/auth.css" />
<link rel="stylesheet" href="src/styles/forgot-password.css" />
</head>
<body>
<!-- Loading Overlay -->
<div id="loading-overlay" class="loading-overlay">
<div class="loading-spinner"></div>
<div class="loading-text">Loading...</div>
</div>
<!-- Auth Status Bar -->
<div class="auth-status-bar">
<span id="user-status"></span>
<div class="auth-links">
<a class='auth-link' href='/login' id='login-link'>Login</a>
<a class='auth-link' href='/register' id='register-link'>Sign Up</a>
<a class='auth-link' href='/settings' id='settings-link' style='display: none;'>⚙️</a>
<button id="logout-btn" class="auth-link logout-btn" style="display: none;">Logout</button>
</div>
</div>
<main class="container">
<div class="idea-container">
<div id="ideas-as-lights"></div>
</div>
<div class="banner">
<h4>An app to save random thoughts to
help improve reflection & self-improvement 🧠
</h4>
</div>
<div class="form-wrapper">
<!-- Neon Sign Box (Left Side) -->
<div id="guest-neon-sign" class="neon-sign-box">
<div class="neon-border">
<p id="neon-sign-text">Guest Mode - Notes are temporary! Sign up to keep them forever</p>
</div>
</div>
<!-- Form (Right Side) -->
<form>
<!-- Resize Handles for all sides and corners -->
<div class="resize-handle resize-top" data-direction="n" title="Drag to resize"></div>
<div class="resize-handle resize-right" data-direction="e" title="Drag to resize"></div>
<div class="resize-handle resize-bottom" data-direction="s" title="Drag to resize"></div>
<div class="resize-handle resize-left" data-direction="w" title="Drag to resize"></div>
<div class="resize-handle resize-top-left" data-direction="nw" title="Drag to resize"></div>
<div class="resize-handle resize-top-right" data-direction="ne" title="Drag to resize"></div>
<div class="resize-handle resize-bottom-left" data-direction="sw" title="Drag to resize"></div>
<div class="resize-handle resize-bottom-right" data-direction="se" title="Drag to resize"></div>
<h1>Random📝Writes</h1>
<p>Random⚡️Lights Entered: <span id="ideas-entered">0</span></p>
<section class="idea-input">
<label for="idea"></label>
<textarea id="idea" required placeholder=""></textarea>
</section>
<section class="buttons">
<div id="btn-container">
<button type="button" id="increment-btn"></button>
<button type="button" id="save-btn"></button>
<button type="button" id="reset-btn"></button>
<button type="button" id="trash-btn"></button>
</div>
</section>
</form>
</div>
</main>
<script type="module" src="src/scripts/index.js"></script>
</body>
</html>
Open service 35.157.26.135:80 · randomwritesrandomlights.com
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:31 GMT Location: https://randomwritesrandomlights.com/ Server: Netlify X-Nf-Request-Id: 01KETDHRJ7ADQ90367V0P0CC28 Content-Length: 52 Connection: close Redirecting to https://randomwritesrandomlights.com/
Open service 35.157.26.135:80 · airvanasystems.org
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:29 GMT Location: https://airvanasystems.org/ Server: Netlify X-Nf-Request-Id: 01KETDHPVCPN6TK6E73630R799 Content-Length: 42 Connection: close Redirecting to https://airvanasystems.org/
Open service 35.157.26.135:443 · airvanasystems.org
2026-01-13 00:54
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 568
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:54:21 GMT
Etag: "054c1f2e90020149aceb6ce8b399320e-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDHEJP7P02WY8DW460057Q
Connection: close
Page title: Airvana Air Systems Website
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Airvana Air Systems Website</title>
<script type="module" crossorigin src="/assets/index-y6X9u1oz.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CnMFQHbz.css">
<script async src="https://bolt.new/badge.js?s=a54f63eb-146a-4ddf-b678-03bc97e1ffdd"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.bizlicenseresearch.com
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:23 GMT Location: https://www.bizlicenseresearch.com/ Server: Netlify X-Nf-Request-Id: 01KETDHH5F5FGTVPZZ85AQA46S Content-Length: 50 Connection: close Redirecting to https://www.bizlicenseresearch.com/
Open service 35.157.26.135:443 · www.bizlicenseresearch.com
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:15 GMT Location: https://bizlicenseresearch.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDH98V2HAMVKT6ZGACF0FE Content-Length: 46 Connection: close Redirecting to https://bizlicenseresearch.com/
Open service 35.157.26.135:443 · www.stratadapt.agency
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:14 GMT Location: https://stratadapt.agency/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDH8P3ZKHVEMXGGQ9N9412 Content-Length: 41 Connection: close Redirecting to https://stratadapt.agency/
Open service 35.157.26.135:80 · www.stratadapt.agency
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:22 GMT Location: https://www.stratadapt.agency/ Server: Netlify X-Nf-Request-Id: 01KETDHGG3FPJHCNPSCVMNSMGZ Content-Length: 45 Connection: close Redirecting to https://www.stratadapt.agency/
Open service 35.157.26.135:80 · unicup.fantasytier.com
2026-01-13 00:54
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:54:13 GMT Location: https://unicup.fantasytier.com/ Server: Netlify X-Nf-Request-Id: 01KETDH7DHRKSVHHMY9VV7JZ0W Content-Length: 46 Connection: close Redirecting to https://unicup.fantasytier.com/
Open service 35.157.26.135:443 · unicup.fantasytier.com
2026-01-13 00:54
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1765
Content-Security-Policy: default-src 'self'; script-src 'self' 'sha256-m0cflPsDtRPEHhwJtLpzUnb5YCJsN7hEjMJlabojQYc=' 'sha256-4tfNZ3vCo/JmYMXvOnh1bXL6PvNal8Lkewreu0boHAI=' https://challenges.cloudflare.com https://*.contentsquare.net; style-src 'self' 'unsafe-inline' https://fonts.googleapis.com; img-src 'self' data: blob: https://*.privy.io https://*.walletconnect.com https://ihotelapp.com https://ibaires.com.ar https://media.api-sports.io https://*.azurefd.net https://*.contentsquare.net https://*.uniswap.org; font-src 'self' https://fonts.gstatic.com https://*.contentsquare.net; object-src 'none'; base-uri 'self'; form-action 'self'; frame-ancestors 'none'; child-src https://auth.privy.io https://verify.walletconnect.com https://verify.walletconnect.org; frame-src https://auth.privy.io https://verify.walletconnect.com https://verify.walletconnect.org https://challenges.cloudflare.com; connect-src 'self' https://www.fantasytier.com https://auth.privy.io wss://relay.walletconnect.com wss://relay.walletconnect.org wss://www.walletlink.org https://*.rpc.privy.systems https://explorer-api.walletconnect.com https://rpc.gnosischain.com https://*.drpc.org https://*.thegraph.com https://*.goldsky.com https://cdn.kleros.link https://*.pimlico.io https://*.contentsquare.net https://*.contentsquare.com; worker-src 'self' blob:; manifest-src 'self'
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:54:04 GMT
Etag: "b0941b650519564e66c26cd9c27bc5d1-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETDGYFR13SEDSJR1E38Z6Z0
Connection: close
Page title: Fantasy Tier
<!doctype html>
<html lang="en" class="dark">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no" />
<title>Fantasy Tier</title>
<link rel="apple-touch-icon" sizes="180x180" href="/apple-touch-icon.png">
<link rel="icon" type="image/png" sizes="32x32" href="/favicon-32x32.png">
<link rel="icon" type="image/png" sizes="16x16" href="/favicon-16x16.png">
<link rel="manifest" href="/site.webmanifest">
<!-- Meta Pixel Code -->
<script>
!function(f,b,e,v,n,t,s)
{if(f.fbq)return;n=f.fbq=function(){n.callMethod?
n.callMethod.apply(n,arguments):n.queue.push(arguments)};
if(!f._fbq)f._fbq=n;n.push=n;n.loaded=!0;n.version='2.0';
n.queue=[];t=b.createElement(e);t.async=!0;
t.src=v;s=b.getElementsByTagName(e)[0];
s.parentNode.insertBefore(t,s)}(window, document,'script',
'https://connect.facebook.net/en_US/fbevents.js');
fbq('init', '1129835692686059');
fbq('track', 'PageView');
</script>
<!-- End Meta Pixel Code -->
<script>
(function (c, s, q, u, a, r, e) {
c.hj=c.hj||function(){(c.hj.q=c.hj.q||[]).push(arguments)};
c._hjSettings = { hjid: a };
r = s.getElementsByTagName('head')[0];
e = s.createElement('script');
e.async = true;
e.src = q + c._hjSettings.hjid + u;
r.appendChild(e);
})(window, document, 'https://static.hj.contentsquare.net/c/csq-', '.js', 6531809);
</script>
<script type="module" crossorigin src="/assets/index-CtWrBJZf.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-IR9L54i5.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.caymen.ky
2026-01-13 00:53
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:53:42 GMT Location: https://caymen.ky/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDG95PTBD7XHZMPERNMPZW Content-Length: 33 Connection: close Redirecting to https://caymen.ky/
Open service 35.157.26.135:80 · www.caymen.ky
2026-01-13 00:53
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:53:50 GMT Location: https://www.caymen.ky/ Server: Netlify X-Nf-Request-Id: 01KETDGH0VXYJ4A64HRGXYRFMS Content-Length: 37 Connection: close Redirecting to https://www.caymen.ky/
Open service 35.157.26.135:443 · estimator.reviverenovations.com
2026-01-13 00:53
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 110963
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:53:41 GMT
Etag: "60766d4655ebee59c81db705ea8d1e28-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDG7KRX16CGFHNJ4D3H6T3
Connection: close
Page title: Revive Renovations - Field Estimator
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Revive Renovations - Field Estimator</title>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Poppins:wght@400;600;700&display=swap" rel="stylesheet">
<!-- Google Maps API -->
<script src="https://maps.googleapis.com/maps/api/js?key=AIzaSyA-EGPFoKGnW7_pZ0D7B4jEIZZuPgHxuAk&libraries=places&callback=initAutocomplete" async defer></script>
<!-- jsPDF for PDF generation -->
<script src="https://cdnjs.cloudflare.com/ajax/libs/jspdf/2.5.1/jspdf.umd.min.js"></script>
<style>
* {
margin: 0;
padding: 0;
box-sizing: border-box;
}
body {
font-family: 'Poppins', -apple-system, BlinkMacSystemFont, 'Segoe UI', Arial, sans-serif;
background-color: #f5f4f9;
color: #333;
line-height: 1.4;
}
.header {
background: white;
padding: 1rem;
border-bottom: 1px solid #ddd;
position: sticky;
top: 0;
z-index: 100;
}
.logo {
font-size: 1.2rem;
font-weight: bold;
color: #000;
}
.container {
max-width: 480px;
margin: 0 auto;
padding: 1rem;
}
.card {
background: white;
border-radius: 8px;
padding: 1rem;
margin-bottom: 1rem;
box-shadow: 0 1px 3px rgba(212,185,26,0.1);
}
.form-group {
margin-bottom: 1rem;
}
label {
display: block;
margin-bottom: 0.5rem;
font-weight: 600;
font-size: 0.9rem;
}
input, select {
width: 100%;
padding: 0.75rem;
border: 1px solid #ddd;
border-radius: 4px;
font-size: 1rem;
}
.multiplier-controls {
display: grid;
grid-template-columns: 1fr 1fr;
gap: 1rem;
margin-bottom: 1rem;
}
.multiplier-group {
text-align: center;
}
.multiplier-input {
width: 80px;
text-align: center;
font-weight: bold;
color: #000;
}
.search-container {
position: relative;
margin-bottom: 1rem;
}
.search-input {
padding-right: 100px;
}
.category-filter {
position: absolute;
right: 0;
top: 0;
width: 90px;
height: 100%;
border-left: 1px solid #ddd;
border-radius: 0 4px 4px 0;
font-size: 0.85rem;
}
.suggestions {
background: white;
border: 1px solid #ddd;
border-top: none;
border-radius: 0 0 4px 4px;
max-height: 300px;
overflow-y: auto;
position: absolute;
width: 100%;
z-index: 1000;
top: 100%;
left: 0;
box-shadow: 0 2px 8px rgba(0,0,0,0.1);
}
.suggestion-item {
padding: 0.75rem;
cursor: pointer;
border-bottom: 1px solid #f0f0f0;
}
.suggestion-item:hover {
background-color: #f5f4f9;
border-left: 4px solid #d4b91a;
}
.suggestion-name {
font-weight: 600;
margin-bottom: 0.25rem;
}
.suggestion-price {
color: #666;
font-size: 0.9rem;
}
.btn {
background: #d4b91a;
Open service 35.157.26.135:80 · estimator.reviverenovations.com
2026-01-13 00:53
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:53:49 GMT Location: https://estimator.reviverenovations.com/ Server: Netlify X-Nf-Request-Id: 01KETDGFJX0574EPRMT27BGGY1 Content-Length: 55 Connection: close Redirecting to https://estimator.reviverenovations.com/
Open service 35.157.26.135:80 · blog.qiuyucode.com
2026-01-13 00:53
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:53:22 GMT Location: https://blog.qiuyucode.com/ Server: Netlify X-Nf-Request-Id: 01KETDFNSQH78NX8B7XXP356BE Content-Length: 42 Connection: close Redirecting to https://blog.qiuyucode.com/
Open service 35.157.26.135:443 · www.qiuyucode.com
2026-01-13 00:53
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:53:15 GMT Location: https://qiuyucode.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDFEDZ8FF4M0XJZPTWYJ3N Content-Length: 37 Connection: close Redirecting to https://qiuyucode.com/
Open service 35.157.26.135:80 · www.qiuyucode.com
2026-01-13 00:53
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:53:23 GMT Location: https://www.qiuyucode.com/ Server: Netlify X-Nf-Request-Id: 01KETDFPGJETQ54K1AAPVBYSJF Content-Length: 41 Connection: close Redirecting to https://www.qiuyucode.com/
Open service 35.157.26.135:443 · blog.qiuyucode.com
2026-01-13 00:53
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 4
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 52393
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:53:15 GMT
Etag: "53ee49f041deaad5332660e80515d66a-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDFE7DWNTS4MSVKG5WZV39
Connection: close
Page title: 求余的博客
<!doctype html><html lang=zh-CN data-theme=light><head><meta charset=UTF-8><meta name=viewport content="width=device-width,initial-scale=1"><meta name=theme-color content="#222" media="(prefers-color-scheme: light)"><meta name=generator content="Hugo 0.152.2"><link rel="shortcut icon" type=image/x-icon href=/imgs/icons/favicon.ico><link rel=icon type=image/x-icon href=/imgs/icons/favicon.ico><link rel=icon type=image/png sizes=16x16 href=/imgs/icons/favicon_16x16_next.png><link rel=icon type=image/png sizes=32x32 href=/imgs/icons/favicon_32_32_next.png><link rel=apple-touch-icon sizes=180x180 href=/imgs/icons/apple_touch_icon_next.png><meta itemprop=name content="求余的博客"><meta itemprop=description content="永葆对技术的好奇与热忱,热爱生活中的每一次探索"><meta name=description content="永葆对技术的好奇与热忱,热爱生活中的每一次探索"><meta itemprop=image content="https://qiuyucode.com/imgs/my_avatar.png"><meta itemprop=keywords content="python,后端开发,前端开发,ROS机器人"><meta property="og:type" content="website"><meta property="og:title" content="求余的博客"><meta property="og:description" content="永葆对技术的好奇与热忱,热爱生活中的每一次探索"><meta property="og:image" content="/imgs/my_avatar.png"><meta property="og:image:width" content="312"><meta property="og:image:height" content="312"><meta property="og:image:type" content="image/jpeg/png/svg/jpg"><meta property="og:url" content="https://qiuyucode.com/"><meta property="og:site_name" content="求余的博客"><meta property="og:locale" content="zh-CN"><link type=text/css rel=stylesheet href=https://qiuyucode.com/js/3rd/font-awesome/6.7.2/css/all.min.css><link type=text/css rel=stylesheet href=https://qiuyucode.com/js/3rd/animate.css/3.1.1/animate.min.css><link type=text/css rel=stylesheet href=https://qiuyucode.com/js/3rd/viewerjs/1.11.6/viewer.min.css><link rel=stylesheet href="/css/main.min.css?=1766394942"><style type=text/css>.post-footer hr:after{content:"~ 我可是有底线的哟 ~"}.flinks-list-footer hr:after{content:"~ 我可是有底线的哟 ~"}</style><script type=text/javascript>(function(){localDB={set:function(e,t,n){if(n===0)return;const s=new Date,o=n*864e5,i={value:t,expiry:s.getTime()+o};localStorage.setItem(e,JSON.stringify(i))},get:function(e){const t=localStorage.getItem(e);if(!t)return 0[0];const n=JSON.parse(t),s=new Date;return s.getTime()>n.expiry?(localStorage.removeItem(e),0[0]):n.value}},theme={active:function(){const e=localDB.get("theme");if(e==null)return;theme.toggle(e),window.matchMedia("(prefers-color-scheme: dark)").addListener(function(e){theme.toggle(e.matches?"dark":"light")})},toggle:function(e){document.documentElement.setAttribute("data-theme",e),localDB.set("theme",e,2);const t=document.querySelector("iframe.giscus-frame");if(t){const n={setConfig:{theme:e}};t.contentWindow.postMessage({giscus:n},"https://giscus.app")}}},theme.active()})(window)</script><script type=text/javascript>document.addEventListener("DOMContentLoaded",()=>{var e=document.createElement("script");e.charset="UTF-8",e.id="LA_COLLECT",e.src="https://sdk.51.la/js-sdk-pro.min.js",e.async="true",e.onload=function(){LA.init({id:"3K5uymYH23g25ObL",ck:"3K5uymYH23g25ObL",autoTrack:!0})},document.head.appendChild(e)})</script><script type=text/javascript>document.addEventListener("DOMContentLoaded",()=>{var e=document.createElement("script");e.charset="UTF-8",e.src="https://hm.baidu.com/hm.js?0a9f3b64f9ca80c024912a200d676de5",e.async="true",document.head.appendChild(e)})</script><script type=text/javascript>document.addEventListener("DOMContentLoaded",()=>{var e=document.createElement("script");e.charset="UTF-8",e.src="https://www.googletagmanager.com/gtag/js?id=G-6VFJJ7XF9D",e.async="true",e.onload=function(){window.dataLayer=window.dataLayer||[];function e(){dataLayer.push(arguments)}e("js",new Date),e("config","G-6VFJJ7XF9D ")},document.head.appendChild(e)})</script><title>求余的博客</title><noscript><link rel=stylesheet href=/css/noscript.css></noscript></hea
Open service 35.157.26.135:80 · www.anthonyle.cv
2026-01-13 00:53
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:53:20 GMT Location: https://www.anthonyle.cv/ Server: Netlify X-Nf-Request-Id: 01KETDFKFP4HGT4H6PA1VHCQSB Content-Length: 40 Connection: close Redirecting to https://www.anthonyle.cv/
Open service 35.157.26.135:443 · www.anthonyle.cv
2026-01-13 00:53
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 495
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:53:12 GMT
Etag: "2a89e6f7887864d3ecfd3eba5d3c746f-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDFBDGATMSXNFSNW796YTH
Connection: close
Page title: Antien Le
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Antien Le</title>
<!-- Font Awesome 6 -->
<link rel="stylesheet" href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/6.5.0/css/all.min.css" />
</head>
<body>
<div id="root"></div>
<script type="module" src="/src/main.tsx"></script>
</body>
</html>
Open service 35.157.26.135:443 · www.synchro.eng.br
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:51:58 GMT Location: https://synchro.eng.br/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDD37QAVCVSJAG0CGAHGZ0 Content-Length: 38 Connection: close Redirecting to https://synchro.eng.br/
Open service 35.157.26.135:80 · www.synchro.eng.br
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:52:05 GMT Location: https://www.synchro.eng.br/ Server: Netlify X-Nf-Request-Id: 01KETDDAMS7PBDZMBASH3N3A13 Content-Length: 42 Connection: close Redirecting to https://www.synchro.eng.br/
Open service 35.157.26.135:80 · synchro.eng.br
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:52:05 GMT Location: https://synchro.eng.br/ Server: Netlify X-Nf-Request-Id: 01KETDDAKDBJ8AT59J46RD7SX5 Content-Length: 38 Connection: close Redirecting to https://synchro.eng.br/
Open service 35.157.26.135:443 · synchro.eng.br
2026-01-13 00:51
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 2178
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:51:57 GMT
Etag: "7090b61ce520096de9141271c20895b2-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDD2TG4CVMQNRQQQX2F3MT
Connection: close
Page title: SYNCHRO | Performance Industrial
<!DOCTYPE html>
<html lang="pt-BR">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>SYNCHRO | Performance Industrial</title>
<link rel="icon" type="image/svg+xml" href="/favicon.svg" />
<script src="https://cdn.tailwindcss.com"></script>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;600;700;900&display=swap" rel="stylesheet">
<script>
tailwind.config = {
darkMode: 'class',
theme: {
extend: {
fontFamily: {
sans: ['Inter', 'sans-serif'],
},
colors: {
synchro: {
black: '#0a0a0a',
dark: '#171717',
gray: '#262626',
light: '#f3f4f6', // Light gray for light mode
white: '#ffffff',
accent: '#0052CC', // Engineering Blue (Less neon, more professional)
accentHover: '#003E99', // Darker shade for hover
}
},
animation: {
'slow-zoom': 'zoom 20s infinite alternate',
},
keyframes: {
zoom: {
'0%': { transform: 'scale(1)' },
'100%': { transform: 'scale(1.1)' },
}
}
},
},
}
</script>
<style>
body {
@apply bg-white dark:bg-synchro-black text-gray-900 dark:text-white transition-colors duration-300;
}
/* Smooth scrolling for anchor links */
html {
scroll-behavior: smooth;
}
</style>
<script type="importmap">
{
"imports": {
"react": "https://esm.sh/react@18.2.0",
"react/": "https://esm.sh/react@18.2.0/",
"react-dom": "https://esm.sh/react-dom@18.2.0",
"react-dom/": "https://esm.sh/react-dom@18.2.0/",
"react-router-dom": "https://esm.sh/react-router-dom@6.22.3?external=react,react-dom",
"lucide-react": "https://esm.sh/lucide-react@0.344.0",
"recharts": "https://esm.sh/recharts@2.12.2?external=react,react-dom"
}
}
</script>
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.covaraai.com
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:51:55 GMT Location: https://covaraai.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDD006QK3S71RFNR698H3H Content-Length: 36 Connection: close Redirecting to https://covaraai.com/
Open service 35.157.26.135:80 · www.covaraai.com
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:52:03 GMT Location: https://www.covaraai.com/ Server: Netlify X-Nf-Request-Id: 01KETDD7YVB56H80M3MG23B66C Content-Length: 40 Connection: close Redirecting to https://www.covaraai.com/
Open service 35.157.26.135:80 · mrturbino.app
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:51:20 GMT Location: https://mrturbino.app/ Server: Netlify X-Nf-Request-Id: 01KETDBY1VPQ3CPYS5V9GWY5F0 Content-Length: 37 Connection: close Redirecting to https://mrturbino.app/
Open service 35.157.26.135:443 · mrturbino.app
2026-01-13 00:51
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 577
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:51:12 GMT
Etag: "9fe337d53721570040f47eef299d8877-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDBP6TXY382CQYN7SC1A1C
Connection: close
Page title: Vite React TS Supabase i18n Tailwind
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Vite React TS Supabase i18n Tailwind</title>
<script type="module" crossorigin src="/assets/index-r790tufV.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-Dp7zLDCF.css">
<script async src="https://bolt.new/badge.js?s=df4dde54-0439-41b2-98d7-cf1f9c7a3848"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.goinwith.me
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:51:08 GMT Location: https://goinwith.me/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETDBJ4D6BGFNMCN2MJSR84F Content-Length: 35 Connection: close Redirecting to https://goinwith.me/
Open service 35.157.26.135:80 · www.goinwith.me
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:51:16 GMT Location: https://www.goinwith.me/ Server: Netlify X-Nf-Request-Id: 01KETDBSY7JJ6BS0YQA07W863C Content-Length: 39 Connection: close Redirecting to https://www.goinwith.me/
Open service 35.157.26.135:443 · www.hongkongmagician.com
2026-01-13 00:51
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 11227
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:51:06 GMT
Etag: "c042a6e30628adab24f86bef7d291e79-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDBGBZNHSP87NRCSE70CZ5
Connection: close
Page title: Team Hong Kong Magician - Corporate & Private Events Magic Show HK | Macau | APAC
<!DOCTYPE html>
<html lang="en-HK">
<head>
<meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
<title>Team Hong Kong Magician - Corporate & Private Events Magic Show HK | Macau | APAC</title>
<meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
<meta name="keywords" content="魔術,香港魔術師,魔術表演,澳門,上海,Hong Kong Magician,Macau,Shanghai,Magic Show" />
<meta name="description" content="Hong Kong based Elite Magicians Team. Award Winning, Multi-lingual, Innovative Magic Show & Illusion Entertainment Services for Corporate & Private events in Hong Kong, Macau & APAC." />
<link rel="canonical" href="index.html" />
<link type="text/css" rel="stylesheet" media="all" href="sites/default/files/css/css_28af60ec3580f667a3d47e5fd1a8e499.css" />
<script type="text/javascript" src="sites/default/files/js/js_ddbb1be6dbd4b4f3de2902963c9db4a2.js"></script>
<script type="text/javascript">
<!--//--><![CDATA[//><!--
jQuery.extend(Drupal.settings, { "basePath": "/", "colorbox": { "transition": "elastic", "speed": 350, "opacity": "0.85", "slideshow": false, "slideshowAuto": false, "slideshowSpeed": 2500, "slideshowStart": "", "slideshowStop": "", "current": "{current} of {total}", "previous": "« Prev", "next": "Next »", "close": "Close", "overlayClose": true, "maxWidth": "100%", "maxHeight": "100%" }, "googleanalytics": { "trackOutbound": 1, "trackMailto": 1, "trackDownload": 1, "trackDownloadExtensions": "7z|aac|arc|arj|asf|asx|avi|bin|csv|doc|exe|flv|gif|gz|gzip|hqx|jar|jpe?g|js|mp(2|3|4|e?g)|mov(ie)?|msi|msp|pdf|phps|png|ppt|qtm?|ra(m|r)?|sea|sit|tar|tgz|torrent|txt|wav|wma|wmv|wpd|xls|xml|z|zip" }, "cron": { "basePath": "/poormanscron", "runNext": 1682860074 }, "viewsSlideshowSingleFrame": { "#views_slideshow_singleframe_main_banner_rotator-default": { "num_divs": 3, "id_prefix": "#views_slideshow_singleframe_main_", "div_prefix": "#views_slideshow_singleframe_div_", "vss_id": "banner_rotator-default", "timeout": 5000, "sort": 1, "effect": "fade", "speed": 700, "start_paused": 0, "delay": 0, "fixed_height": 1, "random": 0, "pause": 1, "pause_on_click": 0, "pause_when_hidden": 0, "pause_when_hidden_type": "full", "amount_allowed_visible": "", "remember_slide": 0, "remember_slide_days": 1, "controls": 0, "items_per_slide": 1, "pager": 2, "pager_type": "Numbered", "pager_hover": 2, "pager_click_to_page": 0, "image_count": 0, "nowrap": 0, "sync": 1, "advanced": "height: 300", "ie": { "cleartype": "true", "cleartypenobg": "false" } } } });
//--><!]]>
</script>
</head>
<body class="front not-logged-in page-front-panel no-sidebars">
<div id="page-wrapper">
<div id="page" class="container-16 clearfix">
<div id="site-header" class="clearfix">
<div id="branding" class="grid-4 suffix-8 clearfix">
<h1 id="site-name"><a class='active' href='/' rel='home'>Hong Kong Magician</a></h1>
</div>
<div id="site-menu" class="grid-16">
<ul class="links main-menu"><li class="menu-524 first"><a href='/who-we-are' id='who-we-are'>Who we are</a></li>
<li class="menu-525"><a href='/what-we-do' id='what-we-do'>What we do</a></li>
<li class="menu-565"><a href='/experience' id='experience'>Experience</a></li>
<li class="menu-1972"><a href='/our-design' id='our-design'>Our Design</a></li>
<li class="menu-466 last"><a href='/contact' id='get-in-touch'>Get in Touch</a></li>
</ul> </div>
</div>
<div id="main" class="column grid-16 ">
<div id="main-content" class="region clearfix">
<div class="panel-display panel-3col-33-stacked clear-block" id="front-panel">
<div class="panel-panel panel-col-top">
<div class="inside"><div class="panel-pane pane-views pane-banner-rotator" >
<div class="pane-content">
<div class="view view-banner-rotator view-id-banner_rotator view-display-id-default view-dom-id-3">
<div class="view-content">
<div id="views_slideshow_singleframe_main_banner_rotator-default" class="views_slideshow_
Open service 35.157.26.135:80 · www.hongkongmagician.com
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:51:14 GMT Location: https://www.hongkongmagician.com/ Server: Netlify X-Nf-Request-Id: 01KETDBQZ0DG786VQ1BF8KY888 Content-Length: 48 Connection: close Redirecting to https://www.hongkongmagician.com/
Open service 35.157.26.135:80 · brg.justinmichaelcahoon.com
2026-01-13 00:51
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:51:13 GMT Location: https://brg.justinmichaelcahoon.com/ Server: Netlify X-Nf-Request-Id: 01KETDBQNPQW2QK9KSA2NZZPN7 Content-Length: 51 Connection: close Redirecting to https://brg.justinmichaelcahoon.com/
Open service 35.157.26.135:443 · brg.justinmichaelcahoon.com
2026-01-13 00:51
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 369200
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:51:06 GMT
Etag: "156de2662f17ed629740d61f5b266668-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDBGKWNMF4RQRJ8X9Q41ED
Connection: close
Page title: Bryan Reynolds Group - Official Band Website
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta
name="viewport"
content="width=device-width, initial-scale=1.0, maximum-scale=1" />
<title>Bryan Reynolds Group - Official Band Website</title>
<link rel="preconnect" href="https://fonts.googleapis.com" />
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin />
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700;800&family=Playfair+Display:wght@700;900&display=swap" rel="stylesheet" />
<!-- Favicons -->
<link rel="icon" type="image/x-icon" href="/favicon.ico" />
<link rel="icon" type="image/png" sizes="16x16" href="/favicon-16x16.png" />
<link rel="icon" type="image/png" sizes="32x32" href="/favicon-32x32.png" />
<link rel="apple-touch-icon" sizes="180x180" href="/apple-touch-icon.png" />
<link rel="manifest" href="/site.webmanifest" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:title" content="Bryan Reynolds Group - Official Band Website" />
<meta property="og:description" content="Moody, cinematic rock inspired by the jazzy complexity of Steely Dan and the spine-tingling arpeggios of the Halloween soundtrack. Listen to our music and follow our journey." />
<meta property="og:image" content="https://brg.justinmichaelcahoon.com/BRGbackground.png" />
<meta property="og:url" content="https://brg.justinmichaelcahoon.com" />
<!-- Twitter -->
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:title" content="Bryan Reynolds Group - Official Band Website" />
<meta name="twitter:description" content="Moody, cinematic rock inspired by the jazzy complexity of Steely Dan and the spine-tingling arpeggios of the Halloween soundtrack. Listen to our music and follow our journey." />
<meta name="twitter:image" content="https://brg.justinmichaelcahoon.com/BRGbackground.png" />
<script type="module" crossorigin src="/assets/index-N9ZKLQlI.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-BYwNkw3F.css">
</head>
<body>
<script id="manus-runtime">window.__MANUS_HOST_DEV__ = false;
(function(){"use strict";var Mr={exports:{}},Kn={};/**
* @license React
* react-jsx-runtime.production.js
*
* Copyright (c) Meta Platforms, Inc. and affiliates.
*
* This source code is licensed under the MIT license found in the
* LICENSE file in the root directory of this source tree.
*/var $c;function um(){if($c)return Kn;$c=1;var r=Symbol.for("react.transitional.element"),i=Symbol.for("react.fragment");function c(s,d,m){var x=null;if(m!==void 0&&(x=""+m),d.key!==void 0&&(x=""+d.key),"key"in d){m={};for(var R in d)R!=="key"&&(m[R]=d[R])}else m=d;return d=m.ref,{$$typeof:r,type:s,key:x,ref:d!==void 0?d:null,props:m}}return Kn.Fragment=i,Kn.jsx=c,Kn.jsxs=c,Kn}var Fc;function dm(){return Fc||(Fc=1,Mr.exports=um()),Mr.exports}var h=dm(),Ar={exports:{}},Pn={},Rr={exports:{}},Nr={};/**
* @license React
* scheduler.production.js
*
* Copyright (c) Meta Platforms, Inc. and affiliates.
*
* This source code is licensed under the MIT license found in the
* LICENSE file in the root directory of this source tree.
*/var Ic;function fm(){return Ic||(Ic=1,function(r){function i(A,q){var B=A.length;A.push(q);t:for(;0<B;){var bt=B-1>>>1,p=A[bt];if(0<d(p,q))A[bt]=q,A[B]=p,B=bt;else break t}}function c(A){return A.length===0?null:A[0]}function s(A){if(A.length===0)return null;var q=A[0],B=A.pop();if(B!==q){A[0]=B;t:for(var bt=0,p=A.length,O=p>>>1;bt<O;){var X=2*(bt+1)-1,G=A[X],Z=X+1,st=A[Z];if(0>d(G,B))Z<p&&0>d(st,G)?(A[bt]=st,A[Z]=B,bt=Z):(A[bt]=G,A[X]=B,bt=X);else if(Z<p&&0>d(st,B))A[bt]=st,A[Z]=B,bt=Z;else break t}}return q}function d(A,q){var B=A.sortIndex-q.sortIndex;return B!==0?B:A.id-q.id}if(r.unstable_now=void 0,typeof performance=="object"&&typeof performance.now=="function"){var m=performance;r.unstable_now=function(){return m.now()}}else{var x=Date,R=x.now();r.unstable_now=function(){return x.now()-R}}var C=[]
Open service 35.157.26.135:80 · www.tshbestfood.com
2026-01-13 00:50
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:50:56 GMT Location: https://www.tshbestfood.com/ Server: Netlify X-Nf-Request-Id: 01KETDB6X7CSHQM6JHDVE8Z8EC Content-Length: 43 Connection: close Redirecting to https://www.tshbestfood.com/
Open service 35.157.26.135:443 · www.tshbestfood.com
2026-01-13 00:50
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 8848
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:50:47 GMT
Etag: "04d5077b8b18500ae9e4ab4e584d0b94-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDAY48ZWC03Q2MSS62GHTJ
Connection: close
Page title: TSH Best Food LLC | Franquicias Gastronómicas Full Service (USA → Perú)
<!DOCTYPE html>
<html lang="es">
<head>
<meta charset="utf-8">
<meta name="viewport" content="width=device-width, initial-scale=1">
<title>TSH Best Food LLC | Franquicias Gastronómicas Full Service (USA → Perú)</title>
<meta name="description" content="TSH Best Food LLC: desarrollamos, implementamos y abastecemos franquicias gastronómicas con modelo full service. Conceptos: Pirates Kitchen (seafood boil), Korean modern & Yard House-style. Alianzas en Perú y LATAM.">
<link rel="canonical" href="https://www.tshbestfood.com/">
<link rel="icon" type="image/png" sizes="64x64" href="assets/favicon.png">
<link rel="apple-touch-icon" sizes="90x90" href="assets/apple-touch-icon.png">
<meta property="og:title" content="TSH Best Food LLC · Full Service Franchise Partner">
<meta property="og:description" content="TSH Best Food LLC: desarrollamos, implementamos y abastecemos franquicias gastronómicas con modelo full service. Conceptos: Pirates Kitchen (seafood boil), Korean modern & Yard House-style. Alianzas en Perú y LATAM.">
<meta property="og:type" content="website">
<meta property="og:url" content="https://www.tshbestfood.com/">
<meta property="og:image" content="https://www.tshbestfood.com/assets/og-image.jpg">
<meta name="theme-color" content="#0f172a">
<link rel="preload" as="image" href="assets/hero.jpg">
<!-- MANTÉN TU CSS PRINCIPAL TAL CUAL -->
<link rel="stylesheet" href="css/styles.css">
<!-- NUEVO: overrides mínimos que no rompen tu tema -->
<link rel="stylesheet" href="css/contact-overrides.css">
</head>
<body>
<nav class="nav">
<div class="container nav-inner">
<a href="/" aria-label="Inicio"><img src="assets/logo.svg" alt="TSH Best Food LLC logo" width="80" height="20"></a>
<div class="links">
<a href="#quienes">Quiénes somos</a>
<a href="#conceptos">Conceptos</a>
<a href="#alianzas">Alianzas</a>
<a href="#contacto">Contacto</a>
</div>
</div>
</nav>
<header class="hero">
<div class="hero-media" aria-hidden="true"></div>
<div class="container content">
<div class="badge">Full Service Franchise Partner</div>
<h1>Desarrollamos, implementamos y abastecemos <br> franquicias gastronómicas entre USA y Perú</h1>
<p class="lead">Operamos modelos probados como <strong>Pirates Kitchen</strong> (seafood boil & cajún), un <strong>concepto Korean moderno</strong> y un <strong>modelo tipo Yard House</strong> que complementan la oferta de grupos líderes. Detectamos <em>horarios muertos</em> y compartimos infraestructura para generar nuevos ingresos.</p>
<div class="hero-cta">
<a class="btn" href="#contacto">Quiero conversar</a>
<a class="btn btn-outline" href="#conceptos">Conceptos</a>
</div>
<div class="kpis">
<div class="kpi">
<div class="label">Experiencia</div>
<div class="value">+20 años</div>
</div>
<div class="kpi">
<div class="label">Mercados</div>
<div class="value">USA · Perú · LATAM</div>
</div>
<div class="kpi">
<div class="label">Modelo</div>
<div class="value">Full Service</div>
</div>
</div>
</div>
</header>
<section id="quienes" class="section">
<div class="container grid grid-2">
<div class="card">
<h2>Quiénes somos</h2>
<p>TSH Best Food LLC es una empresa creada en Estados Unidos dedicada al desarrollo, implementación y abastecimiento integral de franquicias gastronómicas. Acompañamos a nuestros socios con un enfoque <strong>llave en mano</strong> desde la estrategia y el diseño hasta la estandarización operativa.</p>
<ul class="list">
<li>Implementación de locales · manuales · capacitación</li>
<li>Abastecimiento de insumos estratégicos · logística</li>
<li>Marketing, lanzamiento y operación inicial</li>
</ul>
<div class="tags">
<span class="tag">LLC USA</span>
<span class="tag">Operación & Supply</spa
Open service 35.157.26.135:443 · app.automatecontent.io
2026-01-13 00:50
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 494
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:50:23 GMT
Etag: "e89f0a411924cbe595f192ca71cb39c4-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETDA6RVW55WXTEQNJBMP2PT
Connection: close
Page title: Automate Content - AI-Powered Content Generation
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Automate Content - AI-Powered Content Generation</title>
<script type="module" crossorigin src="/assets/index-CjB5zEtX.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DQ9plg_-.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · app.automatecontent.io
2026-01-13 00:50
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:50:31 GMT Location: https://app.automatecontent.io/ Server: Netlify X-Nf-Request-Id: 01KETDAE993HHHZM7T2ACR6WYE Content-Length: 46 Connection: close Redirecting to https://app.automatecontent.io/
Open service 35.157.26.135:80 · ottautomotive.com
2026-01-13 00:50
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:50:22 GMT Location: https://ottautomotive.com/ Server: Netlify X-Nf-Request-Id: 01KETDA5M0SBHD40ZAM3RWGVB4 Content-Length: 41 Connection: close Redirecting to https://ottautomotive.com/
Open service 35.157.26.135:443 · ottautomotive.com
2026-01-13 00:50
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 21070
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:50:13 GMT
Etag: "773ccecaa627447a157883f0e1737a25-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD9X8P4GJ4X11V7JKVNBD9
Connection: close
Page title: OTT Automotive Services | Mobile Car Detailing
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<meta name="description" content="OTT Automotive Services - Professional mobile car detailing. Full-service interior and exterior detailing brought to your location.">
<title>OTT Automotive Services | Mobile Car Detailing</title>
<link rel="stylesheet" href="styles.css">
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Montserrat:wght@400;500;600;700&family=Open+Sans:wght@400;500;600&display=swap" rel="stylesheet">
</head>
<body>
<!-- Navigation -->
<nav class="navbar">
<div class="container">
<a href="#" class="logo">
<img src="images/logo.png" alt="OTT Automotive Services" class="logo-img">
</a>
<button class="nav-toggle" aria-label="Toggle navigation">
<span class="hamburger"></span>
</button>
<ul class="nav-menu">
<li><a href="#home" class="nav-link">Home</a></li>
<li><a href="#services" class="nav-link">Services</a></li>
<li><a href="#about" class="nav-link">About</a></li>
<li><a href="#gallery" class="nav-link">Gallery</a></li>
<li><a href="#booking" class="nav-link btn-primary">Book Now</a></li>
</ul>
</div>
</nav>
<!-- Hero Section -->
<section id="home" class="hero">
<div class="hero-overlay"></div>
<div class="container hero-content">
<img src="images/logo.png" alt="OTT Automotive Services" class="hero-logo">
<h1>Premium Mobile <span class="highlight">Car Detailing</span></h1>
<p class="hero-subtitle">Professional detailing services brought directly to your location. We bring the shine to you.</p>
<div class="hero-buttons">
<a href="#booking" class="btn btn-primary">Book Appointment</a>
<a href="#services" class="btn btn-secondary">Our Services</a>
</div>
</div>
</section>
<!-- Services Section -->
<section id="services" class="services">
<div class="container">
<h2 class="section-title">Our <span class="highlight">Services</span></h2>
<p class="section-subtitle">Comprehensive detailing packages tailored to your vehicle's needs<br><small>All prices include GST</small></p>
<div class="services-grid">
<div class="service-card">
<div class="service-icon">
<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2">
<path d="M7 17m-2 0a2 2 0 1 0 4 0a2 2 0 1 0 -4 0"></path>
<path d="M17 17m-2 0a2 2 0 1 0 4 0a2 2 0 1 0 -4 0"></path>
<path d="M5 17h-2v-6l2 -5h9l4 5h1a2 2 0 0 1 2 2v4h-2m-4 0h-6m-6 -6h15m-6 0v-5"></path>
</svg>
</div>
<h3>Exterior Detailing</h3>
<p>Complete exterior wash, clay bar treatment, and wax protection for a showroom finish.</p>
<ul class="service-features">
<li>Hand wash & dry</li>
<li>Clay bar treatment</li>
<li>Wax protection</li>
</ul>
<span class="price">From $189</span>
</div>
<div class="service-card featured">
<div class="featured-badge">Best Value</div>
<div class="service-icon">
<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2">
<path d="M12 8v4l
Open service 35.157.26.135:80 · livestage.hempin.org
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:49 GMT Location: https://livestage.hempin.org/ Server: Netlify X-Nf-Request-Id: 01KETD95RYP55BPGWF687ZE184 Content-Length: 44 Connection: close Redirecting to https://livestage.hempin.org/
Open service 35.157.26.135:443 · livestage.hempin.org
2026-01-13 00:49
HTTP/1.1 401 Unauthorized
Content-Type: text/html
Date: Tue, 13 Jan 2026 00:49:40 GMT
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD8X22MFX9YBHDB3S659HN
Connection: close
Transfer-Encoding: chunked
Page title: Password Protection
<!DOCTYPE html>
<html>
<head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no">
<title>Password Protection</title>
<style>
body {
font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Helvetica, Arial, sans-serif, "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol";
background: rgb(14, 30, 37);
color: white;
overflow: hidden;
margin: 0;
padding: 0;
}
h1 {
margin: 0;
font-size: 22px;
line-height: 24px;
}
.main {
position: relative;
display: flex;
flex-direction: column;
align-items: center;
justify-content: center;
height: 100vh;
width: 100vw;
}
.card {
position: relative;
display: flex;
flex-direction: column;
width: 75%;
max-width: 364px;
padding: 24px;
background: white;
color: rgb(14, 30, 37);
border-radius: 8px;
box-shadow: 0 2px 4px 0 rgba(14, 30, 37, .16);
}
input {
box-sizing: border-box;
display: block;
width: 100%;
height: 40px;
margin: 24px 0;
padding: 6px 14px;
border: 2px solid #e9ebeb;
border-radius: 4px;
background: none;
box-shadow: none;
font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Helvetica, Arial, sans-serif, "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol";
font-size: 16px;
font-weight: 500;
line-height: 24px;
transition: box-shadow ease-in-out 0.15s;
-webkit-appearance: none;
-moz-appearance: none;
}
input:focus {
outline: none;
border-color: #f4bb00;
box-shadow: 0 0 1px 0 #f4bb00;
}
.button,
button {
position: relative;
box-sizing: border-box;
display: inline-block;
vertical-align: middle;
width: 100%;
padding: 8px 16px;
font-family: inherit;
font-size: 16px;
font-weight: 500;
line-height: 24px;
text-align: center;
text-decoration: none;
align-self: center;
border-radius: 4px;
background-color: #007067;
border: none;
color: #fff;
box-shadow: none;
transition: all 0.2s ease;
transition-property: background-color;
outline: 0;
}
button:hover {
cursor: pointer;
box-shadow: 0 0 0 2px #f4bb00;
}
.alert-box {
position: relative;
display: block;
margin-bottom: -8px;
background: #fff4f5;
border-radius: 4px;
padding: 4px 8px;
font-size: 14px;
color: #ad2831;
letter-spacing: 0;
line-height: 24px;
font-weight: 500;
}
</style>
</head>
<body>
<div class="main">
<div class="card">
<div class="header">
<h1>Password protected site</h1>
</div>
<div class="body">
<p class="lead">Please enter your password to get access.</p>
<form method="post"><input type="hidden" name="form-name" value="form 1" />
<input type="password" name="password" placeholder="Password" autofocus>
<button class="button">Submit</button>
</form>
</div>
</div>
</div>
</body>
</html>
Open service 35.157.26.135:80 · www.beyond-structure.com
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:33 GMT Location: https://www.beyond-structure.com/ Server: Netlify X-Nf-Request-Id: 01KETD8NTMKX7TCHR0B6RRGDDC Content-Length: 48 Connection: close Redirecting to https://www.beyond-structure.com/
Open service 35.157.26.135:443 · www.beyond-structure.com
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:24 GMT Location: https://beyond-structure.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD8DE92XF2PAT644RQGYPR Content-Length: 44 Connection: close Redirecting to https://beyond-structure.com/
Open service 35.157.26.135:443 · www.go3pl.net
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:18 GMT Location: https://go3pl.net/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD87BV3MSA8J8PKPA7CQSR Content-Length: 33 Connection: close Redirecting to https://go3pl.net/
Open service 35.157.26.135:80 · www.go3pl.net
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:27 GMT Location: https://www.go3pl.net/ Server: Netlify X-Nf-Request-Id: 01KETD8FPMVHA5B8X6Q20BCH70 Content-Length: 37 Connection: close Redirecting to https://www.go3pl.net/
Open service 35.157.26.135:80 · itsalexandras.com
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:26 GMT Location: https://itsalexandras.com/ Server: Netlify X-Nf-Request-Id: 01KETD8EK9W9WE6SJDWJ83Z8V5 Content-Length: 41 Connection: close Redirecting to https://itsalexandras.com/
Open service 35.157.26.135:443 · itsalexandras.com
2026-01-13 00:49
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3462
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:49:17 GMT
Etag: "b305f3e76dc486dc278feb6f651d2d72-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD86474231ERVJSZTKW7JT
Connection: close
Page title: Tampa Bay Upholstery | Expert Furniture Reupholstery Services | Tampa FL
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- Preconnect to critical origins -->
<link rel="preconnect" href="https://fonts.googleapis.com" />
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin />
<link rel="preconnect" href="https://images.pexels.com" />
<!-- Google Fonts -->
<link href="https://fonts.googleapis.com/css2?family=Kedebideri:wght@300;400;500;600;700&display=swap" rel="stylesheet" />
<!-- Performance optimizations -->
<link rel="dns-prefetch" href="https://supabase.co" />
<title>Tampa Bay Upholstery | Expert Furniture Reupholstery Services | Tampa FL</title>
<meta name="description" content="Transform your furniture with Tampa Bay's trusted upholstery experts. 9+ years serving Hillsborough, Pinellas & surrounding counties. Free quotes, premium fabrics. Call (727) 793-7205" />
<meta property="og:title" content="Tampa Bay Upholstery | Expert Furniture Reupholstery Services" />
<meta property="og:description" content="Transform your furniture with Tampa Bay's trusted upholstery experts. 9+ years experience, premium fabrics." />
<meta property="og:type" content="website" />
<meta property="og:url" content="https://tampabayupholstery.com" />
<meta property="og:image" content="https://images.pexels.com/photos/1866149/pexels-photo-1866149.jpeg?auto=compress&cs=tinysrgb&w=1200" />
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:title" content="Tampa Bay Upholstery | Expert Furniture Reupholstery Services" />
<meta name="twitter:description" content="Transform your furniture with Tampa Bay's trusted upholstery experts. 9+ years experience, premium fabrics." />
<link rel="canonical" href="https://tampabayupholstery.com" />
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "LocalBusiness",
"name": "Tampa Bay Upholstery",
"description": "Expert furniture reupholstery services across Tampa Bay",
"image": "https://images.pexels.com/photos/1866149/pexels-photo-1866149.jpeg?auto=compress&cs=tinysrgb&w=1200",
"telephone": "+17277937205",
"email": "alexandra.karr@yahoo.com",
"address": {
"@type": "PostalAddress",
"addressLocality": "Clearwater",
"addressRegion": "FL",
"addressCountry": "US"
},
"areaServed": [
{
"@type": "City",
"name": "Tampa"
},
{
"@type": "City",
"name": "St. Petersburg"
},
{
"@type": "City",
"name": "Clearwater"
}
],
"aggregateRating": {
"@type": "AggregateRating",
"ratingValue": "4.9",
"reviewCount": "28"
},
"priceRange": "$$",
"openingHoursSpecification": [
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": ["Monday", "Tuesday", "Wednesday", "Thursday", "Friday"],
"opens": "10:00",
"closes": "18:00"
}
]
}
</script>
<script type="module" crossorigin src="/assets/index-BNq-W_bd.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DRY94GiO.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.sailmate.se
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:11 GMT Location: https://www.sailmate.se/ Server: Netlify X-Nf-Request-Id: 01KETD80DXW44WM121WA6R7KJ1 Content-Length: 39 Connection: close Redirecting to https://www.sailmate.se/
Open service 35.157.26.135:443 · www.sailmate.ru
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:03 GMT Location: https://www.sailmate.com/en/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7RPFEYNXSMWKYXMWFPT3 Connection: close Redirecting to https://www.sailmate.com/en/
Open service 35.157.26.135:80 · www.sailmate.ru
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:11 GMT Location: https://www.sailmate.ru/ Server: Netlify X-Nf-Request-Id: 01KETD80D1EEDF89G88HVR46F6 Content-Length: 39 Connection: close Redirecting to https://www.sailmate.ru/
Open service 35.157.26.135:80 · m.sailmate.fi
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:12 GMT Location: https://m.sailmate.fi/ Server: Netlify X-Nf-Request-Id: 01KETD81HMTA04EHDR6KAT57ZY Content-Length: 37 Connection: close Redirecting to https://m.sailmate.fi/
Open service 35.157.26.135:443 · m.sailmate.fi
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 3 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:04 GMT Location: https://www.sailmate.com/fi/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7SAGX9B52GPYDMT1QHS2 Connection: close Redirecting to https://www.sailmate.com/fi/
Open service 35.157.26.135:443 · www.sailmate.it
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 3 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:04 GMT Location: https://www.sailmate.com/en/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7SAFZSMQ545MRMGBCRNZ Connection: close Redirecting to https://www.sailmate.com/en/
Open service 35.157.26.135:443 · www.nautics.fi
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:03 GMT Location: https://www.sailmate.com/fi/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7RK58860JZDFMN1GS6E4 Connection: close Redirecting to https://www.sailmate.com/fi/
Open service 35.157.26.135:443 · www.sailmate.se
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 3 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:04 GMT Location: https://www.sailmate.com/en/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7S02FDWXY44KXH9RWK3V Connection: close Redirecting to https://www.sailmate.com/en/
Open service 35.157.26.135:80 · www.sailmate.org
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:11 GMT Location: https://www.sailmate.org/ Server: Netlify X-Nf-Request-Id: 01KETD807W6EW8ETP4YSRMY4X4 Content-Length: 40 Connection: close Redirecting to https://www.sailmate.org/
Open service 35.157.26.135:443 · www.sailmate.io
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:03 GMT Location: https://www.sailmate.com/en/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7RH35Y03EBRS8G6PTVE4 Connection: close Redirecting to https://www.sailmate.com/en/
Open service 35.157.26.135:443 · www.sailmate.fi
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 104 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:03 GMT Location: https://www.sailmate.com/fi/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7R7A8A3SW488J02YANQJ Connection: close Redirecting to https://www.sailmate.com/fi/
Open service 35.157.26.135:443 · www.sailmate.info
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:03 GMT Location: https://www.sailmate.com/en/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7REETRX785WAZMHCAHHP Connection: close Redirecting to https://www.sailmate.com/en/
Open service 35.157.26.135:80 · www.sailmate.it
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:11 GMT Location: https://www.sailmate.it/ Server: Netlify X-Nf-Request-Id: 01KETD804EBPRNEEVYK8NAEQET Content-Length: 39 Connection: close Redirecting to https://www.sailmate.it/
Open service 35.157.26.135:80 · www.sailmate.info
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:12 GMT Location: https://www.sailmate.info/ Server: Netlify X-Nf-Request-Id: 01KETD80X3HDPSQX4RFJ3Q50RF Content-Length: 41 Connection: close Redirecting to https://www.sailmate.info/
Open service 35.157.26.135:80 · www.nautics.fi
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:11 GMT Location: https://www.nautics.fi/ Server: Netlify X-Nf-Request-Id: 01KETD803BCXCKZRX8H6NQABCZ Content-Length: 38 Connection: close Redirecting to https://www.nautics.fi/
Open service 35.157.26.135:80 · www.sailmate.fi
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:11 GMT Location: https://www.sailmate.fi/ Server: Netlify X-Nf-Request-Id: 01KETD7ZZN8DS5AT97EG69V78P Content-Length: 39 Connection: close Redirecting to https://www.sailmate.fi/
Open service 35.157.26.135:80 · www.sailmate.io
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:11 GMT Location: https://www.sailmate.io/ Server: Netlify X-Nf-Request-Id: 01KETD806KX407E05HP7CQ9Z63 Content-Length: 39 Connection: close Redirecting to https://www.sailmate.io/
Open service 35.157.26.135:443 · www.sailmate.org
2026-01-13 00:49
HTTP/1.1 301 Moved Permanently Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:49:03 GMT Location: https://www.sailmate.com/en/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD7RC6JQM5AY1HZSRH1B59 Connection: close Redirecting to https://www.sailmate.com/en/
Open service 35.157.26.135:80 · www.bunkersync.com
2026-01-13 00:47
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:47:42 GMT Location: https://www.bunkersync.com/ Server: Netlify X-Nf-Request-Id: 01KETD58YCZRV1H7QTT011XKQ8 Content-Length: 42 Connection: close Redirecting to https://www.bunkersync.com/
Open service 35.157.26.135:443 · www.bunkersync.com
2026-01-13 00:47
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:47:33 GMT Location: https://bunkersync.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD50J4W5NA7MEKPBE1D0YW Content-Length: 38 Connection: close Redirecting to https://bunkersync.com/
Open service 35.157.26.135:80 · www.inspiradatanusa.com
2026-01-13 00:47
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:47:15 GMT Location: https://www.inspiradatanusa.com/ Server: Netlify X-Nf-Request-Id: 01KETD4F06ZWTVZDBMVRHKE86W Content-Length: 47 Connection: close Redirecting to https://www.inspiradatanusa.com/
Open service 35.157.26.135:443 · www.inspiradatanusa.com
2026-01-13 00:47
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3698
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:47:07 GMT
Etag: "927c7071a72faee7865790f6dc962400-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD46ZRS3H33NMT7FMTH28T
Connection: close
Page title: Helium Wallpaper
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<meta http-equiv="X-UA-Compatible" content="ie=edge" />
<!-- 新 Bootstrap 核心 CSS 文件 -->
<link
href="https://cdnjs.cloudflare.com/ajax/libs/twitter-bootstrap/3.3.7/css/bootstrap.min.css"
rel="stylesheet"
/>
<link
rel="stylesheet"
type="text/css"
href="https://cdn.bootcss.com/toastr.js/latest/css/toastr.min.css"
/>
<link rel="stylesheet" href="./css/index.css" />
<link rel="shortcut icon" type="image/x-icon" href="./img/favicon.png" />
<title>Helium Wallpaper</title>
</head>
<body>
<div class="nav_tab">
<div class="nav">
<img src="./img/logo_nav.png" alt="" />
<ul>
<li><a href="#home">Home</a></li>
<li><a href="#advantage">Advantage</a></li>
<li><a href="#contacts">About Us</a></li>
<li>
<a href="https://www.inspiradatanusa.com/privacypolicy"
>Privacy Policy</a
>
</li>
</ul>
</div>
</div>
<div id="home">
<img src="./img/home.png" alt="" />
</div>
<div id="advantage">
<img src="./img/advantage.png" alt="" />
</div>
<div id="step">
<img src="./img/step.png" alt="" />
</div>
<div id="contacts">
<img src="./img/about-us.png" alt="" />
<div class="content">
<p class="header">About Us</p>
<p class="subtitle">
A beautiful wallpaper should enhance, not distract. Our app offers a
curated selection of elegant wallpapers, with real-time previews and
simple saving to your gallery — so you can make your home screen truly
yours.
</p>
<p class="subtitle">
Endless inspiration at your fingertips. Just tap to generate a
brand-new wallpaper. Behind each image is a custom algorithm, creating
infinite visual possibilities — no downloads, no waiting.
</p>
<p class="subtitle">
No ads. No data tracking. No clutter. This is a lightweight, private,
and refined wallpaper experience — focused on beauty, not noise.
</p>
</div>
</div>
<div class="foot">
<div class="foot_info">
<div class="left">
<img class="logo_footer" src="./img/logo_nav.png" alt="" />
<div class="info">
<img class="icon" src="./img/adress.png" alt="" />
<div>
<p>Jl. Bsd Raya Utama Foresta Business Loft 3 No. 30-31</p>
<p>Kabupaten Tangerang - Indonesia (ID)</p>
</div>
</div>
<div class="info">
<img class="icon" src="./img/email.png" alt="" />
<span>insdatadeveloper@gmail.com</span>
</div>
</div>
<div class="right">
<div class="privacy">
<p>
<a href='/terms&conditions'>Terms & Conditions</a>
</p>
<p>
<a href="https://www.inspiradatanusa.com/privacypolicy"
>Privacy Policy</a
>
</p>
</div>
</div>
</div>
<div class="card">
<span>2025©PT INSPIRA DATA NUSA</span>
</div>
</div>
</body>
</html>
<script>
window.addEventListener('scroll', function () {
const homeElement = document.querySelector('.nav_tab');
if (!homeElement) return;
if (window.scrollY > 1000) {
homeElement.classList.add('new-nav');
} else {
homeElement.classList.remove('new-nav');
}
});
</script>
Open service 35.157.26.135:80 · benti-tech.com
2026-01-13 00:46
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:46:48 GMT Location: https://benti-tech.com/ Server: Netlify X-Nf-Request-Id: 01KETD3M6486ZC0YD1VVSATBSJ Content-Length: 38 Connection: close Redirecting to https://benti-tech.com/
Open service 35.157.26.135:443 · benti-tech.com
2026-01-13 00:46
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 19852
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:46:38 GMT
Etag: "a72e04578ffd675a19185b5149fbac2d-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD3AWT6H79QGD1AAZGZBCS
Connection: close
Page title: BENTI BIOMETRIC LABS | RESTRICTEDBENTI BIOMETRIC LABS | RESTRICTED
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>BENTI BIOMETRIC LABS | RESTRICTED</title>
<style>
:root {
--bg-color: #050505;
--text-color: #e0e0e0;
--accent-color: #00ff41; /* Terminal Green */
--alert-color: #ff3333; /* Warning Red */
--dim-color: #4a4a4a;
--grid-color: rgba(0, 255, 65, 0.05);
--font-stack: 'Courier New', Courier, monospace;
}
* {
box-sizing: border-box;
margin: 0;
padding: 0;
}
body {
background-color: var(--bg-color);
color: var(--text-color);
font-family: var(--font-stack);
line-height: 1.6;
overflow-x: hidden;
}
/* BACKGROUND GRID EFFECT */
.grid-bg {
position: fixed;
top: 0;
left: 0;
width: 100vw;
height: 100vh;
background-image:
linear-gradient(var(--grid-color) 1px, transparent 1px),
linear-gradient(90deg, var(--grid-color) 1px, transparent 1px);
background-size: 50px 50px;
z-index: -1;
pointer-events: none;
}
.container {
max-width: 900px;
margin: 0 auto;
padding: 40px 20px;
}
/* HEADER */
header {
padding: 60px 0;
border-bottom: 1px solid var(--dim-color);
margin-bottom: 60px;
}
.logo {
font-size: 2rem;
font-weight: bold;
letter-spacing: -2px;
color: var(--text-color);
}
.logo span {
color: var(--accent-color);
}
.tagline {
color: var(--dim-color);
font-size: 0.9rem;
text-transform: uppercase;
letter-spacing: 2px;
margin-top: 10px;
}
/* STATS BAR */
.stats-grid {
display: grid;
grid-template-columns: repeat(auto-fit, minmax(150px, 1fr));
gap: 20px;
margin-bottom: 80px;
border: 1px solid var(--dim-color);
padding: 20px;
background: rgba(0, 255, 65, 0.02);
}
.stat-item h3 {
font-size: 0.8rem;
color: var(--dim-color);
}
.stat-item p {
font-size: 1.5rem;
color: var(--accent-color);
font-weight: bold;
}
/* PROTOCOL SECTIONS */
.protocol-section {
margin-bottom: 100px;
position: relative;
padding-left: 20px;
border-left: 2px solid var(--dim-color);
}
.protocol-section:hover {
border-left: 2px solid var(--accent-color);
}
.section-label {
font-size: 0.8rem;
color: var(--accent-color);
text-transform: uppercase;
letter-spacing: 1px;
margin-bottom: 10px;
display: block;
}
h2 {
font-size: 2rem;
margin-bottom: 20px;
text-transform: uppercase;
}
p.description {
font-size: 1.1rem;
max-width: 700px;
margin-bottom: 30px;
color: #ccc;
}
.features {
display: grid;
grid-template-columns: 1fr 1fr;
gap: 15px;
font-size: 0.9rem;
}
.feature-item::before {
content: "[✓] ";
color: var(--accent-color);
}
.patent-status {
margin-top: 20px;
font-size: 0.8rem;
color: var(--dim-color);
border: 1px solid var(--dim-color);
display: inline-block;
padding: 5px 10px;
}
/* FOOTER */
footer {
text-align: center;
paddi
Open service 35.157.26.135:443 · rhdigitalinc.com
2026-01-13 00:46
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 35089
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:46:15 GMT
Etag: "23b15e55be72a1054955512a836b1193-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD2MDR8XVGYGXB4KPEWN7H
Connection: close
Page title: RH Digital Inc — Digital Marketing • Web & App Development
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<title>RH Digital Inc — Digital Marketing • Web & App Development</title>
<meta name="description" content="Web & app development and performance marketing for brands that want real results." />
<meta name="theme-color" content="#0b1110" />
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600;700;800&family=Plus+Jakarta+Sans:wght@500;700;800&display=swap" rel="stylesheet">
<style>
:root{
--bg:#0b1110; --surface:#0f151a; --card:#101820; --line:#1b2a33;
--text:#e6edf3; --muted:#ffffff; --accent:#22d3ee; --accent-2:#60a5fa;
--radius:18px; --shadow:0 10px 30px rgba(0,0,0,.35);
}
*{box-sizing:border-box}
html,body{margin:0;padding:0}
body{
background: radial-gradient(1200px 800px at 75% -10%, rgba(34,211,238,.12), transparent),
radial-gradient(1000px 700px at 0% 20%, rgba(96,165,250,.12), transparent),
var(--bg);
color:var(--text);
font-family: Inter, system-ui, -apple-system, Segoe UI, Roboto, "Helvetica Neue", Arial, "Noto Sans", "Apple Color Emoji", "Segoe UI Emoji", "Segoe UI Symbol", sans-serif;
line-height:1.6;
}
body.no-scroll { overflow: hidden; }
/* layout */
.container{width:min(1100px, 92vw); margin-inline:auto}
.section-slim{margin-block:3.5rem}
/* header */
header.site-header{position:sticky; top:0; z-index:50; backdrop-filter: blur(8px); background: rgba(11,17,16,.84); border-bottom:1px solid var(--line)}
.header-inner{display:flex; align-items:center; justify-content:space-between; gap:1rem; padding:.9rem 0;}
.brand{display:flex; align-items:center; gap:.7rem; text-decoration:none; color:var(--text); font-weight:800; letter-spacing:.2px}
.brand .logo{width:34px; height:34px}
.brand-text{font-family:"Plus Jakarta Sans", Inter, system-ui, sans-serif; font-weight:800}
.nav-list{display:flex; list-style:none; gap:.6rem; padding:0; margin:0; align-items:center}
.nav-list a{color:var(--muted); text-decoration:none; padding:.55rem .8rem; border-radius:12px; border:1px solid transparent}
.nav-list a:hover{color:var(--text); border-color:var(--line); background:#0f171d}
.nav-list a.active{color:#0d1720; background:linear-gradient(135deg, var(--accent), var(--accent-2)); border-color:transparent}
.btn{display:inline-flex; align-items:center; justify-content:center; gap:.5rem; padding:.8rem 1rem; border-radius:12px; border:1px solid var(--line); text-decoration:none; color:var(--text); transition:.2s ease; box-shadow:var(--shadow); background:#0f171d}
.btn:hover{transform:translateY(-1px)}
.btn-primary{background:linear-gradient(135deg, var(--accent), var(--accent-2)); color:#041014; border-color:transparent; font-weight:700}
.btn-ghost{background:transparent; border-color:var(--line); color:var(--text)}
.link{color:var(--accent); text-decoration:none}
.link:hover{text-decoration:underline}
.nav-toggle{display:none; background:transparent; border:0; padding:.2rem .25rem}
.nav-toggle .bar{display:block; width:24px; height:2px; background:var(--text); margin:5px 0; border-radius:2px}
/* hero */
.hero{display:grid; grid-template-columns: 1.2fr .8fr; gap:2rem; align-items:center; padding: 3.2rem 0 2rem}
.hero .xl{font-family:"Plus Jakarta Sans", Inter, sans-serif; font-weight:800; font-size: clamp(2.2rem, 3.3vw + .8rem, 4rem); line-height:1.05; letter-spacing:-.02em}
.hero p{color:var(--muted); max-width:54ch}
.grad{background: linear-gradient(135deg,var(--accent), var(--accent-2)); -webkit-background-clip:text; background-clip:text; color:transparent}
.cta-row{display:flex; gap:.8rem; margin-top:1.1rem}
.hero-badges{display:flex; flex-wrap:wrap; gap:.6rem; padding:0; list-style:none; margin-top:1rem}
.hero-badges li{padding:.38rem .6rem; border-radius:999px; border:1px solid var(--line); font-size:.9rem; color:var(--muted)}
.hero-art svg{width:100%; height:auto; display:bl
Open service 35.157.26.135:80 · rhdigitalinc.com
2026-01-13 00:46
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:46:22 GMT Location: https://rhdigitalinc.com/ Server: Netlify X-Nf-Request-Id: 01KETD2VQ7VHQ2RJXW5QW54V85 Content-Length: 40 Connection: close Redirecting to https://rhdigitalinc.com/
Open service 35.157.26.135:80 · secretdereines.com
2026-01-13 00:46
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:46:22 GMT Location: https://secretdereines.com/ Server: Netlify X-Nf-Request-Id: 01KETD2V3G77DPM2T4H7R80PKC Content-Length: 42 Connection: close Redirecting to https://secretdereines.com/
Open service 35.157.26.135:443 · secretdereines.com
2026-01-13 00:46
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 77948
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:46:14 GMT
Etag: "4840db8c8ef7b648bb56d40ac9a19791-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD2KSNY048113SWJP76G12
Connection: close
Page title: Men's Growth - As Seen on Shark Tank
<!DOCTYPE html><html lang="pt-BR"><head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Men's Growth - As Seen on Shark Tank</title>
<style>
* {
margin: 0;
padding: 0;
box-sizing: border-box;
}
body {
font-family: 'Arial', sans-serif;
line-height: 1.6;
color: #333;
}
.header {
background-color: #003d7a;
color: white;
padding: 20px 20px 10px;
}
.header-container {
max-width: 1200px;
margin: 0 auto;
display: flex;
align-items: center;
justify-content: center;
gap: 15px;
}
.logo {
display: flex;
align-items: center;
gap: 15px;
}
.logo-shark-header {
height: 50px;
}
.logo-text {
font-size: 18px;
font-weight: normal;
}
.logo-text strong {
font-weight: bold;
}
.info-bar {
background-color: #4da6ff;
color: white;
padding: 10px 0;
font-size: 13px;
overflow: hidden;
position: relative;
}
.info-bar-container {
display: flex;
align-items: center;
gap: 60px;
animation: scroll-left 20s linear infinite;
white-space: nowrap;
}
@keyframes scroll-left {
0% {
transform: translateX(0);
}
100% {
transform: translateX(-50%);
}
}
.info-bar-container:hover {
animation-play-state: paused;
}
.info-item {
display: flex;
align-items: center;
gap: 8px;
flex-shrink: 0;
}
.hero {
background: linear-gradient(rgba(0, 40, 80, 0.7), rgba(0, 40, 80, 1.7)),
url('images/bgHero.webp') no-repeat center center;
background-size: cover;
background-position: center;
color: white;
text-align: center;
padding: 80px 20px;
position: relative;
}
.shark-badge {
position: absolute;
top: 10px;
right: 10px;
width: 80px;
height: auto;
}
.hero h1 {
font-size: 42px;
margin-bottom: 20px;
color: #ffc107;
font-weight: bold;
text-shadow: 2px 2px 4px rgba(0, 0, 0, 0.5);
}
.hero h2 {
font-size: 26px;
margin-bottom: 20px;
font-weight: 600;
line-height: 1.4;
}
.hero p {
font-size: 17px;
margin-bottom: 10px;
max-width: 900px;
margin-left: auto;
margin-right: auto;
line-height: 1.6;
}
.testimonial {
background-color: rgba(0, 0, 0, 0.5);
padding: 25px;
margin: 30px auto;
max-width: 700px;
border-radius: 8px;
border-left: 4px solid #ffc107;
}
.testimonial-text {
font-style: italic;
font-size: 20px;
margin-bottom: 10px;
}
.testimonial-author {
font-size: 15px;
color: #ffc107;
font-weight: bold;
}
.cta-button {
background-color: #ffc107;
color: #000;
padding: 18px 50px;
font-size: 15px;
font-weight: bold;
border: none;
border-radius: 5px;
cursor: pointer;
text-transform: uppercase;
margin-top: 25px;
transition: all 0.3s;
box-shadow: 0 4px 8px rgba(0, 0, 0, 0.3);
}
.cta-button:hover {
backgro
Open service 35.157.26.135:443 · everythingexists.online
2026-01-13 00:46
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3151
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:46:02 GMT
Etag: "b7adc4a1be2a173719a172e786ba6eb0-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD27E48VNJW3526WPCVESX
Connection: close
Page title: Everything Exists
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Everything Exists</title>
<link rel="stylesheet" href="hp.css">
<link rel="icon" type="image.png" href="Logos/everythingexists favicon logo - 1 CROP 1 1.png">
</head>
<body>
<nav class="navbar">
<div class="logo">
<a href='/'>
<img src="Logos/Exists logo red2 - 7.png" alt="Company Logo">
</a>
</div>
<ul class="nav-links">
<li><a href="Learn More/page.html">Learn More</a></li>
<li><a href='/pricing/page'>Price</a></li>
<li><a href='/content/page'>Content</a></li>
<li><a href='/shop/page'>Store</a></li>
<li><a href="#">Join Forever</a></li>
</ul>
</nav>
<div class="heading-container">
<h1 class="main-heading">EVERYTHING EXISTS: A PRIVATE, SALES DEVELOPMENT OPERATION.</h1>
</div>
<div class="main-container1">
<div class="main-section">
<h2>FOR OWNERS LOOKING TO OVERHAUL THEIR SALES AND OPERATION</h2>
<p>Start a private showcasing chat with our team through live video.</p>
<div class="btn-container">
<button class="primary-button" onclick="window.location.href='https://calendar.app.google/dDVgpMCGoQPo3BYh7'">Book Demo</button>
<button class="primary-button">Learn More</button>
</div>
</div>
</div>
<div class="main-container2">
<video id="bg-video" autoplay muted loop playsinline>
<source src="videos/horse Video Oct 22 2025, 10 43 26 AM.mp4" type="video/mp4">
</video>
<div class="main-section">
<h2>FOR THE INDIVIDUAL READY TO MAKE DRASTIC SHIFTS AND PERSONALLY DEVELOP</h2>
<p>Explore the selection of resources and tools designed to support you fully.</p>
<button class="primary-button">Invest In Yourself</button>
</div>
</div>
<div class="main-container3">
<div class="main-section2">
<div class="Left-title">
<h2>JOIN FOREVER ON TELEGRAM</h2>
<p>Watch us do cool stuff and benefit from ocasional insights all for free.</p>
</div>
<div class="right-title">
<img src="logos/Telegram_logo.svg.png" alt="Telegram Logo" height="150px" width="400px">
</div>
</div>
<div class="button-box">
<button class="primary-button2" onclick="window.location.href='https://t.me/+riJIHRQPI8Y5YjU5'">Join Forever Now</button>
</div>
</div>
<footer class="site-footer">
<div class="left-footer">
<p class="footer-left">© 2026 Everything Exists. All rights reserved.</p>
<a href="#">Contact</a>
<a href="#">Privacy Policy</a>
<a href="#">Media Accounts</a>
</div>
<div class="footer-center">
<time id="footer-date-time"></time>
</div>
</footer>
<script src="hp.js"></script>
</body>
</html>
Open service 35.157.26.135:80 · everythingexists.online
2026-01-13 00:46
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:46:10 GMT Location: https://everythingexists.online/ Server: Netlify X-Nf-Request-Id: 01KETD2F7ZHBE41W4SNX7JX9H9 Content-Length: 47 Connection: close Redirecting to https://everythingexists.online/
Open service 35.157.26.135:443 · prospairityconsulting.com
2026-01-13 00:45
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 26650
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:45:40 GMT
Etag: "ebb015e25ebef5a9b6ae7395d8b8849e-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD1HTPQ9C8VP62AM51Z4DA
Connection: close
Page title: ProspAIrity Consulting | Experience + Intelligence = Growth
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>ProspAIrity Consulting | Experience + Intelligence = Growth</title>
<script src="https://cdn.tailwindcss.com"></script>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Montserrat:wght@300;400;600;700&family=Lato:wght@300;400;700&display=swap" rel="stylesheet">
<style>
:root {
--deep-blue: #0C3D52;
--midnight-blue: #073042;
--sunset-orange: #FF9A55;
--peach-sunrise: #FFC178;
--aqua-intel: #23B5D3;
--horizon-blue: #3BB1D8;
--off-white: #F4FAFD;
}
body {
font-family: 'Lato', sans-serif;
color: var(--midnight-blue);
background-color: #fff;
scroll-behavior: smooth;
}
h1, h2, h3, h4, .font-montserrat {
font-family: 'Montserrat', sans-serif;
}
.bg-gradient-sunrise {
background: linear-gradient(135deg, var(--sunset-orange), var(--peach-sunrise));
}
.bg-deep-blue { background-color: var(--deep-blue); }
.text-deep-blue { color: var(--deep-blue); }
.text-aqua { color: var(--aqua-intel); }
.btn-primary {
background-color: var(--sunset-orange);
color: white;
transition: all 0.3s ease;
box-shadow: 0 4px 14px 0 rgba(255, 154, 85, 0.39);
}
.btn-primary:hover {
background-color: #e88944;
transform: translateY(-2px);
}
.nav-link {
position: relative;
transition: color 0.3s;
}
.nav-link::after {
content: '';
position: absolute;
width: 0;
height: 2px;
bottom: -4px;
left: 0;
background-color: var(--aqua-intel);
transition: width 0.3s;
}
.nav-link:hover::after {
width: 100%;
}
.hero-gradient {
background: radial-gradient(circle at top right, rgba(255, 193, 120, 0.1), transparent),
radial-gradient(circle at bottom left, rgba(35, 181, 211, 0.05), transparent),
linear-gradient(180deg, #F4FAFD 0%, #FFFFFF 100%);
}
.logo-container {
filter: drop-shadow(0 20px 30px rgba(12, 61, 82, 0.1));
}
.profile-image-container {
box-shadow: 0 20px 40px -10px rgba(0, 0, 0, 0.4);
}
.agent-row {
transition: all 0.3s ease;
border: 1px solid rgba(0,0,0,0.05);
}
.agent-row:hover {
transform: translateX(10px);
background-color: white;
box-shadow: 0 10px 30px -10px rgba(12, 61, 82, 0.1);
border-color: var(--aqua-intel);
}
</style>
</head>
<body class="antialiased">
<!-- Navigation -->
<nav class="fixed w-full z-50 bg-white/95 backdrop-blur-md border-b border-gray-100">
<div class="max-w-7xl mx-auto px-4 sm:px-6 lg:px-8">
<div class="flex justify-between h-24 items-center">
<div class="flex items-center">
<!-- Logo increased to 150% size -->
<img src="logo-full.png" alt="ProspAIrity Consulting" class="h-20 w-auto" onerror="this.src='https://via.placeholder.com/300x90?text=ProspAIrity+Consulting';">
</div>
<div class="hidden md:flex space-x-8 items-center">
<a href="#problem" class="nav-link font-bold text-xs uppercase tracking-widest text-deep-blue">The Problem</a>
<a href="#services" class="nav-link font-bold text-xs uppe
Open service 35.157.26.135:80 · prospairityconsulting.com
2026-01-13 00:45
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:45:48 GMT Location: https://prospairityconsulting.com/ Server: Netlify X-Nf-Request-Id: 01KETD1SPEYAWZPS4MM6T4874N Content-Length: 49 Connection: close Redirecting to https://prospairityconsulting.com/
Open service 35.157.26.135:443 · www.studyaipro.com
2026-01-13 00:45
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:45:19 GMT Location: https://studyaipro.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETD0Y66WCKWNEJDQKE1ZSKK Content-Length: 38 Connection: close Redirecting to https://studyaipro.com/
Open service 35.157.26.135:80 · www.studyaipro.com
2026-01-13 00:45
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:45:27 GMT Location: https://www.studyaipro.com/ Server: Netlify X-Nf-Request-Id: 01KETD15H0MR97QSJX6RVQGHN6 Content-Length: 42 Connection: close Redirecting to https://www.studyaipro.com/
Open service 35.157.26.135:443 · calvohq.com
2026-01-13 00:45
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 4269
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:45:07 GMT
Etag: "3768398cfd97a3085c2bb36fab7dcf1a-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETD0J6HA1VQJ6ZMFWY4GY82
Connection: close
Page title: Calvo HQ - AI-Powered LinkedIn Growth Platform
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta
name="viewport"
content="width=device-width, initial-scale=1.0, maximum-scale=1" />
<title>Calvo HQ - AI-Powered LinkedIn Growth Platform</title>
<meta name="description" content="Dominate LinkedIn without the grind. AI-powered content generation, post analysis, and strategic engagement tools for B2B professionals." />
<meta name="keywords" content="LinkedIn growth, LinkedIn AI tool, LinkedIn content generator, LinkedIn post analyzer, LinkedIn engagement, B2B LinkedIn marketing, LinkedIn lead generation, AI content creation, LinkedIn automation, social media marketing, LinkedIn strategy, content marketing, LinkedIn analytics, LinkedIn optimization, personal branding" />
<meta name="author" content="Calvo HQ" />
<meta name="robots" content="index, follow" />
<link rel="canonical" href="https://calvohq.com/" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://calvohq.com/" />
<meta property="og:title" content="Calvo HQ - AI-Powered LinkedIn Growth Platform" />
<meta property="og:description" content="Dominate LinkedIn without the grind. AI-powered content generation, post analysis, and strategic engagement tools for B2B professionals." />
<meta property="og:image" content="https://calvohq.com/og-image.png" />
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image" />
<meta property="twitter:url" content="https://calvohq.com/" />
<meta property="twitter:title" content="Calvo HQ - AI-Powered LinkedIn Growth Platform" />
<meta property="twitter:description" content="Dominate LinkedIn without the grind. AI-powered content generation, post analysis, and strategic engagement tools for B2B professionals." />
<meta property="twitter:image" content="https://calvohq.com/og-image.png" />
<!-- Schema.org Structured Data -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "SoftwareApplication",
"name": "Calvo HQ",
"applicationCategory": "BusinessApplication",
"operatingSystem": "Web",
"description": "AI-powered LinkedIn growth platform for B2B professionals. Generate viral content, analyze posts, and automate strategic engagement.",
"url": "https://calvohq.com",
"offers": {
"@type": "AggregateOffer",
"lowPrice": "0",
"highPrice": "79",
"priceCurrency": "USD",
"priceSpecification": [
{
"@type": "UnitPriceSpecification",
"price": "0",
"priceCurrency": "USD",
"name": "Free Plan"
},
{
"@type": "UnitPriceSpecification",
"price": "39",
"priceCurrency": "USD",
"name": "Starter Plan"
},
{
"@type": "UnitPriceSpecification",
"price": "79",
"priceCurrency": "USD",
"name": "Professional Plan"
}
]
},
"aggregateRating": {
"@type": "AggregateRating",
"ratingValue": "4.8",
"ratingCount": "127"
},
"featureList": [
"AI Post Analyzer",
"Content Generator",
"Comment Generator",
"Performance Intelligence",
"Strategic Commenter",
"Swipe File"
]
}
</script>
<!-- THIS IS THE START OF A COMMENT BLOCK, BLOCK TO BE DELETED: Google Fonts here, example:
<link rel="preconnect" href="https://fonts.googleapis.com" />
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin />
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700&display=swap" rel="stylesheet" />
THIS IS THE END OF A COMMENT BLOCK, BLOCK TO BE DELETED -->
<script type="module" crossorigin src="/assets/index-yXS-EJGy.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-B3N39V5G.css">
</head>
<body>
Open service 35.157.26.135:80 · calvohq.com
2026-01-13 00:45
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:45:16 GMT Location: https://calvohq.com/ Server: Netlify X-Nf-Request-Id: 01KETD0TD5RC0WTXK67MH7CV2J Content-Length: 35 Connection: close Redirecting to https://calvohq.com/
Open service 35.157.26.135:443 · mapasmentalesbiblia.com
2026-01-13 00:44
HTTP/1.1 404 Not Found Cache-Control: private, max-age=0 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:55 GMT Server: Netlify X-Nf-Request-Id: 01KETD062Z89DC4ZD2B8F1CV66 Content-Length: 50 Connection: close Not Found - Request ID: 01KETD062Z89DC4ZD2B8F1CV66
Open service 35.157.26.135:80 · mapasmentalesbiblia.com
2026-01-13 00:44
HTTP/1.1 404 Not Found Cache-Control: private, max-age=0 Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:45:02 GMT Server: Netlify X-Nf-Request-Id: 01KETD0D0409EPKAAHR4TN2P1R Content-Length: 50 Connection: close Not Found - Request ID: 01KETD0D0409EPKAAHR4TN2P1R
Open service 35.157.26.135:443 · infinitesupport.com.au
2026-01-13 00:44
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 19829
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 4271
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:44:42 GMT
Etag: "df9f19d8d40bd60486592d2e7038d2ea-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCZSY3KH8RVX8651X5RVFG
Connection: close
Page title: Infinite Support | NDIS Support Service | Melbourne & Victoria
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Infinite Support | NDIS Support Service | Melbourne & Victoria</title>
<meta name="description" content="Infinite Support provides specialized NDIS services for ASD, complex behaviors, and psychosocial disability in Melbourne and Victoria. We prioritize mental health with rotating staff, internal counselling, and fast allied health referrals." />
<meta name="author" content="Infinite Support" />
<meta name="keywords" content="NDIS, autism support, ASD, mental health, disability support, Melbourne, Victoria, NDIS provider, psychosocial disability, complex behaviors" />
<meta name="robots" content="index, follow, max-snippet:-1, max-image-preview:large, max-video-preview:-1" />
<meta name="theme-color" content="#ff5317" />
<meta name="msapplication-TileColor" content="#ff5317" />
<!-- Google Search Console Verification -->
<meta name="google-site-verification" content="YOUR_GSC_VERIFICATION_CODE_HERE" />
<!-- Google Analytics 4 -->
<!-- Replace GA_MEASUREMENT_ID with your actual GA4 measurement ID -->
<script async src="https://www.googletagmanager.com/gtag/js?id=GA_MEASUREMENT_ID"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'GA_MEASUREMENT_ID');
</script>
<!-- Enhanced Open Graph Properties -->
<meta property="og:title" content="Infinite Support | NDIS Support Service | Melbourne & Victoria" />
<meta property="og:description" content="Infinite Support provides specialized NDIS services for ASD, complex behaviors, and psychosocial disability in Melbourne and Victoria. We prioritize mental health with rotating staff, internal counselling, and fast allied health referrals." />
<meta property="og:type" content="website" />
<meta property="og:url" content="https://infinitesupport.lovable.app/" />
<meta property="og:site_name" content="Infinite Support | NDIS Support Service" />
<meta property="og:locale" content="en_AU" />
<meta property="og:image" content="https://infinitesupport.lovable.app/favicon.png" />
<meta property="og:image:width" content="1200" />
<meta property="og:image:height" content="630" />
<meta property="og:image:alt" content="Infinite Support - NDIS Support Service Logo" />
<!-- Enhanced Twitter Card Properties -->
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:site" content="@pty_infinite" />
<meta name="twitter:creator" content="@pty_infinite" />
<meta name="twitter:title" content="Infinite Support | NDIS Support Service | Melbourne & Victoria" />
<meta name="twitter:description" content="Infinite Support provides specialized NDIS services for ASD, complex behaviors, and psychosocial disability in Melbourne and Victoria. We prioritize mental health with rotating staff, internal counselling, and fast allied health referrals." />
<meta name="twitter:image" content="https://infinitesupport.lovable.app/favicon.png" />
<meta name="twitter:image:alt" content="Infinite Support - NDIS Support Service Logo" />
<!-- Favicon and App Icons -->
<link rel="icon" href="/favicon.png" type="image/png">
<link rel="icon" href="/favicon.png" sizes="16x16" type="image/png">
<link rel="icon" href="/favicon.png" sizes="32x32" type="image/png">
<link rel="apple-touch-icon" href="/favicon.png" sizes="180x180">
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600;700&display=swap" rel="stylesheet">
<script type="module" crossorigin src="/assets/index-BEp8jIPg.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-Bfv7euG8.css">
</head>
<body>
<div id="root"></div
Open service 35.157.26.135:80 · infinitesupport.com.au
2026-01-13 00:44
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:50 GMT Location: https://infinitesupport.com.au/ Server: Netlify X-Nf-Request-Id: 01KETD015FN8YPJKQ3ZAC3YGC9 Content-Length: 46 Connection: close Redirecting to https://infinitesupport.com.au/
Open service 35.157.26.135:80 · www.popupmarketeers.co.za
2026-01-13 00:44
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:41 GMT Location: https://www.popupmarketeers.co.za/ Server: Netlify X-Nf-Request-Id: 01KETCZRA4A304E51H1WR6QP74 Content-Length: 49 Connection: close Redirecting to https://www.popupmarketeers.co.za/
Open service 35.157.26.135:443 · www.popupmarketeers.co.za
2026-01-13 00:44
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:32 GMT Location: https://popupmarketeers.co.za/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCZG1HGZDSRRAEZ04QBZKJ Content-Length: 45 Connection: close Redirecting to https://popupmarketeers.co.za/
Open service 35.157.26.135:80 · www.baggythetrencher.app
2026-01-13 00:44
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:31 GMT Location: https://www.baggythetrencher.app/ Server: Netlify X-Nf-Request-Id: 01KETCZEG9MT8G64D6XXZKYPS6 Content-Length: 48 Connection: close Redirecting to https://www.baggythetrencher.app/
Open service 35.157.26.135:443 · www.baggythetrencher.app
2026-01-13 00:44
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:22 GMT Location: https://baggythetrencher.app/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCZ63C0MDAYE84YN6KCQZJ Content-Length: 44 Connection: close Redirecting to https://baggythetrencher.app/
Open service 35.157.26.135:80 · ateliernava.com
2026-01-13 00:44
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:20 GMT Location: https://ateliernava.com/ Server: Netlify X-Nf-Request-Id: 01KETCZ43WPDRN5D2A4E960KK4 Content-Length: 39 Connection: close Redirecting to https://ateliernava.com/
Open service 35.157.26.135:443 · ateliernava.com
2026-01-13 00:44
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 611
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:44:12 GMT
Etag: "aa7c1265067b0acb61f50d5301760707-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCYWD90228FDZ1GMCDFQAP
Connection: close
Page title: atelier nava
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>atelier nava</title>
<meta name="description" content="nava is an architecture practice based in Lisbon and Zürich. Website under construction.">
<link rel="stylesheet" href="style.css">
</head>
<body>
<main>
<p>
nava<br>
is an architecture practice<br>
based in lisbon and zürich<br><br>
<a href="mailto:info@ateliernava.com">info@ateliernava.com</a><br><br>
website under construction
</p>
</main>
</body>
</html>
Open service 35.157.26.135:80 · www.firstx.ai
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:10 GMT Location: https://www.firstx.ai/ Server: Netlify X-Nf-Request-Id: 01KETCYTN6EKH25CHBR3ADRA6T Content-Length: 37 Connection: close Redirecting to https://www.firstx.ai/
Open service 35.157.26.135:443 · www.firstx.ai
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:44:02 GMT Location: https://firstx.ai/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCYJNCEMYMNNV00FFQ7X0W Content-Length: 33 Connection: close Redirecting to https://firstx.ai/
Open service 35.157.26.135:443 · bultimore.com
2026-01-13 00:43
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 9537
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:43:41 GMT
Etag: "c1d9fed72f87e9a17cdf01cc48f9206f-ssl"
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETCXY0KFAV8W5Z9SAW0KTS6
X-Xss-Protection: 1; mode=block
Connection: close
Page title: Bultimore
<!DOCTYPE html>
<html lang='en'>
<head>
<meta charset='UTF-8'>
<meta name='viewport' content='width=device-width, initial-scale=1.0'>
<title>Bultimore</title>
<link href='https://cdn.jsdelivr.net/npm/bootstrap@5.3.2/dist/css/bootstrap.min.css' rel='stylesheet'>
<link href='https://cdnjs.cloudflare.com/ajax/libs/font-awesome/6.4.2/css/all.min.css' rel='stylesheet'>
<link href='style.css' rel='stylesheet'>
<style>
:root {
--primary: #FDDC5C;
--dark: #996515;
--nav-h: 90px;
}
/* TOPBAR */
.topbar {
background: var(--dark);
padding: 6px 0;
color: white;
}
HEADER BACKGROUND IMAGE
.site-header {
position: sticky;
top: 0;
z-index: 999;
transition: 0.3s ease;
background-image: url("assets/digital_archieve.jpg");
background-size: cover;
background-position: center;
background-repeat: no-repeat;
}
/* NAVBAR */
.main-nav {
background: transparent !important;
height: var(--nav-h);
display: flex;
align-items: center;
transition: 0.3s ease;
}
/* Brand */
.navbar-brand {
color: var(--dark);
font-weight: 700;
font-size: 1.6rem;
transition: 0.3s;
}
.navbar-brand:hover {
color: rgba(29, 28, 28, 0.75)
}
.site-header.scrolled .navbar-brand {
color: var(--dark);
}
/* NAV LINKS */
.nav-link {
text-decoration: none !important;
white-space: nowrap;
color: var(--dark);
font-weight: 600;
font-size: 1rem;
padding: 10px 6px;
transition: 0.3s;
position: relative;
line-height: 1;
}
.nav-link:hover,
.nav-link:active,
.nav-link:focus {
text-decoration: none !important;
}
/* Animated underline */
.nav-link::after {
content: "";
position: absolute;
left: 50%;
bottom: -2px;
width: 60%;
height: 2px;
background: linear-gradient(90deg, var(--primary), var(--dark));
transform: translateX(-50%) scaleX(0);
transform-origin: center;
transition: transform 0.25s ease;
}
.nav-link:hover::after,
.nav-link.active::after {
transform: translateX(-50%) scaleX(1);
}
body {
padding-top: var(--nav-h);
}
.site-header.scrolled .nav-link {
color: var(--dark);
}
/* HAMBURGER */
.custom-toggler {
border: none;
background: transparent;
display: none;
}
.hamburger {
width: 24px;
height: 20px;
position: relative;
}
.hamburger span {
position: absolute;
width: 100%;
height: 2px;
background: white;
left: 0;
transition: 0.3s;
}
.hamburger span:nth-child(1) { top: 0; }
.hamburger span:nth-child(2) { top: 8px; }
.hamburger span:nth-child(3) { top: 16px; }
.site-header.scrolled .hamburger span {
background: var(--dark);
}
.custom-toggler.open .hamburger span:nth-child(1) {
transform: translateY(8px) rotate(45deg);
}
.custom-toggler.open .hamburger span:nth-child(2) {
opacity: 0;
}
.custom-toggler.open .hamburger span:nth-child(3) {
transform: translateY(-8px) rotate(-45deg);
}
@media(max-width: 992px){
.navbar-toggler { display: block; }
.navbar-collapse {
background: white;
padding: 20px;
}
.nav-link {
color: var(--dark) !important;
}
}
/* Mobile: let Bootstrap control it */
@media (max-width: 991px) {
.navbar-collapse {
display: none;
}
.navbar-collapse.show {
display: block;
background: white;
padding: 12px 0;
}
.navbar-nav {
flex-direction: column !important;
}
}
.navbar-toggler {
border: none;
}
.navbar-toggler-icon {
filter: invert(1);
}
#bg-video,
.overlay {
pointer-events: none;
}
.hero,
.hero .content {
pointer-events: auto;
}
.site-header,
.site-header * {
pointer-events: auto;
}
/*#bg-video {
position: absolute;
inset: 0;
width: 100%;
height: 100%;
object-fit: cover;
}
.overlay {
position: absolute;
inset: 0;
background: linear-gradient(180deg, rgba(0,0,0,0.5), rgba(0,0,0,0.4));
}*/
.hero .content {
position: relative;
z-index: 3;
padding-top: 30vh;
}
Open service 35.157.26.135:443 · expertlockandkey.com
2026-01-13 00:43
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 558
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:43:41 GMT
Etag: "aa1f5db7ecb30a465e4eef489e57a1ed-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCXXZXJE2RQB5KS3BP7Z29
Connection: close
Page title: EXPERT LOCK & KEY
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>EXPERT LOCK & KEY</title>
<script type="module" crossorigin src="/assets/index-CTamdXJy.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-Bz15nNVu.css">
<script async src="https://bolt.new/badge.js?s=bf48c0e6-df17-4ce3-b3fa-6402d78a872d"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · bultimore.com
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:49 GMT Location: https://bultimore.com/ Server: Netlify X-Nf-Request-Id: 01KETCY5RT7G2KANK83VT5GDVM Content-Length: 37 Connection: close Redirecting to https://bultimore.com/
Open service 35.157.26.135:80 · expertlockandkey.com
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:50 GMT Location: https://expertlockandkey.com/ Server: Netlify X-Nf-Request-Id: 01KETCY6H4Y40HPQP38GR80A2J Content-Length: 44 Connection: close Redirecting to https://expertlockandkey.com/
Open service 35.157.26.135:80 · www.jejuoreum.kr
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:49 GMT Location: https://www.jejuoreum.kr/ Server: Netlify X-Nf-Request-Id: 01KETCY5KDV96T3NKZJ6Q0Z0SM Content-Length: 40 Connection: close Redirecting to https://www.jejuoreum.kr/
Open service 35.157.26.135:443 · www.jejuoreum.kr
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:41 GMT Location: https://jejuoreum.kr/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCXY197WYEMD45QFFQ9KNA Content-Length: 36 Connection: close Redirecting to https://jejuoreum.kr/
Open service 35.157.26.135:443 · www.wirabot.xyz
2026-01-13 00:43
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 2728
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:43:30 GMT
Etag: "3e6c8a57a04559b6a557beb168a23ce7-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCXKB8QYZPTQWF1509JEKG
Connection: close
Page title: WiraBot Dashboard
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>WiraBot Dashboard</title>
<link rel="stylesheet" href="style.css" />
</head>
<body>
<header class="hero">
<h1>WiraBot Dashboard</h1>
<p>Your all-in-one Discord bot for moderation, fun, and more!</p>
<div class="buttons">
<a href="https://discord.com/oauth2/authorize?client_id=1377679370197405696&permissions=8&integration_type=0&scope=bot" class="cta">🤖 Add Bot to My Server</a>
<a href="https://patreon.com/WiraBot?utm_medium=unknown&utm_source=join_link&utm_campaign=creatorshare_creator&utm_content=copyLink" class="cta alt">❤️ Support WiraBot!</a>
</div>
</header>
<section class="feature">
<div class="text">
<h2>/dog</h2>
<p>Sends a random dog image – instant cuteness!</p>
</div>
<img src="dog.png" alt="/dog command screenshot" />
</section>
<section class="feature">
<div class="text">
<h2>/say</h2>
<p>Repeats your message with style and presence.</p>
</div>
<img src="say.png" alt="/say command screenshot" />
</section>
<section class="feature">
<div class="text">
<h2>Welcome Messages</h2>
<p>Automatically greets new members with a warm welcome.</p>
</div>
<img src="welcome.png" alt="welcome screenshot" />
</section>
<section class="feature">
<div class="text">
<h2>/play</h2>
<p>Plays music from YouTube, Spotify & more.</p>
</div>
<img src="play.png" alt="/play command screenshot" />
</section>
<section class="feature">
<div class="text">
<h2>Moderation & Logging</h2>
<p>Handle bans, mutes, role updates and more with clear logs and mod tools – just like a pro.</p>
</div>
<img src="moderation.png" alt="Moderation features screenshot" />
</section>
<section class="feature">
<div class="text">
<h2>Documentation</h2>
<p><strong>/dog</strong> – Sends a random dog picture<br/>
<strong>/say</strong> – Repeats your message<br/>
<strong>/play</strong> – Starts music playback<br/>
<strong>/ban, /kick, /mute</strong> – Full server control</p>
</div>
</section>
<section class="feature">
<div class="text">
<h2>Terms of Service</h2>
<p><strong>1. Data:</strong> We do not store your private messages. Only public commands are logged for moderation.<br/>
<strong>2. Usage:</strong> You may not use WiraBot to spam, harass or harm other users or servers.</p>
</div>
</section>
<footer>
<p>© 2025 WiraBot – Not affiliated with Discord</p>
</footer>
</body>
</html>
Open service 35.157.26.135:80 · creastic.byronic.art
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:37 GMT Location: https://creastic.byronic.art/ Server: Netlify X-Nf-Request-Id: 01KETCXT94J5AEJ37GP2J748CX Content-Length: 44 Connection: close Redirecting to https://creastic.byronic.art/
Open service 35.157.26.135:443 · creastic.byronic.art
2026-01-13 00:43
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 68053
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:43:29 GMT
Etag: "b55cb6cd73e7dda2cb0c105026484028-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCXJSSES4VX8P6PMPW6VXV
Connection: close
Page title: Creastic - Recycler pour l'océan
<!DOCTYPE html>
<html lang="fr">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Creastic - Recycler pour l'océan</title>
<script src="https://cdn.tailwindcss.com"></script>
<link href="https://unpkg.com/aos@2.3.1/dist/aos.css" rel="stylesheet">
<style>
@import url('https://fonts.googleapis.com/css2?family=Poppins:wght@300;400;600;700&display=swap');
@font-face {
font-family: 'Tan Buster-Bold';
src: url('./font.otf') format('opentype');
font-weight: bold;
font-style: normal;
}
* {
font-family: 'Poppins', sans-serif;
}
html {
scroll-behavior: smooth;
}
body {
overflow-x: hidden;
background: #ffffff; /* White for top overscroll */
scroll-snap-type: y proximity;
overflow-y: scroll;
height: 100vh;
}
section {
scroll-snap-align: start;
}
footer {
scroll-snap-align: none;
}
body::after {
content: '';
position: fixed;
bottom: 0;
left: 0;
right: 0;
height: 100vh;
background: #111827; /* Footer dark for bottom overscroll */
z-index: -1;
}
.mission-bg {
background: transparent;
}
.ocean-bg {
background: #ffffff;
}
.wave-container {
position: relative;
overflow: hidden;
}
/* Blue water layer behind waves - only at the very bottom */
.wave-container::before {
content: '';
position: absolute;
bottom: -1px;
left: 0;
right: 0;
height: 120px;
background: #0c4a6e;
z-index: 4;
}
.wave {
position: absolute;
bottom: -1px;
left: 0;
width: 200%;
height: 150px;
background: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' viewBox='0 0 1200 120' preserveAspectRatio='none'%3E%3Cpath d='M0,0V46.29c47.79,22.2,103.59,32.17,158,28,70.36-5.37,136.33-33.31,206.8-37.5C438.64,32.43,512.34,53.67,583,72.05c69.27,18,138.3,24.88,209.4,13.08,36.15-6,69.85-17.84,104.45-29.34C989.49,25,1113-14.29,1200,52.47V0Z' opacity='.25' fill='%23ffffff'/%3E%3Cpath d='M0,0V15.81C13,36.92,27.64,56.86,47.69,72.05,99.41,111.27,165,111,224.58,91.58c31.15-10.15,60.09-26.07,89.67-39.8,40.92-19,84.73-46,130.83-49.67,36.26-2.85,70.9,9.42,98.6,31.56,31.77,25.39,62.32,62,103.63,73,40.44,10.79,81.35-6.69,119.13-24.28s75.16-39,116.92-43.05c59.73-5.85,113.28,22.88,168.9,38.84,30.2,8.66,59,6.17,87.09-7.5,22.43-10.89,48-26.93,60.65-49.24V0Z' opacity='.5' fill='%23ffffff'/%3E%3Cpath d='M0,0V5.63C149.93,59,314.09,71.32,475.83,42.57c43-7.64,84.23-20.12,127.61-26.46,59-8.63,112.48,12.24,165.56,35.4C827.93,77.22,886,95.24,951.2,90c86.53-7,172.46-45.71,248.8-84.81V0Z' fill='%23ffffff'/%3E%3C/svg%3E") repeat-x;
animation: wave 25s linear infinite;
z-index: 5;
}
.wave:nth-child(2) {
bottom: -1px;
height: 120px;
animation: wave 18s linear infinite, swell 7s ease -1.25s infinite;
opacity: 0.5;
}
.wave:nth-child(3) {
bottom: -1px;
height: 100px;
animation: wave 30s linear infinite;
opacity: 0.3;
}
@keyframes wave {
0% { transform: translateX(0); }
100% { transform: translateX(-50%); }
}
@keyframes swell {
0%, 100% { transform: translate3d(0,-10px,0); }
50% { transform: translate3d(0,5px,0); }
}
/* Navbar styles */
nav {
transition: all 0.3s ease;
}
nav.glass {
background: rgba(255, 255, 255, 0.7);
backdrop-fi
Open service 35.157.26.135:80 · www.wirabot.xyz
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:37 GMT Location: https://www.wirabot.xyz/ Server: Netlify X-Nf-Request-Id: 01KETCXT66VECAERQ2G7XYYFA0 Content-Length: 39 Connection: close Redirecting to https://www.wirabot.xyz/
Open service 35.157.26.135:80 · www.felipesoto.cl
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:31 GMT Location: https://www.felipesoto.cl/ Server: Netlify X-Nf-Request-Id: 01KETCXMJM11HQK1G6NH9HXSCE Content-Length: 41 Connection: close Redirecting to https://www.felipesoto.cl/
Open service 35.157.26.135:443 · www.felipesoto.cl
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:22 GMT Location: https://felipesoto.cl/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCXBQG0PEAZNZSE2V5CE1T Content-Length: 37 Connection: close Redirecting to https://felipesoto.cl/
Open service 35.157.26.135:80 · openmapsafaris.co.ke
2026-01-13 00:43
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:43:15 GMT Location: https://openmapsafaris.co.ke/ Server: Netlify X-Nf-Request-Id: 01KETCX52BA9YJ4KPS979QM364 Content-Length: 44 Connection: close Redirecting to https://openmapsafaris.co.ke/
Open service 35.157.26.135:443 · openmapsafaris.co.ke
2026-01-13 00:43
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 21418
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:43:07 GMT
Etag: "2389f5869c42d6584fdd668314e45b42-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCWWFJGH2P4DG4MBPDQAZN
Connection: close
Page title: Open Map Safaris - Explore Beyond
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8">
<title>Open Map Safaris - Explore Beyond</title>
<meta content="width=device-width, initial-scale=1.0" name="viewport">
<meta content="African safaris, wildlife tours, safari packages, guided tours, Open Map Safaris, adventure travel, African wilderness, wildlife experiences, safari holidays" name="keywords">
<meta content="Explore the African wilderness with Open Map Safaris. Offering unique wildlife tours and adventure travel experiences across Africa, tailored to your preferences. Discover the best of African safaris with our expert guides." name="description">
<!-- Favicon -->
<link href="img/Open-Map-Safaris-With-Phrase.ico" rel="icon">
<link href="https://www.openmapsafaris.co.ke/img/OpenMapIcon.png" rel="icon">
<!-- Google Web Fonts -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Heebo:wght@400;500;600&family=Nunito:wght@600;700;800&display=swap" rel="stylesheet">
<!-- Icon Font Stylesheet -->
<link href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/5.10.0/css/all.min.css" rel="stylesheet">
<link href="https://cdn.jsdelivr.net/npm/bootstrap-icons@1.4.1/font/bootstrap-icons.css" rel="stylesheet">
<!-- Libraries Stylesheet -->
<link href="lib/animate/animate.min.css" rel="stylesheet">
<link href="lib/owlcarousel/assets/owl.carousel.min.css" rel="stylesheet">
<link href="lib/tempusdominus/css/tempusdominus-bootstrap-4.min.css" rel="stylesheet" />
<!-- Customized Bootstrap Stylesheet -->
<link href="css/bootstrap.min.css" rel="stylesheet">
<!-- Template Stylesheet -->
<link href="css/style.css" rel="stylesheet">
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "TravelAgency",
"name": "Open Map Safaris",
"url": "https://www.openmapsafaris.co.ke",
"logo": "https://www.openmapsafaris.co.ke/img/OpenMapIcon.png",
"image": "https://www.openmapsafaris.co.ke/img/safari-myths-zebra.webp",
"description": "Explore the African wilderness with Open Map Safaris. Offering unique wildlife tours and adventure travel experiences across Africa, tailored to your preferences.",
"address": {
"@type": "PostalAddress",
"streetAddress": "Nairobi",
"addressLocality": "Nairobi",
"addressCountry": "KE"
},
"contactPoint": {
"@type": "ContactPoint",
"telephone": "+254793805810",
"contactType": "Customer Service",
"areaServed": "KE",
"availableLanguage": "English"
},
"sameAs": [
"https://x.com/OpenMapSafaris",
"https://www.linkedin.com/in/open-map-safaris-812aa8324/",
"https://www.youtube.com/channel/UCC10qNO8txkkzqPaZf6QR7A"
],
"openingHoursSpecification": {
"@type": "OpeningHoursSpecification",
"dayOfWeek": [
"Monday",
"Tuesday",
"Wednesday",
"Thursday",
"Friday"
],
"opens": "09:00",
"closes": "18:00"
},
"offers": {
"@type": "OfferCatalog",
"name": "Safari Packages",
"itemListElement": [
{
"@type": "Offer",
"itemOffered": {
"@type": "Service",
"name": "WorldWide Tours",
"description": "Explore exotic destinations across the globe with our expert-guided tours."
}
},
{
"@type": "Offer",
"itemOffered": {
"@type": "Service",
"name": "Hotel Reservation",
"description": "Stay in the best accommodations, carefully selected to meet your needs and preferences."
}
},
{
"@type": "Offer",
"itemOffered": {
"@type": "Service",
"name": "Travel Guides",
"description": "Our experienced guides ensure you get the most out of your safari with in-depth knowledge of the areas you visit."
}
},
{
"@type": "Offer",
"itemOffered": {
"@type": "Service",
"nam
Open service 35.157.26.135:80 · meowsthetime.shop
2026-01-13 00:42
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:42:54 GMT Location: https://meowsthetime.shop/ Server: Netlify X-Nf-Request-Id: 01KETCWGAQ9XRN1H5K5QNK5Q9Z Content-Length: 41 Connection: close Redirecting to https://meowsthetime.shop/
Open service 35.157.26.135:443 · meowsthetime.shop
2026-01-13 00:42
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 10780
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:42:45 GMT
Etag: "fa870a4a914f9fd2de31022e83dfde57-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCW7KWR5XNMCM038JJZFGD
Connection: close
Page title: Meow's the Time
<!DOCTYPE html>
<html>
<head>
<title>Meow's the Time</title>
<!-- Link to Tailwind CSS -->
<link rel="stylesheet" href="tailwindmin.css">
<!-- Link to Alpine.js -->
<script src="alpinmin.js" defer=""></script>
<link rel="stylesheet" href="https://use.typekit.net/siy6nhy.css">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<link rel="icon" href="/favicon.ico" type="image/x-icon">
<style>
h1 {
font-family: "mighty-slab", serif;
font-weight: 400;
font-style: normal;
}
.layer {
font-family: "mighty-slab", serif;
font-weight: 700;
font-style: normal;
}
p {
font-family: "dolly-new", sans-serif;
font-weight: 400;
font-style: normal;
}
</style>
</head>
<!-- Google tag (gtag.js) -->
<script async src="https://www.googletagmanager.com/gtag/js?id=G-NWHSQCS802"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-NWHSQCS802');
</script>
<body class="bg-repeat p-4" style="background-image: url(background.webp)">
<div class="max-w-3xl mx-auto bg-white p-4 my-10">
<h1 class="text-2xl md:text-3xl mb-6 text-center text-gray-700">End of Time Sale! Pets half off!</h1>
<img src="storefront.webp" class="w-full mb-10 rounded border-2 border-red-300">
<h1 class="text-2xl md:text-3xl mb-6 text-center text-red-400">Question Mark, Ohio's only and longest-operating pet and pet supply store!</h1>
<h1 class="text-xl mb-2 text-center text-gray-500">Offering regular and one-of-a-kind pets!</h1>
<h1 class="text-xl mb-2 text-center text-gray-600">Borrow a friend from our Animal Library!</h1>
<h1 class="text-xl mb-2 text-center text-gray-500">Or rent-to-own!</h1>
<h1 class="text-xl mb-2 text-center text-gray-600">Under new management!</h1>
<div class="my-10" x-data="{ currentTab: 'dogs' }">
<!-- Tab Buttons -->
<div class="mb-6 mx-auto border-b-2 border-grey-200 ">
<button
class="px-2 rounded-t-lg pb-1 md:w-20 ml-6"
@click="currentTab = 'dogs'"
:class="{
'bg-red-500 text-white': currentTab === 'dogs',
'bg-gray-300 hover:bg-red-200 text-gray-800' : currentTab !== 'dogs',
}"
>
Dogs
</button>
<button
class="px-2 rounded-t-lg pb-1 md:w-20"
@click="currentTab = 'cats'"
:class="{
'bg-red-500 text-white': currentTab === 'cats',
'bg-gray-300 hover:bg-red-200 text-gray-800': currentTab !== 'cats',
}"
>
Cats
</button>
<button
class="px-2 rounded-t-lg pb-1 md:w-20"
@click="currentTab = 'reptiles'"
:class="{
'bg-red-500 text-white': currentTab === 'reptiles',
'bg-gray-300 hover:bg-red-200 text-gray-800': currentTab !== 'reptiles',
}"
>
Reptiles
</button>
<button
class="px-2 rounded-t-lg pb-1 md:w-20"
@click="currentTab = 'birds'"
:class="{
'bg-red-500 text-white': currentTab === 'birds',
'bg-gray-300 hover:bg-red-200 text-gray-800': currentTab !== 'birds',
}"
>
Birds
</button>
</div>
<!-- Content for each tab -->
<div x-show="currentTab === 'dogs'" class="w-full">
<h1 class="text-3xl text-red-400">Dogs</h1>
<p class="text-xl my-4">Dogs are often regarded as the best pet due to their unwavering loyalty and companionship, providing boundless affection and joy to their owners. Their versatility, from cuddly companions to dedicated protectors, makes them an irreplaceable part of countless households in <a class="underline" href="https://questionmark.town">Question Mark, Ohio</a>.</p>
<p class="text-xl my-4">Here are just a few of the wonderful dogs available today:
<div x-init="
images = ['dog1.webp', 'dog2.webp', 'dog3.webp', 'dog4.webp', 'dog5.webp', 'dog6.webp'];
names = ['Ruggles', 'Pee-Wee', 'Bad Charlie', 'Mickey', 'Toughy', 'Sweetums'];
blankIndices = [];
while (blankIndices.length < Math.floor(Math.random() * 3) + 1) {
const randomIndex = Math.floo
Open service 35.157.26.135:443 · zahlfix.com
2026-01-13 00:42
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 18147
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:42:11 GMT
Etag: "0a6f66d494301bb0938529f5bc9d640f-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCV5RMMP3WX16VWEW814ZV
Connection: close
Page title: Zahlfix – Structure for your numbers.
<!DOCTYPE html>
<html lang="de">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<meta name="description"
content="Zahlfix – Structure for your numbers. Clarity for your business. Legally secure. Digital. Professional accounting and business solutions.">
<meta name="keywords" content="Zahlfix, Accounting, Business, Numbers, Digital, Legally Secure, Finance">
<meta name="author" content="Zahlfix">
<meta name="theme-color" content="#FFD700">
<title>Zahlfix – Structure for your numbers.</title>
<!-- Google Fonts -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Manrope:wght@300;400;600;800&display=swap" rel="stylesheet">
<!-- CSS -->
<link rel="stylesheet" href="assets/css/style.css">
<link rel="stylesheet" href="assets/css/cursor.css">
<!-- Favicon -->
<link rel="icon" href="assets/media/favicon.png" type="image/png">
<!-- Structured Data (JSON-LD) -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "LocalBusiness",
"name": "Zahlfix",
"image": "https://images.unsplash.com/photo-1554224155-8d04cb21cd6c",
"telephone": "+49 123 456 789",
"email": "info@zahlfix.de",
"address": {
"@type": "PostalAddress",
"streetAddress": "Musterstraße 1",
"addressLocality": "Berlin",
"postalCode": "10115",
"addressCountry": "DE"
},
"url": "http://127.0.0.1:8080",
"priceRange": "$$",
"description": "Zahlfix – Struktur für Ihre Zahlen. Digitale und rechtssichere Finanzlösungen für Ihr Unternehmen."
}
</script>
</head>
<body>
<div class="grain-overlay"></div>
<!-- Custom Cursor -->
<div class="cursor-dot" data-cursor-dot></div>
<div class="cursor-outline" data-cursor-outline></div>
<!-- Navigation -->
<nav class="navbar" id="navbar">
<div class="container nav-container">
<a href="#hero" class="logo">Zahl<span class="highlight">fix</span>.</a>
<button class="menu-toggle" aria-label="Toggle navigation">
<span class="bar"></span>
<span class="bar"></span>
<span class="bar"></span>
</button>
<ul class="nav-links">
<li><a href="#services">Leistungen</a></li>
<li><a href="#about">Über uns</a></li>
<li><a href="#digital">Digital</a></li>
<li><a href="#contact" class="btn-nav">Kontakt</a></li>
</ul>
</div>
</nav>
<!-- Hero Section -->
<header id="hero" class="hero-section parallax-container">
<video id="hero-bg" class="parallax-video" autoplay muted loop playsinline poster="">
<source src="assets/media/handshake.mp4" type="video/mp4">
</video>
<div class="overlay"></div>
<div class="container hero-content">
<span class="hero-subtitle fade-in-up">Rechtssicher & Digital</span>
<h1 class="hero-title fade-in-up delay-1">ZahlFix – Struktur für Ihre <span class="highlight">Zahlen</span>.
</h1>
<p class="hero-text fade-in-up delay-2">Klarheit in Ihrer Buchhaltung. Wir organisieren Belege, Rechnungen
und Zahlen digital – in Zusammenarbeit mit Ihrem Steuerberater oder unserem Partner.</p>
<div class="hero-buttons fade-in-up delay-3">
<a href="#contact" class="btn btn-primary">Jetzt anfragen</a>
<a href="#services" class="btn btn-outline">Leistungen ansehen</a>
</div>
</div>
<div class="scroll-indicator">
<div class="mouse">
<div class="wheel"></div>
</div>
</div>
</header>
<!-- Mai
Open service 35.157.26.135:80 · zahlfix.com
2026-01-13 00:42
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:42:20 GMT Location: https://zahlfix.com/ Server: Netlify X-Nf-Request-Id: 01KETCVENQANPRFBMXS78R41F8 Content-Length: 35 Connection: close Redirecting to https://zahlfix.com/
Open service 35.157.26.135:443 · democracents.org
2026-01-13 00:41
HTTP/1.1 200 OK
Age: 0
Cache-Control: no-cache
Cache-Status: "Netlify Durable"; fwd=bypass
Cache-Status: "Netlify Edge"; fwd=miss
Content-Type: text/html
Date: Tue, 13 Jan 2026 00:41:14 GMT
Netlify-Vary: query
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Nf-Request-Id: 01KETCSEBPKH15WRKZP9ZZA9NB
Connection: close
Transfer-Encoding: chunked
Page title: Home | CivicCents
<!DOCTYPE html><html lang="en"> <head><meta charset="UTF-8"><meta name="viewport" content="width=device-width, initial-scale=1.0"><meta name="description" content="Understand where your tax dollars go with our free federal and state tax breakdown calculator"><title>Home | CivicCents</title><!-- PWA Manifest --><link rel="manifest" href="/manifest.json"><!-- Favicon --><link rel="icon" type="image/svg+xml" href="/favicon.svg"><!-- Theme Color for PWA --><meta name="theme-color" content="#4f46e5"><!-- Open Graph / Social Media --><meta property="og:title" content="Home"><meta property="og:description" content="Understand where your tax dollars go with our free federal and state tax breakdown calculator"><meta property="og:type" content="website"><!-- Twitter Card --><meta name="twitter:card" content="summary_large_image"><meta name="twitter:title" content="Home"><meta name="twitter:description" content="Understand where your tax dollars go with our free federal and state tax breakdown calculator"><style></style>
<link rel="stylesheet" href="/_astro/_slug_.Bc0xjEUh.css?dpl=6965933e4bb5cb26594ba027"></head> <body class="flex flex-col min-h-screen bg-gray-50"> <!-- Header Component --> <header class="bg-gray-200 text-white shadow-lg"> <nav class="max-w-6xl mx-auto px-4 py-1"> <div class="flex items-center justify-between"> <!-- Logo/Brand --> <a href="/" class="flex items-center gap-2 text-xl font-bold hover:text-indigo-200 transition"> <img src="/logo-512.png" alt="CivicCents Logo" class="w-32 h-32"> </a> <!-- Navigation Links --> <div class="hidden md:flex items-center gap-6"> <a href="/" class="hover:text-indigo-200 transition font-medium">
Home
</a> <a href="/calculator" class="hover:text-indigo-200 transition font-medium">
Calculator
</a> <a href="/blog" class="hover:text-indigo-200 transition font-medium">
Blog
</a> <a href="/about" class="hover:text-indigo-200 transition font-medium">
About
</a> </div> <!-- Mobile Menu Button --> <button id="mobile-menu-btn" class="md:hidden p-2"> <svg class="w-6 h-6" fill="none" stroke="currentColor" viewBox="0 0 24 24"> <path stroke-linecap="round" stroke-linejoin="round" stroke-width="2" d="M4 6h16M4 12h16M4 18h16"></path> </svg> </button> </div> <!-- Mobile Menu --> <div id="mobile-menu" class="hidden md:hidden mt-4 pb-4 border-t border-indigo-500 pt-4"> <div class="flex flex-col gap-3"> <a href="/" class="hover:text-indigo-200 transition font-medium">
Home
</a> <a href="/calculator" class="hover:text-indigo-200 transition font-medium">
Calculator
</a> <a href="/blog" class="hover:text-indigo-200 transition font-medium">
Blog
</a> <a href="/about" class="hover:text-indigo-200 transition font-medium">
About
</a> </div> </div> </nav> </header> <script type="module">const e=document.getElementById("mobile-menu-btn"),n=document.getElementById("mobile-menu");e?.addEventListener("click",()=>{n?.classList.toggle("hidden")});</script> <!-- Top Ad Banner (if enabled) --> <div class="ad-banner mb-8" data-astro-cid-33f3bo6r> <div class="max-w-6xl mx-auto px-4" data-astro-cid-33f3bo6r> <!-- Placeholder for Google AdSense or direct sponsor --> <div class="bg-gray-100 border-2 border-dashed border-gray-300 rounded-lg p-6 text-center" data-astro-cid-33f3bo6r> <p class="text-gray-500 text-sm mb-2" data-astro-cid-33f3bo6r>Advertisement</p> <!-- Replace this section with your actual ad code --> <!-- Example: Google AdSense --> <!--
<ins class="adsbygoogle"
style="display:block"
data-ad-client="ca-pub-XXXXXXXXXXXXXXXX"
data-ad-slot="XXXXXXXXXX"
data-ad-format="auto"
data-full-width-responsive="true"></ins>
<script>
(adsbygoogle = window.adsbygoogle || []).push({});
</script>
--> <!-- Placeholder content - remove when adding real ads
<div class="bg-white rounded p-4 max-w-2xl mx-auto">
<p class="text-gray-600 font-semibold">Your Ad Space Here</p>
<p class="text-gray-500 text-sm mt-1">728 x 90 banner</p>
</div>
--> </div> </div> </div> <!-- Main Content Area (this is where page conte
Open service 35.157.26.135:80 · democracents.org
2026-01-13 00:41
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:41:21 GMT Location: https://democracents.org/ Server: Netlify X-Nf-Request-Id: 01KETCSMW8ANRP2NGD8TA6X69A Content-Length: 40 Connection: close Redirecting to https://democracents.org/
Open service 35.157.26.135:80 · marinagasservice.com
2026-01-13 00:41
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:41:22 GMT Location: https://marinagasservice.com/ Server: Netlify X-Nf-Request-Id: 01KETCSNYWJK77HVVQPZC4D0QG Content-Length: 44 Connection: close Redirecting to https://marinagasservice.com/
Open service 35.157.26.135:443 · marinagasservice.com
2026-01-13 00:41
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 58033
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:41:13 GMT
Etag: "c328786ad764c2742364e4df2d199b15-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCSDFYEA7K2BCP6WC1VPWM
Connection: close
Page title: Marina Gas Service | Indane LPG Distributor in Itanagar | First LPG Agency in Arunachal Pradesh
<!DOCTYPE html><html lang="en"> <head><meta charset="UTF-8"><meta name="description" content="Marina Gas Service is the first Indane LPG distributor in Arunachal Pradesh, catering to Itanagar city with reliable domestic and commercial LPG cylinders and NFR products."><meta name="viewport" content="width=device-width, initial-scale=1.0"><link rel="icon" type="image/png" href="/images/5kg.png"><link rel="shortcut icon" type="image/png" href="/images/5kg.png"><meta name="generator" content="Astro v4.16.19"><!-- SEO Meta Tags --><title>Marina Gas Service | Indane LPG Distributor in Itanagar | First LPG Agency in Arunachal Pradesh</title><meta property="og:title" content="Marina Gas Service | Indane LPG Distributor in Itanagar | First LPG Agency in Arunachal Pradesh"><meta property="og:description" content="Marina Gas Service is the first Indane LPG distributor in Arunachal Pradesh, catering to Itanagar city with reliable domestic and commercial LPG cylinders and NFR products."><meta property="og:type" content="website"><meta property="og:url" content="https://marina-gas-service.netlify.app/"><meta property="og:site_name" content="Marina Gas Service"><meta name="twitter:card" content="summary_large_image"><meta name="twitter:title" content="Marina Gas Service | Indane LPG Distributor in Itanagar | First LPG Agency in Arunachal Pradesh"><meta name="twitter:description" content="Marina Gas Service is the first Indane LPG distributor in Arunachal Pradesh, catering to Itanagar city with reliable domestic and commercial LPG cylinders and NFR products."><!-- Language alternates --><link rel="alternate" hreflang="hi" href="https://marina-gas-service.netlify.app/hi"><link rel="alternate" hreflang="x-default" href="https://marina-gas-service.netlify.app/"><!-- Canonical URL --><link rel="canonical" href="https://marina-gas-service.netlify.app/"><!-- Google Fonts --><link rel="preconnect" href="https://fonts.googleapis.com"><link rel="preconnect" href="https://fonts.gstatic.com" crossorigin><link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600;700;800;900&display=swap" rel="stylesheet"><!-- Structured Data --><script type="application/ld+json">{"@context":"https://schema.org","@type":"LocalBusiness","name":"Marina Gas Service","description":"Marina Gas Service is the first Indane LPG distributor in Arunachal Pradesh, serving Itanagar city with domestic and commercial LPG.","url":"https://marina-gas-service.netlify.app/","telephone":"+919774249297","address":{"@type":"PostalAddress","streetAddress":"Zero Point Tinali, Near SBI PP Branch","addressLocality":"Itanagar","addressRegion":"Arunachal Pradesh","postalCode":"791111","addressCountry":"IN"},"geo":{"@type":"GeoCoordinates","latitude":27.101801,"longitude":93.628931},"openingHoursSpecification":[{"@type":"OpeningHoursSpecification","dayOfWeek":["Monday","Tuesday","Wednesday","Thursday","Friday","Saturday"],"opens":"09:00","closes":"18:00"}],"sameAs":["https://locator.iocl.com/indane/indane-marina-gas-service-gas-agency-itanagar-papum-pare-212135/Home"]}</script><link rel="stylesheet" href="/_astro/about.OqnYRWgi.css"><script type="module">const t=document.getElementById("mobile-menu-button"),o=document.getElementById("mobile-menu");t&&o&&t.addEventListener("click",()=>{o.classList.toggle("hidden")});const e=document.getElementById("main-header"),s=document.querySelector("section.bg-gradient-to-br"),n=()=>{window.scrollY>50?e?.classList.add("scrolled"):e?.classList.remove("scrolled")};window.addEventListener("scroll",n);n();!s&&e&&e.classList.add("scrolled");
</script></head> <body class="min-h-screen flex flex-col bg-white antialiased"> <header class="fixed top-0 left-0 right-0 z-50 transition-all duration-300" id="main-header" data-astro-cid-3ef6ksr2> <div class="container mx-auto px-4 py-4" data-astro-cid-3ef6ksr2> <div class="flex items-center justify-between" data-astro-cid-3ef6ksr2> <div class="flex items-center space-x-3" data-astro-cid-3ef6ksr2> <a href="/" class="flex items-center space-x-3 group" data-astro-cid-3ef6ksr2> <div class="px-4 h-10 bg-ind
Open service 35.157.26.135:443 · www.marinagasservice.com
2026-01-13 00:41
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:41:12 GMT Location: https://marinagasservice.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCSCRQ5JWXDWQXB8CWT2WZ Content-Length: 44 Connection: close Redirecting to https://marinagasservice.com/
Open service 35.157.26.135:80 · www.marinagasservice.com
2026-01-13 00:41
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:41:20 GMT Location: https://www.marinagasservice.com/ Server: Netlify X-Nf-Request-Id: 01KETCSMJK0D0TC6A2G9SRW2AA Content-Length: 48 Connection: close Redirecting to https://www.marinagasservice.com/
Open service 35.157.26.135:80 · dodra.racing
2026-01-13 00:40
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:40:54 GMT Location: https://dodra.racing/ Server: Netlify X-Nf-Request-Id: 01KETCRTH27TE9ZNQFT49HB7K9 Content-Length: 36 Connection: close Redirecting to https://dodra.racing/
Open service 35.157.26.135:443 · www.dodra.racing
2026-01-13 00:40
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:40:46 GMT Location: https://dodra.racing/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCRK5TDKEH6GHMPMX6Y70E Content-Length: 36 Connection: close Redirecting to https://dodra.racing/
Open service 35.157.26.135:443 · dodra.racing
2026-01-13 00:40
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 4963
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:40:46 GMT
Etag: "8117601fd343db116aa9991213efc500-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCRJR9GZQVHC9N1JCEQGAW
Connection: close
Page title: DODRA Racing - Champion Drag Bike Performance Parts
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<title>DODRA Racing - Champion Drag Bike Performance Parts</title>
<meta name="copyrighted-site-verification" content="e6a5a3d1bb20808f" />
<!-- SEO Meta Tags -->
<meta name="description" content="DODRA Racing - Championship-winning Drag Bike performance parts manufacturer. Custom swingarms, bodywork, and fuel tanks for professional racers." />
<meta name="keywords" content="DODRA Racing, drag bike parts, motorcycle racing, custom swingarm, carbon bodywork, racing fuel tank, drag racing" />
<meta name="author" content="DODRA Racing" />
<!-- Open Graph Meta Tags -->
<meta property="og:title" content="DODRA Racing - Champion Drag Bike Performance Parts" />
<meta property="og:description" content="Championship-winning Drag Bike performance parts manufacturer. Custom swingarms, bodywork, and fuel tanks for professional racers." />
<meta property="og:image" content="https://dodra.racing/dodra-racing-logo.png" />
<meta property="og:url" content="https://dodra.racing" />
<meta property="og:type" content="website" />
<!-- Twitter Card Meta Tags -->
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:title" content="DODRA Racing - Champion Drag Bike Performance Parts" />
<meta name="twitter:description" content="Championship-winning Drag Bike performance parts manufacturer. Custom swingarms, bodywork, and fuel tanks for professional racers." />
<meta name="twitter:image" content="https://dodra.racing/dodra-racing-logo.png" />
<!-- Favicon -->
<link rel="icon" type="image/svg+xml" href="/favicon/favicon.svg">
<link rel="icon" type="image/x-icon" href="/favicon/favicon.ico">
<link rel="icon" type="image/png" sizes="96x96" href="/favicon/favicon-96x96.png">
<!-- Apple Touch Icon -->
<link rel="apple-touch-icon" href="/favicon/apple-touch-icon.png">
<!-- Web App Manifest -->
<link rel="manifest" href="/favicon/site.webmanifest">
<!-- Viewport -->
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- Theme Color -->
<meta name="theme-color" content="#ffffff">
<!-- Fonts -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700&display=swap" rel="stylesheet">
<!-- Animation Styles -->
<style>
[data-aos] {
opacity: 0;
transition-property: opacity, transform;
transition-duration: 0.8s;
}
[data-aos].aos-animate {
opacity: 1;
}
[data-aos="fade-up"] {
transform: translateY(30px);
}
[data-aos="fade-up"].aos-animate {
transform: translateY(0);
}
[data-aos="fade-right"] {
transform: translateX(-30px);
}
[data-aos="fade-right"].aos-animate {
transform: translateX(0);
}
[data-aos="fade-left"] {
transform: translateX(30px);
}
[data-aos="fade-left"].aos-animate {
transform: translateX(0);
}
</style>
<script type="text/javascript" src="https://cdn.ywxi.net/js/1.js" async></script>
<script type="module" crossorigin src="/assets/index-CRwBzQ5w.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-D7M21WxG.css">
</head>
<body>
<div id="root"></div>
<script>
document.addEventListener('DOMContentLoaded', function() {
setTimeout(function() {
document.querySelectorAll('[data-aos]').forEach(function(el) {
setTimeout(function() {
el.classList.add('aos-animate');
}, parseInt(el.getAttribute('data-aos-delay') || 0));
});
}, 100);
});
window.addEventListener('scroll', function() {
document.querySelectorAll('[data-aos]').forEach(function(el) {
const elementPosition = el.getBoundingCl
Open service 35.157.26.135:80 · www.thelitfinance.com
2026-01-13 00:40
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:40:23 GMT Location: https://www.thelitfinance.com/ Server: Netlify X-Nf-Request-Id: 01KETCQX0RPPQ61NPRTQGB83FH Content-Length: 45 Connection: close Redirecting to https://www.thelitfinance.com/
Open service 35.157.26.135:443 · www.thelitfinance.com
2026-01-13 00:40
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:40:15 GMT Location: https://thelitfinance.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCQN32J7KC4TV211RCPSJ9 Content-Length: 41 Connection: close Redirecting to https://thelitfinance.com/
Open service 35.157.26.135:80 · www.fusion.skin
2026-01-13 00:39
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:39:58 GMT Location: https://www.fusion.skin/ Server: Netlify X-Nf-Request-Id: 01KETCQ43JF2BXJ60SCFV9MMN8 Content-Length: 39 Connection: close Redirecting to https://www.fusion.skin/
Open service 35.157.26.135:443 · www.fusion.skin
2026-01-13 00:39
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1695
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:39:49 GMT
Etag: "20539292da67862ed1d508aa24104b7d-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCPVDHYTFKBX469KAVQRMX
Connection: close
Page title: fusion.skin
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8">
<meta name="viewport" content="width=device-width, initial-scale=1">
<title>fusion.skin</title>
<link href="https://cdn.jsdelivr.net/npm/bootstrap@5.3.7/dist/css/bootstrap.min.css" rel="stylesheet" integrity="sha384-LN+7fdVzj6u52u30Kp6M/trliBMCMKTyK833zpbD+pXdCLuTusPj697FH4R/5mcr" crossorigin="anonymous">
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;600&display=swap" rel="stylesheet">
<link href="https://cdn.jsdelivr.net/npm/bootswatch@5.2.3/dist/lux/bootstrap.min.css" rel="stylesheet"></link>
<style>
body {
font-family: 'Inter', sans-serif;
}
</style>
</head>
<body>
<header>
<div class="p-5"></div>
<div class="text-center" style="background-color: #d0debb">
<img src="logo.svg" class="p-5">
</div>
</header>
<div class="text-center mt-5">
<a href="mailto:info@perspectabeauty.ca?subject=Order for Pickup" target="_blank" class="btn btn-primary mb-5">Purchase in-store</a><br/>
<a href="https://fusionskin.faire.com/" target="_blank" class="btn btn-primary mb-5">Order Wholesale</a>
<footer style="margin-top:2rem; font-size:0.9rem; color:#666;">
© Fusion Skin™ <br/>
Clean, effective skincare.
</footer>
</div>
<script src="https://cdn.jsdelivr.net/npm/bootstrap@5.3.7/dist/js/bootstrap.bundle.min.js" integrity="sha384-ndDqU0Gzau9qJ1lfW4pNLlhNTkCfHzAVBReH9diLvGRem5+R9g2FzA8ZGN954O5Q" crossorigin="anonymous"></script>
</body>
</html>
Open service 35.157.26.135:80 · www.mandiahasthina.live
2026-01-13 00:39
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:39:51 GMT Location: https://www.mandiahasthina.live/ Server: Netlify X-Nf-Request-Id: 01KETCPXJ5VFQSX2NGVNHYFCE4 Content-Length: 47 Connection: close Redirecting to https://www.mandiahasthina.live/
Open service 35.157.26.135:443 · www.mandiahasthina.live
2026-01-13 00:39
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:39:42 GMT Location: https://mandiahasthina.live/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCPMS0GJ910T0VE5AS2W4V Content-Length: 43 Connection: close Redirecting to https://mandiahasthina.live/
Open service 35.157.26.135:80 · densyte.org
2026-01-13 00:38
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:39:08 GMT Location: https://densyte.org/ Server: Netlify X-Nf-Request-Id: 01KETCNK4GHQGBTK7KCAMPY0NH Content-Length: 35 Connection: close Redirecting to https://densyte.org/
Open service 35.157.26.135:443 · densyte.org
2026-01-13 00:38
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 799
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:39:00 GMT
Etag: "407c770c05c4452b36df11d805aece01-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCNB7GDCEN6B11MV6YPCQD
Connection: close
Page title: DenSyte - Premium Wildlife & Nature Stock Footage
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/png" href="/Blue Business Architecture Design Logo (2).png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<meta name="description" content="DenSyte - A global marketplace for premium wildlife and nature stock footage. Join the first wave of producers and cinematographers." />
<title>DenSyte - Premium Wildlife & Nature Stock Footage</title>
<script type="module" crossorigin src="/assets/index-Bp9IqN89.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CfjjCIsJ.css">
<script async src="https://bolt.new/badge.js?s=aded31be-7f6c-4b4f-9fbf-de5f904548ba"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · justbonkit.lol
2026-01-13 00:38
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1269
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:38:35 GMT
Etag: "d34023d931c0f73cb54adee4e1448a05-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCMKN65ZMVZRPYEV7SY3BB
Connection: close
Page title: Just Bonk It
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/png" href="/justbonkit.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Just Bonk It</title>
<meta name="description" content="Just Bonk It - Simple, Clean, Effective" />
<meta name="theme-color" content="#ffffff" />
<!-- Preload the logo for faster loading -->
<link rel="preload" href="/justbonkit.png" as="image" />
<!-- Open Graph meta tags -->
<meta property="og:title" content="Just Bonk It" />
<meta property="og:description" content="Simple, Clean, Effective" />
<meta property="og:image" content="/justbonkit.png" />
<meta property="og:type" content="website" />
<!-- Twitter Card meta tags -->
<meta name="twitter:card" content="summary" />
<meta name="twitter:title" content="Just Bonk It" />
<meta name="twitter:description" content="Simple, Clean, Effective" />
<meta name="twitter:image" content="/justbonkit.png" />
<script type="module" crossorigin src="/assets/index-CveLgewn.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-D6rLf6f4.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · justbonkit.lol
2026-01-13 00:38
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:38:44 GMT Location: https://justbonkit.lol/ Server: Netlify X-Nf-Request-Id: 01KETCMVMVGKECNEH4Z4KF6DA1 Content-Length: 38 Connection: close Redirecting to https://justbonkit.lol/
Open service 35.157.26.135:80 · swapethereum.com
2026-01-13 00:38
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:38:32 GMT Location: https://swapethereum.com/ Server: Netlify X-Nf-Request-Id: 01KETCMGN0VEXNEGF9HT2ZKBG3 Content-Length: 40 Connection: close Redirecting to https://swapethereum.com/
Open service 35.157.26.135:443 · swapethereum.com
2026-01-13 00:38
HTTP/1.1 200 OK
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 36123
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:38:24 GMT
Etag: "pnb9i5x4tbrvc"
Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data
Server: Netlify
Strict-Transport-Security: max-age=31536000
Vary: Accept-Encoding
X-Content-Type-Options: nosniff
X-Nf-Request-Id: 01KETCM87EANVKBC70A0NMRGTD
X-Powered-By: Next.js
Connection: close
Page title: Swap Ethereum - Quick & Secure ETH-to-Crypto Conversions | SwapEthereum.com | Swap Ethereum
<!DOCTYPE html><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width"/><meta name="twitter:card" content="summary_large_image"/><meta name="twitter:site" content="@swapethereum"/><meta name="twitter:creator" content="@swapethereum"/><meta property="og:locale" content="en_US"/><meta property="og:site_name" content="Swap Ethereum"/><meta name="author" content="Swap Ethereum"/><meta name="robots" content="index, follow"/><meta property="og:locale" content="en_US"/><link rel="icon" href="/favicon.svg"/><title>Swap Ethereum - Quick & Secure ETH-to-Crypto Conversions | SwapEthereum.com | Swap Ethereum</title><meta name="robots" content="index,follow"/><meta name="description" content="Swap Ethereum seamlessly on SwapEthereum.com. Instantly trade ETH for BTC, USDT, and more on GhostSwap. Enjoy secure, low-fee crypto exchanges and grow your DeFi portfolio."/><meta property="og:title" content="Swap Ethereum - Fast & Secure ETH Swaps | SwapEthereum.com"/><meta property="og:description" content="Effortlessly swap Ethereum (ETH) with Bitcoin, USDT, and other top cryptocurrencies. Connect to GhostSwap for fast, secure DeFi trading and low fees."/><meta property="og:url" content="https://swapethereum.com/"/><meta property="og:type" content="website"/><meta property="og:image" content="https://swapethereum.com/og-image.png"/><meta property="og:image:alt" content="Swap Ethereum Platform"/><meta property="og:image:width" content="1200"/><meta property="og:image:height" content="630"/><link rel="canonical" href="https://swapethereum.com"/><meta name="keywords" content="Swap Ethereum, Ethereum Swap, ETH Swap, BTC Swap, ETH to USDT, ETH to BTC, DeFi, GhostSwap, Crypto Exchange"/><meta name="next-head-count" content="24"/><script async="" src="https://www.googletagmanager.com/gtag/js?id=G-LR1V9C8TE5"></script><script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-LR1V9C8TE5');
</script><link rel="icon" type="image/svg+xml" href="/favicon.svg"/><link rel="apple-touch-icon" href="/apple-touch-icon.png"/><link rel="preconnect" href="https://fonts.googleapis.com"/><link rel="preconnect" href="https://fonts.gstatic.com" crossorigin="anonymous"/><link rel="preconnect" href="https://fonts.gstatic.com" crossorigin /><link rel="preload" href="/_next/static/css/a1cd06d935e9b837.css" as="style"/><link rel="stylesheet" href="/_next/static/css/a1cd06d935e9b837.css" data-n-g=""/><noscript data-n-css=""></noscript><script defer="" nomodule="" src="/_next/static/chunks/polyfills-42372ed130431b0a.js"></script><script src="/_next/static/chunks/webpack-ee7e63bc15b31913.js" defer=""></script><script src="/_next/static/chunks/framework-64ad27b21261a9ce.js" defer=""></script><script src="/_next/static/chunks/main-5e450df66d6c1b57.js" defer=""></script><script src="/_next/static/chunks/pages/_app-654b8734c75c670c.js" defer=""></script><script src="/_next/static/chunks/663-0409c334a08aaa30.js" defer=""></script><script src="/_next/static/chunks/66-187f57243d4a51bf.js" defer=""></script><script src="/_next/static/chunks/707-059d444129b8fc18.js" defer=""></script><script src="/_next/static/chunks/pages/index-4623f6e30911990f.js" defer=""></script><script src="/_next/static/8qJUR3sXB1uKU6z1d8Ke7/_buildManifest.js" defer=""></script><script src="/_next/static/8qJUR3sXB1uKU6z1d8Ke7/_ssgManifest.js" defer=""></script><style data-href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700;800&display=swap">@font-face{font-family:'Inter';font-style:normal;font-weight:400;font-display:swap;src:url(https://fonts.gstatic.com/l/font?kit=UcCO3FwrK3iLTeHuS_nVMrMxCp50SjIw2boKoduKmMEVuLyfMZs&skey=c491285d6722e4fa&v=v20) format('woff')}@font-face{font-family:'Inter';font-style:normal;font-weight:500;font-display:swap;src:url(https://fonts.gstatic.com/l/font?kit=UcCO3FwrK3iLTeHuS_nVMrMxCp50SjIw2boKoduKmMEVuI6fMZs&skey=c491285d6722e4fa&v=v20) format('woff')}@font-face{font-
Open service 35.157.26.135:443 · steal.so
2026-01-13 00:38
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=31536000,immutable
Cache-Status: "Netlify Edge"; hit
Content-Length: 9422
Content-Security-Policy: default-src 'self'; script-src 'self' 'unsafe-inline' 'unsafe-eval' https://www.googletagmanager.com https://www.google-analytics.com https://gc.zgo.at; style-src 'self' 'unsafe-inline' https://fonts.googleapis.com; font-src 'self' https://fonts.gstatic.com; img-src 'self' data: https: blob:; connect-src 'self' https://hwkiojwsmypzofrplwgr.supabase.co https://www.google-analytics.com https://stealso.goatcounter.com https://gc.zgo.at; frame-src 'self' https://www.youtube.com https://www.youtube-nocookie.com; frame-ancestors 'none'; base-uri 'self'; form-action 'self';
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:38:10 GMT
Etag: "27e3fffc8c5188ee617918ec0dc1e0b4-ssl"
Permissions-Policy: camera=(), microphone=(), geolocation=(), payment=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETCKTCRVRES2QB19GN730FJ
X-Xss-Protection: 1; mode=block
Connection: close
Page title: STEAL.SO - Professional Content Theft, Automated | AI Social Media Tool
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<!-- Performance: DNS Prefetch & Preconnect -->
<link rel="dns-prefetch" href="https://hwkiojwsmypzofrplwgr.supabase.co" />
<link rel="dns-prefetch" href="https://fonts.googleapis.com" />
<link rel="dns-prefetch" href="https://fonts.gstatic.com" />
<link rel="dns-prefetch" href="https://www.youtube.com" />
<link rel="dns-prefetch" href="https://i.ytimg.com" />
<link rel="preconnect" href="https://hwkiojwsmypzofrplwgr.supabase.co" crossorigin />
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin />
<link rel="preconnect" href="https://www.youtube.com" />
<link rel="preconnect" href="https://www.youtube-nocookie.com" />
<link rel="preconnect" href="https://i.ytimg.com" />
<!-- Performance: Preload Critical Assets -->
<link rel="preload" href="/StealLOGOwithBackground.svg" as="image" type="image/svg+xml" />
<!-- Favicon -->
<link rel="icon" type="image/svg+xml" href="/StealFavIconWithBackground.svg" />
<link rel="apple-touch-icon" href="/S.png" />
<!-- Viewport -->
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- Canonical URL -->
<link rel="canonical" href="https://steal.so/" />
<!-- Hreflang for Multi-Language Support -->
<link rel="alternate" hreflang="en" href="https://steal.so/" />
<link rel="alternate" hreflang="ar" href="https://steal.so/?lang=ar" />
<link rel="alternate" hreflang="x-default" href="https://steal.so/" />
<!-- Primary Meta Tags -->
<title>STEAL.SO - Professional Content Theft, Automated | AI Social Media Tool</title>
<meta name="title" content="STEAL.SO - Professional Content Theft, Automated | AI Social Media Tool" />
<meta name="description" content="Stop pretending. Start stealing. Our AI steals trending content 24/7, rewrites it in your brand voice + any language, and publishes everywhere while you sleep. Join 1,247 content thieves dominating their feeds." />
<!-- Theme Color -->
<meta name="theme-color" content="#9333EA" />
<meta name="theme-color" media="(prefers-color-scheme: dark)" content="#0a0a0a" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://steal.so/" />
<meta property="og:title" content="STEAL.SO - Professional Content Theft, Automated" />
<meta property="og:description" content="Stop pretending. Start stealing. Our AI steals trending content 24/7, rewrites it in your brand voice + any language, and publishes everywhere while you sleep." />
<meta property="og:image" content="https://steal.so/S.png" />
<meta property="og:image:width" content="1200" />
<meta property="og:image:height" content="630" />
<meta property="og:image:type" content="image/png" />
<meta property="og:image:alt" content="STEAL.SO - Professional Content Theft, Automated" />
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image" />
<meta property="twitter:url" content="https://steal.so/" />
<meta property="twitter:title" content="STEAL.SO - Professional Content Theft, Automated" />
<meta property="twitter:description" content="Stop pretending. Start stealing. Our AI steals trending content 24/7, rewrites it in your brand voice + any language, and publishes everywhere while you sleep." />
<meta property="twitter:image" content="https://steal.so/S.png" />
<!-- Additional SEO -->
<meta name="robots" content="index, follow, max-snippet:-1, max-image-preview:large, max-video-preview:-1" />
<meta name="language" content="English" />
<meta name="author" content="STEAL.SO" />
<meta name="copyright" content="Adzwin LLC" />
<meta name="publisher" content="Adzwin LLC" />
<meta name="keywords" content="AI content creation, social media automation, content theft tool, automated posting, multi-platform publishing, brand voice AI, social media management, conte
Open service 35.157.26.135:80 · steal.so
2026-01-13 00:38
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:38:17 GMT Location: https://steal.so/ Server: Netlify X-Nf-Request-Id: 01KETCM1R6JR0FVZ8P67FEHB6F Content-Length: 32 Connection: close Redirecting to https://steal.so/
Open service 35.157.26.135:80 · www.nayeon.site
2026-01-13 00:37
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:37:49 GMT Location: https://www.nayeon.site/ Server: Netlify X-Nf-Request-Id: 01KETCK6BCPXZA3K52QWW3D524 Content-Length: 39 Connection: close Redirecting to https://www.nayeon.site/
Open service 35.157.26.135:443 · www.nayeon.site
2026-01-13 00:37
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:37:40 GMT Location: https://nayeon.site/ Server: Netlify Strict-Transport-Security: max-age=63072000; includeSubDomains; preload X-Nf-Request-Id: 01KETCJX7Z1RT7FQ8EXCB4GZ0P Content-Length: 35 Connection: close Redirecting to https://nayeon.site/
Open service 35.157.26.135:80 · eliasanalytics.com
2026-01-13 00:36
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:36:52 GMT Location: https://eliasanalytics.com/ Server: Netlify X-Nf-Request-Id: 01KETCHEZY83XZZM5VKD6X9P3Q Content-Length: 42 Connection: close Redirecting to https://eliasanalytics.com/
Open service 35.157.26.135:443 · eliasanalytics.com
2026-01-13 00:36
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 3 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 6924 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:36:44 GMT Etag: "a02a08d9840d1f23a2505df6961fe761-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCH6D2FF5DK1FET3RDQ0MG Connection: close Page title: Prologue by HTML5 UP <!DOCTYPE HTML> <!-- Prologue by HTML5 UP html5up.net | @ajlkn Free for personal and commercial use under the CCA 3.0 license (html5up.net/license) --> <html> <head> <title>Prologue by HTML5 UP</title> <meta charset="utf-8" /> <meta name="viewport" content="width=device-width, initial-scale=1, user-scalable=no" /> <link rel="stylesheet" href="assets/css/main.css" /> </head> <body class="is-preload"> <!-- Header --> <div id="header"> <div class="top"> <!-- Logo --> <div id="logo"> <span class="image avatar48"><img src="images/avatar.jpg" alt="" /></span> <h1 id="title">Elias Nunez</h1> <p>Data Analyst</p> </div> <!-- Nav --> <nav id="nav"> <ul> <li><a href="#top" id="top-link"><span class="icon solid fa-home">Intro</span></a></li> <li><a href="#portfolio" id="portfolio-link"><span class="icon solid fa-th">Portfolio</span></a></li> <li><a href="#about" id="about-link"><span class="icon solid fa-user">About Me</span></a></li> <li><a href="#contact" id="contact-link"><span class="icon solid fa-envelope">Contact</span></a></li> </ul> </nav> </div> <div class="bottom"> <!-- Social Icons --> <ul class="icons"> <li><a href="#" class="icon brands fa-twitter"><span class="label">Twitter</span></a></li> <li><a href="#" class="icon brands fa-facebook-f"><span class="label">Facebook</span></a></li> <li><a href="#" class="icon brands fa-github"><span class="label">Github</span></a></li> <li><a href="#" class="icon brands fa-dribbble"><span class="label">Dribbble</span></a></li> <li><a href="#" class="icon solid fa-envelope"><span class="label">Email</span></a></li> </ul> </div> </div> <!-- Main --> <div id="main"> <!-- Intro --> <section id="top" class="one dark cover"> <div class="container"> <header> <h2 class="alt">Hi! I'm <strong>Prologue</strong>, a <a href="http://html5up.net/license">free</a> responsive<br /> site template designed by <a href="http://html5up.net">HTML5 UP</a>.</h2> <p>Ligula scelerisque justo sem accumsan diam quis<br /> vitae natoque dictum sollicitudin elementum.</p> </header> <footer> <a href="#portfolio" class="button scrolly">Magna Aliquam</a> </footer> </div> </section> <!-- Portfolio --> <section id="portfolio" class="two"> <div class="container"> <header> <h2>Portfolio</h2> </header> <p>Vitae natoque dictum etiam semper magnis enim feugiat convallis convallis egestas rhoncus ridiculus in quis risus amet curabitur tempor orci penatibus. Tellus erat mauris ipsum fermentum etiam vivamus eget. Nunc nibh morbi quis fusce hendrerit lacus ridiculus.</p> <div class="row"> <div class="col-4 col-12-mobile"> <article class="item"> <a href="#" class="image fit"><img src="images/pic02.jpg" alt="" /></a> <header> <h3>Ipsum Feugiat</h3> </header> </article> <article class="item"> <a href="#" class="image fit"><img src="images/pic03.jpg" alt="" /></a> <header> <h3>Rhoncus Semper</h3> </header> </article> </div> <div class="col-4 col-12-mobile"> <article class="item"> <a href="#" class="image fit"><img src="images/pic04.jpg" alt="" /></a> <header> <h3>Magna Nullam</h3> </header> </article> <article class="item"> <a href="#" class="image fit"><img src="images/pic05.jpg" alt="" /></a> <header> <h3>Natoque Vitae</h3> </header> </article> </div> <div class="col-4 col-12-mobile"> <article class="item"> <a href="#" class="image fit"><img src="imag
Open service 35.157.26.135:80 · blockchain-sage.com
2026-01-13 00:36
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:36:40 GMT Location: https://blockchain-sage.com/ Server: Netlify X-Nf-Request-Id: 01KETCH2SFNHNJ5SZ1ZZH4EMGA Content-Length: 43 Connection: close Redirecting to https://blockchain-sage.com/
Open service 35.157.26.135:443 · blockchain-sage.com
2026-01-13 00:36
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 7724
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:36:32 GMT
Etag: "9b26556cf6470749f618cf8af9dca76a-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCGTVNW9JHMSMV0D6CWXKD
Connection: close
Page title: Blockchain Sage
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<link rel="icon" type="image/png" href="favicon.png">
<title>Blockchain Sage</title>
<style>
/* === Base Styles & Animations === */
body {
margin: 0;
background: black url('images/pagecover.jpg') center/cover no-repeat fixed;
color: white;
font-family: Arial, sans-serif;
text-align: center;
overflow-x: hidden;
}
/* Animation Setup: Start Invisible */
h1, h2, h3, h4, p, img, section, nav, footer,
.gallery-item, .blue-btn, .whitepaper-btn, .buy-sage-btn-full {
opacity: 0;
transform: translateY(20px);
transition: all 1s ease-in-out;
}
.visible {
opacity: 1 !important;
transform: translateY(0) !important;
}
/* === Frosted Glass Backgrounds === */
p, .main-content h3 {
background: rgba(0, 0, 0, 0.45);
border-radius: 10px;
padding: 12px 20px;
display: inline-block;
line-height: 1.6;
backdrop-filter: blur(6px);
-webkit-backdrop-filter: blur(6px);
box-shadow: 0 0 10px rgba(0, 0, 0, 0.3);
max-width: 80%;
}
/* === Floating Contact Icons === */
.fixed-icons {
position: fixed;
top: 50%;
left: 20px;
transform: translateY(-50%);
display: flex;
flex-direction: column;
gap: 15px;
z-index: 9999;
opacity: 1; /* Keep icons visible */
}
.fixed-icons img {
width: 30px;
height: 30px;
border-radius: 50%;
opacity: 0.6;
transition: all 0.3s ease;
box-shadow: 0 0 8px rgba(255, 255, 255, 0.2);
}
.fixed-icons img:hover {
transform: translateX(8px) scale(1.1);
opacity: 1;
box-shadow: 0 0 15px rgba(173, 216, 230, 0.8);
}
/* === Buttons === */
.cta-container {
margin: 30px auto;
padding: 0 20px;
}
.button-group {
display: flex;
flex-direction: column;
align-items: center;
gap: 15px;
width: 100%;
max-width: 450px;
margin: 20px auto;
}
.whitepaper-btn {
background: black;
color: #00FF00;
border: 2px solid #00FF00;
border-radius: 50px;
padding: 15px 40px;
font-size: 18px;
font-weight: 800;
text-decoration: none;
display: inline-block;
margin-bottom: 15px;
text-transform: uppercase;
transition: all 0.3s ease;
}
.whitepaper-btn:hover {
background: #00FF00;
color: black;
box-shadow: 0 0 15px #00FF00;
}
.blue-btn {
background: #2b67e2;
color: white;
text-decoration: none;
border-radius: 50px;
padding: 12px 30px;
font-weight: 600;
width: 100%;
box-sizing: border-box;
transition: all 0.3s ease;
}
/* Your Requested Style: White BG, Dark Green Text/Outline, Full Margin */
.buy-sage-btn-full {
display: block;
width: 100%;
background-color: #ffffff;
color: #006400;
border: 2px solid #006400;
border-radius: 50px;
padding: 15px 0;
font-size: 18px;
font-weight: 800;
text-align: center;
text-decoration: none;
text-transform: uppercase;
box-sizing: border-box;
transition: all 0.3s ease;
}
.buy-sage-btn-full:hover {
background-color: #006400;
color: #ffffff;
box-shadow: 0 0 20px rgba(0, 100, 0, 0.4);
}
/* === Gallery Layout === */
.gallery-container {
display: flex;
flex-direction: column;
gap: 30px;
align-items: center;
padding: 40px 20px;
max-width: 1000px;
margin: 0 auto;
}
.gallery-item img {
width: 100%;
height: auto;
border-radius: 12px;
box-shadow: 0 10px 30px rgba(0,0,0,0.5);
}
.hero-image {
max-width: 100%;
height: auto;
margin: 20px auto;
}
footer {
padding: 40px;
color: pink;
background: rgba(0,0,0,0.6);
Open service 35.157.26.135:80 · bodyslimisrael.co.il
2026-01-13 00:36
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:36:38 GMT Location: https://bodyslimisrael.co.il/ Server: Netlify X-Nf-Request-Id: 01KETCH0W8AD6VFDNF7E75VDWC Content-Length: 44 Connection: close Redirecting to https://bodyslimisrael.co.il/
Open service 35.157.26.135:443 · bodyslimisrael.co.il
2026-01-13 00:36
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 262865
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:36:30 GMT
Etag: "f1ba2035813286cd4f8e3be7f5f67e42-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCGS6WZZMCGMWW8VDEPQQM
X-Robots-Tag: index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1
Connection: close
Page title: Body Slim Israel - בודי סלים ישראל
<!DOCTYPE html><html dir="rtl" lang="he-IL" class="dark" style="--dir:rtl"><head><meta charset="utf-8">
<meta name="viewport" content="width=device-width, initial-scale=1">
<title>Body Slim Israel - בודי סלים ישראל</title>
<style>@font-face{font-family:Heebo;src:local("Heebo Light"),url(/_fonts/DDGSmU75zslJUCQ3bnWszhLUS7fzi_MsgaQGI3W-Ol4-OFX0WF47pJAReizvZXaS1QiVByF3SiOZLKU96Wr93uA.woff2) format(woff2);font-display:swap;unicode-range:U+0307-0308,U+0590-05FF,U+200C-2010,U+20AA,U+25CC,U+FB1D-FB4F;font-weight:300;font-style:normal}@font-face{font-family:"Heebo Fallback: Arial";src:local("Arial");size-adjust:99.8905%;ascent-override:104.9001%;descent-override:42.136%;line-gap-override:0%}@font-face{font-family:Heebo;src:local("Heebo Light"),url(/_fonts/cUSR37EIItk2Vtkj_auxnUiEFz_sVsb4KTampAJlqdU-KA_30fGXZlZbvOtz0dJDPlMF4kZE90BL0UWPc6A7-TM.woff2) format(woff2);font-display:swap;unicode-range:U+0302-0303,U+0305,U+0307-0308,U+0310,U+0312,U+0315,U+031A,U+0326-0327,U+032C,U+032F-0330,U+0332-0333,U+0338,U+033A,U+0346,U+034D,U+0391-03A1,U+03A3-03A9,U+03B1-03C9,U+03D1,U+03D5-03D6,U+03F0-03F1,U+03F4-03F5,U+2016-2017,U+2034-2038,U+203C,U+2040,U+2043,U+2047,U+2050,U+2057,U+205F,U+2070-2071,U+2074-208E,U+2090-209C,U+20D0-20DC,U+20E1,U+20E5-20EF,U+2100-2112,U+2114-2115,U+2117-2121,U+2123-214F,U+2190,U+2192,U+2194-21AE,U+21B0-21E5,U+21F1-21F2,U+21F4-2211,U+2213-2214,U+2216-22FF,U+2308-230B,U+2310,U+2319,U+231C-2321,U+2336-237A,U+237C,U+2395,U+239B-23B7,U+23D0,U+23DC-23E1,U+2474-2475,U+25AF,U+25B3,U+25B7,U+25BD,U+25C1,U+25CA,U+25CC,U+25FB,U+266D-266F,U+27C0-27FF,U+2900-2AFF,U+2B0E-2B11,U+2B30-2B4C,U+2BFE,U+3030,U+FF5B,U+FF5D,U+1D400-1D7FF,U+1EE00-1EEFF;font-weight:300;font-style:normal}@font-face{font-family:Heebo;src:local("Heebo Light"),url(/_fonts/aCiEseI2ym0gNY-SUZWI7LUjkvlZ8ydfPpB_JtszCCQ-tvQwo4I8rc97J4ylbzQkt_XpgFXv_mXYAByPSOpmNS4.woff2) format(woff2);font-display:swap;unicode-range:U+0001-000C,U+000E-001F,U+007F-009F,U+20DD-20E0,U+20E2-20E4,U+2150-218F,U+2190,U+2192,U+2194-2199,U+21AF,U+21E6-21F0,U+21F3,U+2218-2219,U+2299,U+22C4-22C6,U+2300-243F,U+2440-244A,U+2460-24FF,U+25A0-27BF,U+2800-28FF,U+2921-2922,U+2981,U+29BF,U+29EB,U+2B00-2BFF,U+4DC0-4DFF,U+FFF9-FFFB,U+10140-1018E,U+10190-1019C,U+101A0,U+101D0-101FD,U+102E0-102FB,U+10E60-10E7E,U+1D2C0-1D2D3,U+1D2E0-1D37F,U+1F000-1F0FF,U+1F100-1F1AD,U+1F1E6-1F1FF,U+1F30D-1F30F,U+1F315,U+1F31C,U+1F31E,U+1F320-1F32C,U+1F336,U+1F378,U+1F37D,U+1F382,U+1F393-1F39F,U+1F3A7-1F3A8,U+1F3AC-1F3AF,U+1F3C2,U+1F3C4-1F3C6,U+1F3CA-1F3CE,U+1F3D4-1F3E0,U+1F3ED,U+1F3F1-1F3F3,U+1F3F5-1F3F7,U+1F408,U+1F415,U+1F41F,U+1F426,U+1F43F,U+1F441-1F442,U+1F444,U+1F446-1F449,U+1F44C-1F44E,U+1F453,U+1F46A,U+1F47D,U+1F4A3,U+1F4B0,U+1F4B3,U+1F4B9,U+1F4BB,U+1F4BF,U+1F4C8-1F4CB,U+1F4D6,U+1F4DA,U+1F4DF,U+1F4E3-1F4E6,U+1F4EA-1F4ED,U+1F4F7,U+1F4F9-1F4FB,U+1F4FD-1F4FE,U+1F503,U+1F507-1F50B,U+1F50D,U+1F512-1F513,U+1F53E-1F54A,U+1F54F-1F5FA,U+1F610,U+1F650-1F67F,U+1F687,U+1F68D,U+1F691,U+1F694,U+1F698,U+1F6AD,U+1F6B2,U+1F6B9-1F6BA,U+1F6BC,U+1F6C6-1F6CF,U+1F6D3-1F6D7,U+1F6E0-1F6EA,U+1F6F0-1F6F3,U+1F6F7-1F6FC,U+1F700-1F7FF,U+1F800-1F80B,U+1F810-1F847,U+1F850-1F859,U+1F860-1F887,U+1F890-1F8AD,U+1F8B0-1F8BB,U+1F8C0-1F8C1,U+1F900-1F90B,U+1F93B,U+1F946,U+1F984,U+1F996,U+1F9E9,U+1FA00-1FA6F,U+1FA70-1FA7C,U+1FA80-1FA89,U+1FA8F-1FAC6,U+1FACE-1FADC,U+1FADF-1FAE9,U+1FAF0-1FAF8,U+1FB00-1FBFF;font-weight:300;font-style:normal}@font-face{font-family:Heebo;src:local("Heebo Light"),url(/_fonts/UDWGUJ_y7TY0g_0zvlI1FLs93Vytvzly_3cVFg1EWN4-2uquQGGNnSEkMTTmmJSOCPXtjkjx5m0QIaseujpR8bY.woff2) format(woff2);font-display:swap;unicode-range:U+0100-02BA,U+02BD-02C5,U+02C7-02CC,U+02CE-02D7,U+02DD-02FF,U+0304,U+0308,U+0329,U+1D00-1DBF,U+1E00-1E9F,U+1EF2-1EFF,U+2020,U+20A0-20AB,U+20AD-20C0,U+2113,U+2C60-2C7F,U+A720-A7FF;font-weight:300;font-style:normal}@font-face{font-family:Heebo;src:local("Heebo Light"),url(/_fonts/iRG13KglRBKVRgyNmQIY2D0qAlTXU0O5XZgMv9wa73E-w55g6b_sX79DajIWY9zhqc2CNwyopuFIcx1SCTwTdic.woff2) format(woff2);font-display:swap;unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+0304,U+0308,U+0329,U+2000
Open service 35.157.26.135:80 · maciekpalmowski.dev
2026-01-13 00:36
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:36:38 GMT Location: https://maciekpalmowski.dev/ Server: Netlify X-Nf-Request-Id: 01KETCH1BF2JWBHQCTZE74ZNK3 Content-Length: 43 Connection: close Redirecting to https://maciekpalmowski.dev/
Open service 35.157.26.135:443 · maciekpalmowski.dev
2026-01-13 00:36
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 91010
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:36:29 GMT
Etag: "2789ede396c2367fd9394b830fb0c3aa-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCGRDVV9YP6DYKHS5TTKN3
Connection: close
Page title: Home | maciek palmowski
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="apple-touch-icon" sizes="180x180" href="/assets/fav/apple-touch-icon.png">
<link rel="icon" type="image/png" sizes="32x32" href="/assets/fav/favicon-32x32.png">
<link rel="icon" type="image/png" sizes="16x16" href="/assets/fav/favicon-16x16.png">
<link rel="manifest" href="/assets/fav/site.webmanifest">
<link rel="mask-icon" href="/assets/fav/safari-pinned-tab.svg" color="#18181b">
<meta name="msapplication-TileColor" content="#18181b">
<meta name="theme-color" content="#18181b">
<link rel="preload" href="https://maciekpalmowski.dev/build/assets/unbounded-v7-latin-regular.9ad59444.woff2" as="font" type="font/woff2" crossorigin>
<link rel="preload" href="https://maciekpalmowski.dev/build/assets/unbounded-v7-latin-700.d1df3113.woff2" as="font" type="font/woff2" crossorigin>
<link rel="preload" href="https://maciekpalmowski.dev/build/assets/montserrat-v26-latin-ext-regular.aece0b51.woff2" as="font" type="font/woff2" crossorigin>
<link rel="preload" href="https://maciekpalmowski.dev/build/assets/montserrat-v26-latin-ext-italic.2ad967cd.woff2" as="font" type="font/woff2" crossorigin>
<link rel="preload" href="https://maciekpalmowski.dev/build/assets/montserrat-v26-latin-ext-700.bb5a456a.woff2" as="font" type="font/woff2" crossorigin>
<link rel="alternate" type="application/atom+xml" title="Maciek Palmowski blog" href="/feed/atom" />
<link rel="alternate" type="application/rss+xml" title="Maciek Palmowski blog" href="/feed" />
<title>Home | maciek palmowski</title>
<meta name="description"
content="My small little blog about WordPress, CI/CD, and Technology" />
<meta property="og:title" content="Home | maciek palmowski" />
<meta property="og:description"
content="My small little blog about WordPress, CI/CD, and Technology" />
<meta property="og:image" content="https://maciekpalmowski.dev/img/containers/assets/page-cover-%281%29.png/ac505d4cb54179b022c06ef49c6e0519/page-cover-%281%29.png">
<meta name="twitter:card" content="summary_large_image">
<meta name="twitter:creator" content="@palmiak_fp">
<meta name="twitter:title" content="Home | maciek palmowski">
<meta name="twitter:description"
content="My small little blog about WordPress, CI/CD, and Technology">
<link rel="preload" as="style" href="https://maciekpalmowski.dev/build/assets/web.05ed2dcb.css" /><link rel="modulepreload" href="https://maciekpalmowski.dev/build/assets/web.5ab976dc.js" /><link rel="stylesheet" href="https://maciekpalmowski.dev/build/assets/web.05ed2dcb.css" /><script type="module" src="https://maciekpalmowski.dev/build/assets/web.5ab976dc.js"></script>
<meta name="view-transition" content="same-origin" />
<script data-goatcounter="https://palmiak.goatcounter.com/count" async src="https://gc.zgo.at/count.js"></script>
</head>
<body class="bg-palmiak_bg font-palmiak-font leading-normal text-zinc-300 grid grid-cols-1 gap-10 pt-[180px] max-[660px]:pt-[104px]">
<header class="fixed z-40 top-0 left-0 w-full bg-palmiak_bg/80 backdrop-blur-[10px]">
<div class="flex items-center mx-auto max-w-6xl px-5 py-2 md:py-4">
<div class="flex-1">
<a href="/" class="block" aria-label="Return to the homepage">
<svg xmlns="http://www.w3.org/2000/svg" width="177" height="39" viewBox="0 0 177 39" fill="none"><path fill-rule="evenodd" clip-rule="evenodd" d="M45.832 17.17L23.0501 27.8999V21.9502L37.7973 15.1359C38.4415 14.8308 39.1026 14.5766 39.7806 14.3731C40.4586 14.1697 40.9841 14.0341 41.357 13.9663C40.9841 13.8985 40.4756 13.7629 39.8314 13.5595C39.1534 13.3222 38.4754 13.051 37.7973 12.7459L23.0501 5.93161V0.0835571L45.832 10.8135V17.17ZM0 28.1866L22.782 38.9165V32.9667L8.03471 26.1525C7.39058 25.8473 6.7295 25.5931 6.05146 25.3897C5.37343 25.1863 4.84795 25.0507 4.47503 24.98
Open service 35.157.26.135:443 · uzs.info
2026-01-13 00:36
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 83146
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:36:26 GMT
Etag: "99c02421340d9507aac1a9e0ae238157-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCGMW2B0GJ7AN268DM6DTH
Connection: close
Page title: Разыскиваемые лица
<!DOCTYPE html>
<html prefix="og: http://ogp.me/ns#" class="boxed " lang="ru">
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "WebSite",
"name": "llbb",
"alternateName": ["llbb", "libb"],
"url": "https://uzs.info"
}
</script>
<head>
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "WebSite",
"name": "llbb",
"alternateName": ["llbb", "libb"],
"url": "https://uzs.info"
}
</script>
<meta charset="utf-8"/>
<meta http-equiv="X-UA-Compatible" content="IE=edge"/>
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no"/>
<meta name="format-detection" content="telephone=no"/>
<link rel="shortcut icon" href="images/favicon.png"/>
<title>Разыскиваемые лица</title>
<meta name="keywords" content=""/>
<meta name="description" content=""/>
<meta property="og:description" content="Тошкент шаҳар Ички ишлар бош бошқармаси, Главное управление внутренних дел города Ташкента, Toshkent shahar Ichki ishlar bosh boshqarmasi "/>
<meta property="og:title" content="Главное Управление Внутренних Дел Города Ташкента"/>
<meta property="og:url" content="/var/www/vhosts/iibb.uz/httpdocs"/>
<meta property="og:type" content="website"/>
<meta property='og:image' content='https://iibb.uz/assets/public/images/iibb_logo.png' />
<meta property="og:image:width" content="200"/>
<meta property="og:image:height" content="200"/>
<meta name="robots" content="index, follow"/>
<script>
site_url = 'https://iibb.uz/ru/';
base_url = '/var/www/vhosts/iibb.uz/httpdocs';
resource = 'https://iibb.uz/assets/public/';
mobile_menu = 'Меню';
lang = 'ru';
sel = 'wanted';
</script>
<link rel="stylesheet" href="fonts/MuseoSansCyrl/fonts.css">
<link rel="stylesheet" href="fonts/icomoon/style.css">
<link rel="stylesheet" href="bootstrap/css/bootstrap.min.css">
<link rel="stylesheet" href="css/owl.carousel.min.css">
<link rel="stylesheet" href="css/owl.theme.default.min.css">
<link rel="stylesheet" type="text/css" href="js/slider-pro/dist/css/slider-pro.min.css"
media="screen"/>
<link rel="stylesheet" href="fonts/font-awesome/css/font-awesome.css">
<link rel="stylesheet" href="css/animate.css">
<link rel="stylesheet" href="js/magnific-popup/magnific-popup.css@v=0.1.css"/>
<link rel="stylesheet" href="pikaday/pikaday.css"/>
<link rel="stylesheet" href="menu/jquery.mmenu.css@v=1767514513.css" media="screen"/>
<link rel="stylesheet" href="menu/sm.css@v=1767514513.css" media="screen" type="text/css"/>
<link rel="stylesheet" href="menu/jquery.smartmenus.bootstrap.css" type="text/css">
<link rel="stylesheet" href="css/z-layer.css@v=1767514513.css">
<link rel="stylesheet" href="css/main.css@v=1767514513.css">
<link rel="stylesheet" href="css/media.css@v=1767514513.css">
<link rel='stylesheet' href='fancybox-master/dist/jquery.fancybox.min.css'
type='text/css'/>
<link rel="stylesheet" href="stacktable/stacktable.css@v=0.2.css"/>
<script src="js/jquery.js"></script>
<link rel="stylesheet" type="text/css" href="speaker/speaker.css@v=0.2.css"/>
<script type="text/javascript"
src="js/slider-pro/dist/js/jquery.sliderPro.min.js"></script>
<link href="js/spec/special_view.css@ver=1767514513.css" rel="stylesheet"/>
<link href="js/spec/site.min.css" rel="stylesheet"/>
<script src="js/printThis.js"></script>
<script src="js/recaptcha.js"></script>
</head>
<body class="">
<div class="wrapper ">
<header>
<header class="header2">
<div class="header-top">
<div class="container">
<div class="header-top_left">
<ul>
Open service 35.157.26.135:80 · uzs.info
2026-01-13 00:36
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:36:34 GMT Location: https://uzs.info/ Server: Netlify X-Nf-Request-Id: 01KETCGWV3MSDFZCSHX8Y0KWYB Content-Length: 32 Connection: close Redirecting to https://uzs.info/
Open service 35.157.26.135:443 · nodefleet.org
2026-01-13 00:36
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 4358 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 1016 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:36:20 GMT Etag: "6805c8cfe8802c9d0954fbc6a91287b7-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCGFFPQVT9TNPQ4VCRWNJY Connection: close Page title: Nodefleet <!doctype html><html lang="en"><head><meta charset="utf-8"/><link rel="icon" href="/icon.svg"/><meta name="viewport" content="width=device-width,initial-scale=1"/><link rel="preconnect" href="https://fonts.gstatic.com"/><link href="https://fonts.googleapis.com/css2?family=Open+Sans:wght@400;600;700&display=swap" rel="stylesheet"/><link rel="stylesheet" href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/6.5.1/css/all.min.css" integrity="sha512-DTOQO9RWCH3ppGqcWaEA1BIZOC6xxalwEsw9c2QQeAIftl+Vegovlnee1c9QX4TctnWMn13TZye+giMm8e2LwA==" crossorigin="anonymous" referrerpolicy="no-referrer"/><meta name="theme-color" content="#000000"/><meta name="description" content="Blockchain development & infrastructure done well"/><link rel="apple-touch-icon" href="/icon.svg"/><link rel="manifest" href="/manifest.json"/><title>Nodefleet</title><script defer="defer" src="/static/js/main.cb20c854.js"></script><link href="/static/css/main.64d6b7ee.css" rel="stylesheet"></head><body><div id="root"></div></body></html>
Open service 35.157.26.135:80 · nodefleet.org
2026-01-13 00:36
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:36:27 GMT Location: https://nodefleet.org/ Server: Netlify X-Nf-Request-Id: 01KETCGPB7305YCANV3PWJ02B7 Content-Length: 37 Connection: close Redirecting to https://nodefleet.org/
Open service 35.157.26.135:80 · anonella.xyz
2026-01-13 00:35
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:35:53 GMT Location: https://anonella.xyz/ Server: Netlify X-Nf-Request-Id: 01KETCFN1DQXTB2903VR3X414P Content-Length: 36 Connection: close Redirecting to https://anonella.xyz/
Open service 35.157.26.135:443 · anonella.xyz
2026-01-13 00:35
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 4
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 51752
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:35:47 GMT
Etag: "f39e8ace67fc004e32dccf9b0bbdf41f-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCFF0W3CH356CEN92Y4DC1
Connection: close
Page title: ELLA
<!DOCTYPE html>
<html data-wf-page="6440775b98cac15cb3cd2c0a" data-wf-site="66532ba09b25da8de84847cf" lang="en">
<head>
<meta charset="utf-8" />
<title>ELLA</title>
<meta content="width=device-width, initial-scale=1" name="viewport" />
<meta content="rj2ZPjnE4zl2gtC6S_YilwWS4ibK-huD-VvB7WTP7qI" name="google-site-verification" />
<link href="https://fonts.googleapis.com" rel="preconnect" />
<link href="https://fonts.gstatic.com" rel="preconnect" crossorigin="anonymous" />
<script src="https://ajax.googleapis.com/ajax/libs/webfont/1.6.26/webfont.js" type="text/javascript"></script>
<link href="index.css" rel="stylesheet" type="text/css" />
<link href="main.css" rel="stylesheet" type="text/css" />
<link rel="icon" href="public/fav.ico" type="image/x-icon" />
<link rel="icon" type="image/png" sizes="48x48" href="public/fav48.png">
<meta property="og:title" content="$ELLA">
<meta property="og:site_name" content="$ELLA">
<link rel="apple-touch-icon" href="public/appleicon.png" />
<script type="text/javascript">
WebFont.load({
google: {
families: ["Inconsolata:400,700", "Overpass Mono:regular", "VT323:regular"]
}
});
</script>
<script type="text/javascript">
!function (o, c) {
var n = c.documentElement
, t = " w-mod-";
n.className += t + "js",
("ontouchstart" in o || o.DocumentTouch && c instanceof DocumentTouch) && (n.className += t + "touch")
}(window, document);
</script>
</head>
<body class="body">
<div class="page-wrapper">
<div data-w-id="d899472f-84ad-fa54-9fb3-94fcff8b29ca" style="display: block" class="main-page">
<div class="app nav mobile_for">
<div style="display:block" class="shut-down">
<div style="-webkit-transform:translate3d(null, 39%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0);-moz-transform:translate3d(null, 39%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0);-ms-transform:translate3d(null, 39%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0);transform:translate3d(null, 39%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0)"
class="bottom-black"></div>
<div class="side-black-left"></div>
<div class="side-black-right"></div>
<div style="-webkit-transform:translate3d(0, 0%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0);-moz-transform:translate3d(0, 0%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0);-ms-transform:translate3d(0, 0%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0);transform:translate3d(0, 0%, 0) scale3d(1, 1, 1) rotateX(0) rotateY(0) rotateZ(0) skew(0, 0)"
class="top-black"></div>
</div>
<div data-w-id="aeb5d509-3fdb-6d0a-acc9-3de8071b906d" class="desktop-wrapper viewfix">
<div class="desktop-icons-wrapper">
<a class='desktop-icon-wrapper is-whitepaper-icon w-inline-block' data-w-id='d6f80373-a9df-788c-3356-ec5d768a07e7' href='/#'>
<img src="images/portfolio.png" loading="lazy" alt="" class="desktop-icons" />
<h2 class="icons-heading">ABOUT US</h2>
</a>
<a class='desktop-icon-wrapper is-buy-icon w-inline-block' data-w-id='d12fffc6-dc31-7054-ba60-2a0f75efcbe0' href='/#'>
<img src="images/buy.png" loading="lazy" alt="" class="desktop-icons" />
<h2 class="icons-heading">BUY</h2>
</a>
<a class='desktop-icon-wrapper is-contact-icon w-inline-block' data-w-id='9d63a54c-c494-a257-75e9-dbf5be9cd70f' href='/#'>
<img src="images/envelope.png" loading="lazy" alt="" class="desktop-icons" />
<h2
Open service 35.157.26.135:443 · chillioilclub.com
2026-01-13 00:35
HTTP/1.1 307 Temporary Redirect
Age: 4097178
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 5549
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:35:32 GMT
Etag: "d2x6h9xcnz4a5"
Location: /surveys
Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Nextjs-Date: Sat, 27 Dec 2025 02:10:56 GMT
X-Nextjs-Prerender: 1, 1
X-Nextjs-Stale-Time: 300
X-Nf-Request-Id: 01KETCF0S6CBKK81AB8CHAT7B5
X-Powered-By: Next.js
Connection: close
Page title: Chilli Oil Club
<!DOCTYPE html><!--kkNxIS_8VReFiieqi3nWl--><html id="__next_error__"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/aa1e71c87c00a19b.js"/><script src="/_next/static/chunks/52741de5ec95b9a7.js" async=""></script><script src="/_next/static/chunks/5e5b5fb1a028c55c.js" async=""></script><script src="/_next/static/chunks/turbopack-ace456f22462056a.js" async=""></script><script src="/_next/static/chunks/ff1a16fafef87110.js" async=""></script><script src="/_next/static/chunks/247eb132b7f7b574.js" async=""></script><title>Chilli Oil Club</title><link rel="icon" href="/favicon.ico?favicon.d860631d.ico" sizes="32x31" type="image/x-icon"/><script src="/_next/static/chunks/a6dad97d9634a72d.js" noModule=""></script></head><body><div hidden=""><!--$--><!--/$--></div><script src="/_next/static/chunks/aa1e71c87c00a19b.js" id="_R_" async=""></script><script>(self.__next_f=self.__next_f||[]).push([0])</script><script>self.__next_f.push([1,"1:\"$Sreact.fragment\"\n2:I[39756,[\"/_next/static/chunks/ff1a16fafef87110.js\",\"/_next/static/chunks/247eb132b7f7b574.js\"],\"default\"]\n3:I[37457,[\"/_next/static/chunks/ff1a16fafef87110.js\",\"/_next/static/chunks/247eb132b7f7b574.js\"],\"default\"]\n5:I[97367,[\"/_next/static/chunks/ff1a16fafef87110.js\",\"/_next/static/chunks/247eb132b7f7b574.js\"],\"OutletBoundary\"]\n6:\"$Sreact.suspense\"\n8:I[97367,[\"/_next/static/chunks/ff1a16fafef87110.js\",\"/_next/static/chunks/247eb132b7f7b574.js\"],\"ViewportBoundary\"]\na:I[97367,[\"/_next/static/chunks/ff1a16fafef87110.js\",\"/_next/static/chunks/247eb132b7f7b574.js\"],\"MetadataBoundary\"]\nc:I[68027,[],\"default\"]\n:HL[\"/_next/static/chunks/49a526beb994457b.css\",\"style\"]\n:HL[\"/_next/static/media/797e433ab948586e-s.p.dbea232f.woff2\",\"font\",{\"crossOrigin\":\"\",\"type\":\"font/woff2\"}]\n:HL[\"/_next/static/media/caa3a2e1cccd8315-s.p.853070df.woff2\",\"font\",{\"crossOrigin\":\"\",\"type\":\"font/woff2\"}]\n"])</script><script>self.__next_f.push([1,"0:{\"P\":null,\"b\":\"kkNxIS_8VReFiieqi3nWl\",\"c\":[\"\",\"\"],\"q\":\"\",\"i\":false,\"f\":[[[\"\",{\"children\":[\"__PAGE__\",{}]},\"$undefined\",\"$undefined\",true],[[\"$\",\"$1\",\"c\",{\"children\":[[[\"$\",\"link\",\"0\",{\"rel\":\"stylesheet\",\"href\":\"/_next/static/chunks/49a526beb994457b.css\",\"precedence\":\"next\",\"crossOrigin\":\"$undefined\",\"nonce\":\"$undefined\"}]],[\"$\",\"html\",null,{\"lang\":\"en\",\"children\":[\"$\",\"body\",null,{\"className\":\"geist_2ae47f08-module__h69qWW__variable geist_mono_eb58308d-module__w_p2Lq__variable antialiased\",\"children\":[\"$\",\"$L2\",null,{\"parallelRouterKey\":\"children\",\"error\":\"$undefined\",\"errorStyles\":\"$undefined\",\"errorScripts\":\"$undefined\",\"template\":[\"$\",\"$L3\",null,{}],\"templateStyles\":\"$undefined\",\"templateScripts\":\"$undefined\",\"notFound\":[[[\"$\",\"title\",null,{\"children\":\"404: This page could not be found.\"}],[\"$\",\"div\",null,{\"style\":{\"fontFamily\":\"system-ui,\\\"Segoe UI\\\",Roboto,Helvetica,Arial,sans-serif,\\\"Apple Color Emoji\\\",\\\"Segoe UI Emoji\\\"\",\"height\":\"100vh\",\"textAlign\":\"center\",\"display\":\"flex\",\"flexDirection\":\"column\",\"alignItems\":\"center\",\"justifyContent\":\"center\"},\"children\":[\"$\",\"div\",null,{\"children\":[[\"$\",\"style\",null,{\"dangerouslySetInnerHTML\":{\"__html\":\"body{color:#000;background:#fff;margin:0}.next-error-h1{border-right:1px solid rgba(0,0,0,.3)}@media (prefers-color-scheme:dark){body{color:#fff;background:#000}.next-error-h1{border-right:1px solid rgba(255,255,255,.3)}}\"}}],[\"$\",\"h1\",null,{\"className\":\"next-error-h1\",\"style\":{\"display\":\"inline-block\",\"margin\":\"0 20px 0 0\",\"padding\":\"0 23px 0 0\",\"fontSize\":24,\"fontWeight\":500,\"verticalAlign\":\"top\",\"lineHeight\":\"49px\"},\"children\":404}],[\"$\",\"div\",null,{\"style\":{\"display\":\"inline-block\"},\"children\":[\"$\",\"h2\",null,{\"style\":{\"fontSize\":14,\"fontWeight\":400,\"lineHeight\":\"49px\
Open service 35.157.26.135:80 · www.chillioilclub.com
2026-01-13 00:35
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:35:41 GMT Location: https://www.chillioilclub.com/ Server: Netlify X-Nf-Request-Id: 01KETCF9HKNMFYT5H12KYXV6BM Content-Length: 45 Connection: close Redirecting to https://www.chillioilclub.com/
Open service 35.157.26.135:443 · www.chillioilclub.com
2026-01-13 00:35
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:35:32 GMT Location: https://chillioilclub.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCF0FJQ4HR609KNKBYYARA Content-Length: 41 Connection: close Redirecting to https://chillioilclub.com/
Open service 35.157.26.135:80 · chillioilclub.com
2026-01-13 00:35
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:35:39 GMT Location: https://chillioilclub.com/ Server: Netlify X-Nf-Request-Id: 01KETCF7R17V0387XCQ7T6X0EC Content-Length: 41 Connection: close Redirecting to https://chillioilclub.com/
Open service 35.157.26.135:443 · thecivicprism.org
2026-01-13 00:34
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 6744
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:35:01 GMT
Etag: "5ce056c6af03ae562b8d5c9241803e97-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCE27KW3QESKZRXJX0QTCQ
Connection: close
Page title: The Civic Prism: Upstream Structures in an Age of Fracture
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width,initial-scale=1.0" />
<title>The Civic Prism: Upstream Structures in an Age of Fracture</title>
<!-- ☍ Civic Prism Metadata -->
<meta name="reply-to" content="contact@thecivicprism.org">
<meta name="theme-color" content="#020611">
<meta name="description" content="The Civic Prism: Upstream Structures in an Age of Fracture — a reflective nonfiction project exploring perception, structure, and civic imagination.">
<meta property="og:title" content="The Civic Prism — Upstream Structures in an Age of Fracture">
<meta property="og:description" content="A reflective framework for seeing upstream structures in a fractured age.">
<meta property="og:image" content="https://thecivicprism.org/assets/img/cover6.png">
<meta property="og:type" content="website">
<meta property="og:url" content="https://thecivicprism.org">
<meta name="twitter:card" content="summary_large_image">
<meta name="twitter:title" content="The Civic Prism — Upstream Structures in an Age of Fracture">
<meta name="twitter:description" content="A reflective nonfiction project by Clayton Maki.">
<meta name="twitter:image" content="/assets/img/cover6.png">
<!-- Meta for share cards -->
<meta name="description" content="A reflective framework for understanding how perception, structure, and coherence shape the modern world. Not about sides—about systems.">
<meta property="og:title" content="The Civic Prism: Upstream Structures in an Age of Fracture" />
<meta property="og:description" content="Not about sides or saviors—about perception and coherence in a fractured world." />
<meta property="og:type" content="website" />
<meta property="og:site_name" content="The Civic Prism" />
<meta name="theme-color" content="#020611" />
<!-- Favicon -->
<link rel="icon" type="image/svg+xml" href="/assets/icons/civicprism-sigil.svg">
<link rel="stylesheet" href="/assets/css/civicprism.css">
</head>
<body class="cp-body">
<header class="cp-nav">
<div class="cp-nav-left">
<div class="cp-nav-title">THE CIVIC PRISM</div>
<div class="cp-nav-mark">Reflection latency · Governance · Media tempo</div>
</div>
<nav class="cp-nav-links">
<a class="cp-nav-link" href="/">Home</a>
<a class='cp-nav-link' href='/press/about/about'>About</a>
<a class='cp-nav-link' href='/press/reflections/'>Reflections</a>
<a class='cp-nav-link' href='/press/kit/press-kit'>Press</a>
<a class='cp-nav-link' href='/rgi/rgi'>RGI</a>
<a class="cp-nav-link" href="mailto:press@thecivicprism.org">Contact</a>
</nav>
<button id="theme-toggle" class="cp-theme-toggle" aria-label="Toggle color mode">
Dark Mode
</button>
</header>
<!-- Main content -->
<main class="cp-shell fade-in" style="animation-delay:.15s;" layer="1">
<!-- Short intro -->
<section class="cp-panel fade-in">
<h3 class="cp-section-title">Upstream Structures in an Age of Fracture</h3>
<p class="cp-lede">
The Civic Prism began as a question: what happens when a democracy forgets how to see itself?
<br><br>
This isn’t about sides or saviors — it’s about the machinery of perception itself.
<br>
The beam, the prism, the mirror, the lens — every part of how we bend light into meaning.
<br><br>
The goal isn’t agreement. It’s clarity without humiliation.
</p>
</section>
<!-- RGI Teaser Module -->
<section class="cp-panel fade-in">
<h3 class="cp-section-title">Reflective Governance Institute</h3>
<p>
Turning transparency into a science.
The <strong>Reflective Governance Institute (RGI)</strong> is a Civic Prism initiative
that transforms accountability from a promise into a measurable process —
one that anyone, anywhere, can verify.
</p>
<div class="cp-cta-row">
<a class='cp-cta-btn' href='/rgi/rgi'>Explore the Framework →</a>
</div>
</section>
<!-- Call-to-action block -->
<div class="cp-cta-row">
<a class='cp-cta-btn' href='/press/about/abo
Open service 35.157.26.135:80 · thecivicprism.org
2026-01-13 00:34
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:35:08 GMT Location: https://thecivicprism.org/ Server: Netlify X-Nf-Request-Id: 01KETCE9D0R6498MT5RY914TDV Content-Length: 41 Connection: close Redirecting to https://thecivicprism.org/
Open service 35.157.26.135:80 · ichingnext.com
2026-01-13 00:34
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:34:45 GMT Location: https://ichingnext.com/ Server: Netlify X-Nf-Request-Id: 01KETCDJYW2Q74WDE1KP8A8P1B Content-Length: 38 Connection: close Redirecting to https://ichingnext.com/
Open service 35.157.26.135:443 · ichingnext.com
2026-01-13 00:34
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 685
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:34:38 GMT
Etag: "81145f1a45cd0b193810b73cd6d794ff-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCDBNJXZ6CAVCXKWKNDNKY
Connection: close
Page title: I Ching Wisdom - Ancient Guidance for Modern Life
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>I Ching Wisdom - Ancient Guidance for Modern Life</title>
<meta name="description" content="Transform your life with I Ching consultations and life coaching. Expert readings, personalized guidance, and ancient wisdom for modern challenges." />
<script type="module" crossorigin src="/assets/index-BfrwYBLR.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DAnw6NIq.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · meowcoffee.com.tw
2026-01-13 00:34
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:34:46 GMT Location: https://meowcoffee.com.tw/ Server: Netlify X-Nf-Request-Id: 01KETCDKMCZZ5FPF7XV1DCK42D Content-Length: 41 Connection: close Redirecting to https://meowcoffee.com.tw/
Open service 35.157.26.135:443 · meowcoffee.com.tw
2026-01-13 00:34
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 18688
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:34:37 GMT
Etag: "edefd3b3a18416b4eb1fbff61e68ddca-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCDB8PVNH60N1730TB6H7C
Connection: close
Page title: 喵豆商行
<!DOCTYPE html><html dir="ltr" lang="en" class="false" data-astro-cid-sckkx6r4> <head><meta charset="UTF-8"><meta name="viewport" content="width=device-width"><link rel="icon" type="image/svg+xml" href="/favicon.svg"><link rel="canonical" href="https://meowcoffee.com.tw/"><meta name="generator" content="Astro v5.12.0"><!-- General Meta Tags --><title>喵豆商行</title><meta name="title" content="喵豆商行"><meta name="description" content="自家烘焙咖啡豆"><meta name="author" content="Chih-Ping Kuo"><link rel="sitemap" href="/sitemap-index.xml"><!-- Open Graph / Facebook --><meta property="og:title" content="喵豆商行"><meta property="og:description" content="自家烘焙咖啡豆"><meta property="og:url" content="https://meowcoffee.com.tw/"><meta property="og:image" content="https://meowcoffee.com.tw/astropaper-og.jpg"><!-- Article Published/Modified time --><!-- Twitter --><meta property="twitter:card" content="summary_large_image"><meta property="twitter:url" content="https://meowcoffee.com.tw/"><meta property="twitter:title" content="喵豆商行"><meta property="twitter:description" content="自家烘焙咖啡豆"><meta property="twitter:image" content="https://meowcoffee.com.tw/astropaper-og.jpg"><!-- Google JSON-LD Structured data --><script type="application/ld+json">{"@context":"https://schema.org","@type":"BlogPosting","headline":"喵豆商行","image":"https://meowcoffee.com.tw/astropaper-og.jpg","datePublished":"undefined","author":[{"@type":"Person","name":"Chih-Ping Kuo","url":"https://meowcoffee.com.tw/"}]}</script><!-- Enable RSS feed auto-discovery --><!-- https://docs.astro.build/en/recipes/rss/#enabling-rss-feed-auto-discovery --><link rel="alternate" type="application/rss+xml" title="喵豆商行" href="https://meowcoffee.com.tw/rss.xml"><meta name="theme-color" content=""><meta name="astro-view-transitions-enabled" content="true"><meta name="astro-view-transitions-fallback" content="animate"><script type="module" src="/_astro/ClientRouter.astro_astro_type_script_index_0_lang.D98dxaWf.js"></script><script src="/toggle-theme.js"></script><link rel="stylesheet" href="/_astro/about.opA1CgdX.css">
<style>:where([data-astro-image]){object-fit:var(--fit);object-position:var(--pos);height:auto}:where([data-astro-image=full-width]){width:100%}:where([data-astro-image=constrained]){max-width:100%}
</style></head> <body data-astro-cid-sckkx6r4> <header> <a id="skip-to-content" href="#main-content" class="absolute start-16 -top-full z-50 bg-background px-3 py-2 text-accent backdrop-blur-lg transition-all focus:top-4">
Skip to content
</a> <div id="nav-container" class="mx-auto flex max-w-app flex-col items-center justify-between sm:flex-row"> <div id="top-nav-wrap" class="relative flex w-full items-baseline justify-between bg-background p-4 sm:items-center sm:py-6"> <a href="/" class="absolute py-1 text-xl leading-8 font-semibold whitespace-nowrap sm:static sm:my-auto sm:text-2xl sm:leading-none"> 喵豆商行 </a> <nav id="nav-menu" class="flex w-full flex-col items-center sm:ms-2 sm:flex-row sm:justify-end sm:space-x-4 sm:py-0"> <button id="menu-btn" class="focus-outline self-end p-2 sm:hidden" aria-label="Open Menu" aria-expanded="false" aria-controls="menu-items"> <svg width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="hidden" id="close-icon"><path stroke="none" d="M0 0h24v24H0z" fill="none" /><path d="M18 6l-12 12" /><path d="M6 6l12 12" /></svg> <svg width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="icon icon-tabler icons-tabler-outline icon-tabler-menu-deep" id="menu-icon"><path stroke="none" d="M0 0h24v24H0z" fill="none" /><path d="M4 6h16" /><path d="M7 12h13" /><path d="M10 18h10" /></svg> </button> <ul id="menu-items" class="mt-4 grid w-44 grid-cols-2 place-content-center gap-2 [&>li>a]:block [&>li>a]:px-4 [&>li>a]:py-3 [&>li>a]:text-center [&>li>a]:font-medium [&>li>a]:
Open service 35.157.26.135:443 · godsyouthmovment.org
2026-01-13 00:33
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 9523
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:34:02 GMT
Etag: "3732e3449bb8ad01466c9395c0ff1a9e-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCC8FM5TPJ4H7GB5Z603FD
Connection: close
Page title: God’s Youth — You’re Not Too Young
<!DOCTYPE html>
<html lang="en">
<head>
<title>God’s Youth — You’re Not Too Young</title>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<link rel="icon" href="images/gods-youth-logo.png" />
<script src="https://cdn.tailwindcss.com"></script>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700;800&family=Poppins:wght@600;700;800&display=swap" rel="stylesheet">
<style>
:root{--bg:#ffffff;--bg2:#fef9f5;--ink:#111;--muted:#444;--line:rgba(200,200,200,.4);--primary:#b71c1c;--accent:#ffb300}
.gradient-bg{background:linear-gradient(90deg,#b71c1c,#ffb300,#000000)}
.gradient-text{background:linear-gradient(90deg,#b71c1c,#ffb300,#000000);-webkit-background-clip:text;-webkit-text-fill-color:transparent}
html{scroll-behavior:smooth}
.btn-glow{box-shadow:0 10px 30px rgba(183,28,28,.25)}
.card{transition:transform .25s ease, box-shadow .25s ease}
.card:hover{transform:translateY(-4px); box-shadow:0 12px 30px rgba(0,0,0,.08)}
.shine{position:relative;overflow:hidden}
.shine:before{content:'';position:absolute;inset:-150% -150%;background:linear-gradient(120deg,transparent,rgba(255,255,255,.25),transparent);transform:rotate(15deg);animation:shine 6s linear infinite}
@keyframes shine{0%{transform:translateX(-60%) rotate(15deg)}100%{transform:translateX(60%) rotate(15deg)}}
.headline-underline:after{content:'';display:block;width:80px;height:4px;background:linear-gradient(90deg,#ffb300,#b71c1c,#000);margin:.6rem auto 0;border-radius:9999px}
</style>
</head>
<body class="bg-[var(--bg)] text-[var(--ink)]">
<div class="w-full text-center text-sm text-white py-2 gradient-bg">🔥 God’s Youth · <strong>You’re not too young to be used by God</strong></div>
<header class="sticky top-0 z-50 bg-white/90 backdrop-blur border-b border-[var(--line)]">
<div class="max-w-7xl mx-auto px-6 py-4 flex items-center justify-between">
<a class='flex items-center gap-3' href='/'>
<img src="images/gods-youth-logo.png" alt="God's Youth logo" class="w-12 h-12 object-contain">
<div>
<div class="font-display text-xl font-bold tracking-wide gradient-text">God’s Youth</div>
<!-- Tagline: BLACK (not gradient) -->
<div class="text-[10px] uppercase tracking-[.14em] text-black">YOU’RE NOT TOO YOUNG TO BE USED BY GOD</div>
</div>
</a>
<nav class="hidden lg:flex items-center gap-6 text-sm">
<a class='hover:opacity-80' href='/'>Home</a>
<a class='hover:opacity-80' href='/ministries'>Ministries</a>
<a class='hover:opacity-80' href='/watch'>Watch</a>
<a class='hover:opacity-80' href='/book'>Books</a>
<a class='hover:opacity-80' href='/team'>Team</a>
<a class='hover:opacity-80' href='/partnerships'>Partnerships</a>
<a class='hover:opacity-80' href='/contact'>Contact</a>
<a class='hover:opacity-80' href='/donate'>Donate</a>
</nav>
</div>
</header>
<section class="relative gradient-bg text-white">
<div class="pointer-events-none absolute inset-0 overflow-hidden">
<span class="absolute -top-20 -left-20 w-72 h-72 rounded-full blur-3xl opacity-30" style="background:#ffb300;"></span>
<span class="absolute -bottom-24 -right-10 w-96 h-96 rounded-full blur-3xl opacity-25" style="background:#000000;"></span>
</div>
<div class="relative max-w-7xl mx-auto px-6 pt-20 pb-24 grid md:grid-cols-2 gap-10 items-center">
<div>
<!-- HERO HEADLINE: BLACK (not gradient) -->
<h1 class="font-display text-4xl sm:text-5xl lg:text-6xl font-extrabold leading-tight text-black">YOU’RE NOT TOO YOUNG. YOU’RE NOT TOO LATE.</h1>
<p class="mt-5 text-lg max-w-xl">We point students and young adults to Jesus and into their God‑given calling. <span class="font-semibold">You’re not too young to be used by God</span>—and it’s not too late to begin.</p>
<div class="mt-8 flex flex-wrap gap-3">
<a class='px-6 py-3 rounded-2xl gradi
Open service 35.157.26.135:80 · godsyouthmovment.org
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:34:10 GMT Location: https://godsyouthmovment.org/ Server: Netlify X-Nf-Request-Id: 01KETCCG6B1HE84BKFGT91S5S4 Content-Length: 44 Connection: close Redirecting to https://godsyouthmovment.org/
Open service 35.157.26.135:443 · www.patelkiran.dev
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:34:00 GMT Location: https://patelkiran.dev/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCC6EGH58ZDR6WW05CH1QT Content-Length: 38 Connection: close Redirecting to https://patelkiran.dev/
Open service 35.157.26.135:80 · www.patelkiran.dev
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:34:08 GMT Location: https://www.patelkiran.dev/ Server: Netlify X-Nf-Request-Id: 01KETCCEMVE9TG8RCDWWHKT7V0 Content-Length: 42 Connection: close Redirecting to https://www.patelkiran.dev/
Open service 35.157.26.135:80 · patelkiran.dev
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:34:07 GMT Location: https://patelkiran.dev/ Server: Netlify X-Nf-Request-Id: 01KETCCDKQ167Z0RT9RAQ1EESN Content-Length: 38 Connection: close Redirecting to https://patelkiran.dev/
Open service 35.157.26.135:443 · patelkiran.dev
2026-01-13 00:33
HTTP/1.1 200 OK Age: 12813956 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Encoding: gzip Content-Length: 5414 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:59 GMT Etag: "c9ztqlt55aetn" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: RSC,Next-Router-State-Tree,Next-Router-Prefetch,Next-Router-Segment-Prefetch X-Content-Type-Options: nosniff X-Nextjs-Date: Mon, 12 Jan 2026 04:46:46 GMT X-Nextjs-Prerender: 1 X-Nextjs-Stale-Time: 4294967294 X-Nf-Request-Id: 01KETCC5XHAT9VRP1RGT6JG8BN X-Powered-By: Next.js Connection: close Page title: Kiran Patel - Software Developer <!DOCTYPE html><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/569ce4b8f30dc480-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/93f479601ee12b01-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" as="image" href="/path-finder.png"/><link rel="stylesheet" href="/_next/static/css/e56ea54426d10a55.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-05cc406d6a87b1a9.js"/><script src="/_next/static/chunks/4bd1b696-49dfdb1645950f8a.js" async=""></script><script src="/_next/static/chunks/517-1b72e8afd3a28b6b.js" async=""></script><script src="/_next/static/chunks/main-app-cdc49106085b3106.js" async=""></script><script src="/_next/static/chunks/863-ef59389c4c3744aa.js" async=""></script><script src="/_next/static/chunks/app/page-c93cb98214f54a76.js" async=""></script><meta name="next-size-adjust" content=""/><title>Kiran Patel - Software Developer</title><meta name="description" content="Welcome to my portfolio! I am a passionate full-stack developer who bridges the gap between frontend and backend development. Specializing in creating complete web solutions, from beautiful user interfaces to robust server architectures."/><meta name="author" content="Kiran Patel"/><meta name="keywords" content="Full-Stack Developer,Software Engineer,Frontend Development,Backend Development,React,Next.js,Node.js,TypeScript,Database Design,API Development,Cloud Solutions,DevOps,System Architecture,Web Development,Kiran Patel"/><meta name="creator" content="Kiran Patel"/><meta name="robots" content="index, follow"/><meta name="googlebot" content="index, follow, max-video-preview:-1, max-image-preview:large, max-snippet:-1"/><meta property="og:title" content="Kiran Patel - Software Developer Portfolio"/><meta property="og:description" content="Passionate full-stack developer creating complete web solutions. Explore my projects and technical expertise across the entire development stack."/><meta property="og:url" content="https://your-domain.com"/><meta property="og:site_name" content="Kiran Patel - Portfolio"/><meta property="og:locale" content="en_US"/><meta property="og:image" content="http://localhost:3000/og-image.jpg"/><meta property="og:image:width" content="1200"/><meta property="og:image:height" content="630"/><meta property="og:image:alt" content="Kiran Patel - Software Developer Portfolio"/><meta property="og:type" content="website"/><meta name="twitter:card" content="summary_large_image"/><meta name="twitter:creator" content="@yourusername"/><meta name="twitter:title" content="Kiran Patel - Software Developer"/><meta name="twitter:description" content="Passionate full-stack developer creating complete web solutions. Explore my projects and technical expertise across the entire development stack."/><meta name="twitter:image" content="http://localhost:3000/og-image.jpg"/><link rel="icon" href="/favicon.ico" type="image/x-icon" sizes="16x16"/><script src="/_next/static/chunks/polyfills-42372ed130431b0a.js" noModule=""></script></head><body class="__variable_5cfdac __variable_9a8899 antialiased"><main class="min-h-screen bg-gradient-to-b from-gray-950 to-black text-white"><section class="min-h-screen relative overflow-hidden py-24 md:py-0"><div class="absolute inset-0"><div class="absolute inset-0 bg-[url('/grid.svg')] opacity-10"></div></div><div class="relative z-10 min-h-screen flex flex-col items-center justify-center px-4 pt-8 md:pt-0"><div class="text-center mb-8 md:mb-12" style="opacity:0;transform:translateY(20px)"><div class="space-y-3 md:space-y-4 mb-6 md:mb-8"><h1 class="text-4xl md:text-7xl font-bold text-transparent bg-clip-text bg-gradient-to-r from-blue-500 via-purple-500 to-teal-500">Kiran Patel</h1><h2 class="text-2xl md:text-4xl font-bold text-white">Software Developer</h2><p class="text-lg md:text-xl text-gray-400 max-w-2xl mx-auto">Full-stack developer skilled in
Open service 35.157.26.135:80 · www.dralisonreiter.com.br
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:46 GMT Location: https://www.dralisonreiter.com.br/ Server: Netlify X-Nf-Request-Id: 01KETCBSB94K6RHJFXCD7VR34K Content-Length: 49 Connection: close Redirecting to https://www.dralisonreiter.com.br/
Open service 35.157.26.135:443 · www.dralisonreiter.com.br
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:37 GMT Location: https://dralisonreiter.com.br/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCBGMEV8WEHEJ98B9BMPG1 Content-Length: 45 Connection: close Redirecting to https://dralisonreiter.com.br/
Open service 35.157.26.135:443 · www.codesmart.in
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:35 GMT Location: https://codesmart.in/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCBE09DTE6BW4G2RGSYZEY Content-Length: 36 Connection: close Redirecting to https://codesmart.in/
Open service 35.157.26.135:80 · www.codesmart.in
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:42 GMT Location: https://www.codesmart.in/ Server: Netlify X-Nf-Request-Id: 01KETCBN0AHX9SRFMXC7EEQ8GG Content-Length: 40 Connection: close Redirecting to https://www.codesmart.in/
Open service 35.157.26.135:443 · govistara.com
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:32 GMT Location: https://www.govistara.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCBBAN2383JNW088AHFN3B Content-Length: 41 Connection: close Redirecting to https://www.govistara.com/
Open service 35.157.26.135:80 · www.govistara.com
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:40 GMT Location: https://www.govistara.com/ Server: Netlify X-Nf-Request-Id: 01KETCBK0XVM6JHRKJCZDH2DQB Content-Length: 41 Connection: close Redirecting to https://www.govistara.com/
Open service 35.157.26.135:443 · www.govistara.com
2026-01-13 00:33
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 17139
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:33:32 GMT
Etag: "45bef084aaeb43cd8a1d3ac1e4c27e01-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCBAWS48TMSNX4X47RCRB0
Connection: close
Page title: Vistara Consulting Group (VCG)
<!DOCTYPE html>
<html dir="ltr" lang="en-US">
<head>
<meta http-equiv="content-type" content="text/html; charset=utf-8">
<meta http-equiv="x-ua-compatible" content="IE=edge">
<meta name="author" content="SemiColonWeb">
<meta name="description" content="Vistara Consulting Group LLC">
<!-- Font Imports -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Lato:ital,wght@0,300;0,400;0,700;1,400&family=Raleway:wght@300;400;500;600;700&display=swap" rel="stylesheet">
<link rel="stylesheet" href="https://use.typekit.net/ipp3kvy.css">
<!-- Core Style -->
<link rel="stylesheet" href="style.css">
<!-- Font Icons -->
<link rel="stylesheet" href="css/font-icons.css">
<!-- Plugins/Components CSS -->
<link rel="stylesheet" href="css/swiper.css">
<!-- Custom CSS -->
<link rel="stylesheet" href="css/custom.css">
<meta name="viewport" content="width=device-width, initial-scale=1">
<!-- Document Title
============================================= -->
<title>Vistara Consulting Group (VCG)</title>
<style>
:root {
--cnvs-secondary-font: quiche-sans, sans-serif;
}
.block-sticky-cards .content-wrap,
.block-sticky-cards .section { overflow: visible; }
.block-sticky-cards .sticky-section + .sticky-section {
margin-top: 5vh;
}
@media (min-width: 992px) {
.block-sticky-cards .sticky-section {
--sticky-top-gap: 30px;
position: -webkit-sticky;
position: sticky;
z-index: 2;
top: calc(80px + var(--sticky-top-gap));
}
.block-sticky-cards .sticky-section + .sticky-section {
margin-top: 20vh;
}
}
</style>
</head>
<body class="stretched block-sticky-cards">
<!-- Document Wrapper
============================================= -->
<div id="wrapper">
<!-- Content
============================================= -->
<section id="content">
<header id="header" class="full-header transparent-header dark">
<div id="header-wrap">
<div class="container">
<div class="header-row">
<!-- Logo
============================================= -->
<div id="logo">
<a href='/'>
<img class="logo-default" srcset="images/vistaralogo3.png, images/vistaralogo3.png 2x" src="images/vistaralogo3.png" alt="Canvas Logo">
<img class="logo-dark" srcset="images/vistaralogo3.png, images/vistaralogo3.png" src="images/vistaralogo3.png" alt="Canvas Logo" >
</a>
</div><!-- #logo end -->
<div class="header-misc">
<!-- Top Search
============================================= -->
<div id="top-search" class="header-misc-icon">
<a href="#" id="top-search-trigger"><i class="uil uil-search"></i><i class="bi-x-lg"></i></a>
</div><!-- #top-search end -->
</div>
<div class="primary-menu-trigger">
<button class="cnvs-hamburger" type="button" title="Open Mobile Menu">
<span class="cnvs-hamburger-box"><span class="cnvs-hamburger-inner"></span></span>
</button>
</div>
<!-- Primary Navigation
============================================= -->
<nav class="primary-menu">
<ul class="menu-container">
<li class="menu-item mega-menu">
<a class='menu-link' href='/contact-us'><div>Contact Us</div></a>
</li>
</ul>
</nav><!-- #primary-menu end -->
<form class="top-search-form" action="search.html" method="get">
<input type="text" name="q" class="form-control" value="" placeholder="Type & Hit Enter.." autocomplete="off">
</form>
</div>
</div>
</div>
<div class="header-wrap-clone"></div>
</header><!-- #header end -->
<section id="slider" class="slider-element slider-parallax min-vh-100 dark include-header">
<div class="slider-inner">
<div class="vertical-middle">
Open service 35.157.26.135:80 · govistara.com
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:39 GMT Location: https://govistara.com/ Server: Netlify X-Nf-Request-Id: 01KETCBJ7W45GC6GAZXQEHSZJ3 Content-Length: 37 Connection: close Redirecting to https://govistara.com/
Open service 35.157.26.135:80 · www.gklean.com
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:36 GMT Location: https://www.gklean.com/ Server: Netlify X-Nf-Request-Id: 01KETCBFPRRT1J12NACJJACPTE Content-Length: 38 Connection: close Redirecting to https://www.gklean.com/
Open service 35.157.26.135:443 · www.gklean.com
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:27 GMT Location: https://gklean.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCB681G55Y4R1NR6R3GBHW Content-Length: 34 Connection: close Redirecting to https://gklean.com/
Open service 35.157.26.135:80 · greenarsenal.net
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:36 GMT Location: https://greenarsenal.net/ Server: Netlify X-Nf-Request-Id: 01KETCBF10HDVSDFN9K08S855P Content-Length: 40 Connection: close Redirecting to https://greenarsenal.net/
Open service 35.157.26.135:443 · greenarsenal.net
2026-01-13 00:33
HTTP/1.1 200 OK Age: 9907378 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43989 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:27 GMT Etag: "nha46wyjy3vvv" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: RSC,Next-Router-State-Tree,Next-Router-Prefetch X-Content-Type-Options: nosniff X-Nextjs-Date: Tue, 13 Jan 2026 00:33:21 GMT X-Nf-Request-Id: 01KETCB6PATKR02C8K9732B64G X-Powered-By: Next.js Connection: close Page title: GreenArsenal - Saudi CTI Platform <!DOCTYPE html><html lang="ar" dir="rtl"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1.0"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" as="image" href="/images/greenarsenal-logo.png" fetchPriority="high"/><link rel="stylesheet" href="/_next/static/css/3d88f5d3f06ffcbf.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-c81f7fd28659d64f.js"/><script src="/_next/static/chunks/fd9d1056-91aa9495991b9c80.js" async=""></script><script src="/_next/static/chunks/117-4b311a6519ddf5c4.js" async=""></script><script src="/_next/static/chunks/main-app-f1e2f05f66ca4fbd.js" async=""></script><script src="/_next/static/chunks/691-b870cb7021ee6f9e.js" async=""></script><script src="/_next/static/chunks/app/page-1a913f8aebb9ee80.js" async=""></script><title>GreenArsenal - Saudi CTI Platform</title><meta name="description" content="Saudi Arabia's pioneering cybersecurity threat intelligence platform combining competitions with community-driven threat sharing"/><meta name="generator" content="v0.app"/><script src="/_next/static/chunks/polyfills-42372ed130431b0a.js" noModule=""></script></head><body><div class="min-h-screen bg-slate-900 bg-gradient-to-br from-slate-900 via-green-900/90 to-green-800/80" dir="rtl"><header class="border-b border-green-800/10 bg-slate-900/90 backdrop-blur-sm sticky top-0 z-50 transition-all duration-300 py-2"><div class="container mx-auto px-4"><div class="flex items-center justify-between h-16"><div class="flex items-center gap-2 sm:gap-4 flex-shrink-0"><div class="relative h-12 w-12 sm:h-16 sm:w-16"><img alt="GreenArsenal Logo" fetchPriority="high" decoding="async" data-nimg="fill" class="object-contain" style="position:absolute;height:100%;width:100%;left:0;top:0;right:0;bottom:0;color:transparent" src="/images/greenarsenal-logo.png"/></div><div class="sm:block"><h1 class="text-lg sm:text-2xl font-bold text-slate-50">الترسانة الخضراء</h1><p class="text-[10px] sm:text-xs text-green-300 font-medium">منصة الاستخبارات السيبرانية السعودية</p></div></div><div class="md:hidden"><button class="hamburger-button inline-flex items-center justify-center p-2 rounded-md text-slate-400 hover:text-white hover:bg-slate-800/50 focus:outline-none focus:ring-2 focus:ring-inset focus:ring-green-500" aria-expanded="false"><span class="sr-only">Open main menu</span><svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="lucide lucide-menu block h-6 w-6" aria-hidden="true"><line x1="4" x2="20" y1="12" y2="12"></line><line x1="4" x2="20" y1="6" y2="6"></line><line x1="4" x2="20" y1="18" y2="18"></line></svg></button></div><nav class="hidden md:flex items-center justify-center flex-1 gap-1 mx-4"><a href="#hero" class="px-3 py-2 text-sm text-slate-300 hover:text-white hover:bg-slate-800/50 rounded-lg transition-colors whitespace-nowrap">الرئيسية</a><a href="#vision" class="px-3 py-2 text-sm text-slate-300 hover:text-white hover:bg-slate-800/50 rounded-lg transition-colors whitespace-nowrap">لماذا؟</a><a href="#goals" class="px-3 py-2 text-sm text-slate-300 hover:text-white hover:bg-slate-800/50 rounded-lg transition-colors whitespace-nowrap">الأهداف الاستراتيجية</a><a href="#roadmap" class="px-3 py-2 text-sm text-slate-300 hover:text-white hover:bg-slate-800/50 rounded-lg transition-colors whitespace-nowrap">الخطة الزمنية</a><a href="#interest" class="px-4 py-2 text-sm font-medium bg-gradient-to-r from-green-600 to-emerald-600 hover:from-green-700 hover:to-emerald-700 text-white rounded-lg transition-all whitespace-nowrap shadow-lg hover:shadow-green-500/20">كن من البنائين الأوائل</a></nav></div></div></header><section id="hero" class="min-h-[80vh] sm:min-h-[90vh] flex items-center bg-gradient-to-br from-slate-900 via-green-900/90 to-g
Open service 35.157.26.135:80 · brainerly.com
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:24 GMT Location: https://brainerly.com/ Server: Netlify X-Nf-Request-Id: 01KETCB3S0N73YPJKMK22RE7PN Content-Length: 37 Connection: close Redirecting to https://brainerly.com/
Open service 35.157.26.135:443 · brainerly.com
2026-01-13 00:33
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 4
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 2564
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:33:16 GMT
Etag: "9c12dc9381fa1697fe63a251c2c2dff3-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCAV8TKHZ7D6P76FCXZ04J
Connection: close
Page title: Brainerly - Brain Game Launchpad | Discover & Share Brain Training Games
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Brainerly - Brain Game Launchpad | Discover & Share Brain Training Games</title>
<meta name="description" content="Discover, play, and share brain training games. Vote on your favorites, provide feedback to developers, and help improve cognitive training games for everyone." />
<meta name="keywords" content="brain games, brain training, cognitive games, memory games, puzzle games, educational games, game development, indie games" />
<meta name="author" content="Brainerly" />
<meta name="theme-color" content="#2563eb" />
<meta property="og:type" content="website" />
<meta property="og:title" content="Brainerly - Brain Game Launchpad" />
<meta property="og:description" content="Discover, play, and share brain training games. Vote on your favorites and help developers improve their games." />
<meta property="og:image" content="https://bolt.new/static/og_default.png" />
<meta property="og:url" content="https://brainerly.com" />
<meta property="og:site_name" content="Brainerly" />
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:title" content="Brainerly - Brain Game Launchpad" />
<meta name="twitter:description" content="Discover, play, and share brain training games. Vote on your favorites and help developers improve their games." />
<meta name="twitter:image" content="https://bolt.new/static/og_default.png" />
<link rel="canonical" href="https://brainerly.com" />
<meta name="robots" content="index, follow, max-snippet:-1, max-image-preview:large, max-video-preview:-1" />
<meta name="googlebot" content="index, follow" />
<link rel="apple-touch-icon" href="/vite.svg" />
<meta name="mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-status-bar-style" content="default" />
<meta name="apple-mobile-web-app-title" content="Brainerly" />
<meta property="og:locale" content="en_US" />
<meta name="twitter:site" content="@brainerly" />
<meta name="twitter:creator" content="@brainerly" />
<script type="module" crossorigin src="/assets/index-C7WoMSPO.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-6GcW9KIf.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · temanbatin.com
2026-01-13 00:33
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 4959
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:33:11 GMT
Etag: "71018e4455fd51d501ca13e20312b53d-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETCAQ6J1522WHD8G88HD8X9
Connection: close
Page title: Teman Batin - Human Design Chart Gratis #1 Indonesia
<!doctype html>
<html lang="id">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Teman Batin - Human Design Chart Gratis #1 Indonesia</title>
<meta name="description"
content="Temukan dirimu yang sejati dengan Human Design. Chart gratis + analisis mendalam untuk memahami potensi terbaikmu. Digunakan 1500+ orang Indonesia.">
<meta name="author" content="Teman Batin" />
<meta name="robots" content="index, follow" />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://temanbatin.com/" />
<meta property="og:title" content="Teman Batin - Human Design Chart Gratis #1 Indonesia">
<meta property="og:description"
content="Temukan dirimu yang sejati dengan Human Design. Chart gratis + analisis mendalam untuk memahami potensi terbaikmu.">
<meta property="og:image" content="https://temanbatin.com/OG.jpg" />
<meta property="og:locale" content="id_ID" />
<!-- Twitter -->
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:site" content="@temanbatin" />
<meta name="twitter:title" content="Teman Batin - Human Design Chart Gratis #1 Indonesia">
<meta name="twitter:description"
content="Temukan dirimu yang sejati dengan Human Design. Chart gratis + analisis mendalam.">
<meta name="twitter:image" content="https://temanbatin.com/OG.jpg" />
<link rel="icon" type="image/png"
href="https://storage.googleapis.com/gpt-engineer-file-uploads/brEcArQF50WBqEkSGvIOI7xpmgC2/uploads/1767555357944-favicon.png">
<link rel="canonical" href="https://temanbatin.com/" />
<!-- FAQ Schema Markup -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "FAQPage",
"mainEntity": [
{
"@type": "Question",
"name": "Apa bedanya chart gratis dengan laporan berbayar?",
"acceptedAnswer": {
"@type": "Answer",
"text": "Chart gratis memberikan gambaran umum tipe, strategi, dan otoritas. Laporan berbayar (30+ halaman) menjelaskan secara detail tentang misi hidupmu, gate & center, strategi karir, dan panduan relasi."
}
},
{
"@type": "Question",
"name": "Bagaimana jika laporan tidak sesuai harapan?",
"acceptedAnswer": {
"@type": "Answer",
"text": "Kami memberikan garansi 100% uang kembali dalam 7 hari jika kamu merasa laporan tidak bermanfaat."
}
},
{
"@type": "Question",
"name": "Berapa lama laporan dikirim?",
"acceptedAnswer": {
"@type": "Answer",
"text": "Laporan dikirim ke email dalam maksimal 24 jam setelah pembayaran terverifikasi."
}
}
]
}
</script>
<!-- Product Schema Markup -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "Product",
"name": "Laporan Analisis Mendalam Human Design",
"description": "Laporan personal 30+ halaman tentang Human Design kamu termasuk analisis tipe, strategi, otoritas, misi hidup (incarnation cross), dan panduan karir & relasi.",
"brand": {
"@type": "Brand",
"name": "Teman Batin"
},
"offers": {
"@type": "Offer",
"price": "199000",
"priceCurrency": "IDR",
"availability": "https://schema.org/InStock",
"priceValidUntil": "2027-12-31"
},
"aggregateRating": {
"@type": "AggregateRating",
"ratingValue": "4.8",
"reviewCount": "150"
}
}
</script>
<!-- Meta Pixel Code -->
<script>
!function (f, b, e, v, n, t, s) {
if (f.fbq) return; n = f.fbq = function () {
n.callMethod ?
n.callMethod.apply(n, arguments) : n.queue.push(arguments)
};
if (!f._fbq) f._fbq = n; n.push = n; n.loaded = !0; n.version = '2.0';
n.queue = []; t = b.createElement(e); t.async = !0;
t.src = v; s = b.getElementsByTagN
Open service 35.157.26.135:80 · temanbatin.com
2026-01-13 00:33
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:20 GMT Location: https://temanbatin.com/ Server: Netlify X-Nf-Request-Id: 01KETCAZEFGYHMMY91ZZZ08YHR Content-Length: 38 Connection: close Redirecting to https://temanbatin.com/
Open service 35.157.26.135:80 · www.brookssolutions.xyz
2026-01-13 00:32
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:33:03 GMT Location: https://www.brookssolutions.xyz/ Server: Netlify X-Nf-Request-Id: 01KETCAEZDAK0HDZDP3REFWA41 Content-Length: 47 Connection: close Redirecting to https://www.brookssolutions.xyz/
Open service 35.157.26.135:443 · www.brookssolutions.xyz
2026-01-13 00:32
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:32:55 GMT Location: https://brookssolutions.xyz/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETCA7368CR5SX3CHFKP4HYM Content-Length: 43 Connection: close Redirecting to https://brookssolutions.xyz/
Open service 35.157.26.135:443 · canary.inprodwetest.com
2026-01-13 00:32
HTTP/1.1 200 OK
Age: 5180802
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 89494
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:32:27 GMT
Etag: "12zqxj310pr1wxa"
Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc,cookie=__prerender_bypass|__next_preview_data
Server: Netlify
Strict-Transport-Security: max-age=31536000
Vary: Accept-Encoding
X-Content-Type-Options: nosniff
X-Nextjs-Date: Tue, 13 Jan 2026 00:32:25 GMT
X-Nf-Request-Id: 01KETC9BY00A0CSSEABDJS3K37
X-Powered-By: Next.js
Connection: close
<!DOCTYPE html><html><head><meta charSet="utf-8" data-next-head=""/><meta name="viewport" content="width=device-width" data-next-head=""/><link rel="preload" href="/_next/static/css/2341627488bf7e4f.css" as="style"/><link rel="stylesheet" href="/_next/static/css/2341627488bf7e4f.css" data-n-g=""/><noscript data-n-css=""></noscript><script defer="" noModule="" src="/_next/static/chunks/polyfills-42372ed130431b0a.js"></script><script src="/_next/static/chunks/webpack-a866bb07f6a131cf.js" defer=""></script><script src="/_next/static/chunks/framework-306aa0968ce8efc5.js" defer=""></script><script src="/_next/static/chunks/main-e89ea6fa5eb34098.js" defer=""></script><script src="/_next/static/chunks/pages/_app-7283156036b78080.js" defer=""></script><script src="/_next/static/chunks/pages/%5B%5B...slug%5D%5D-9e9cdb3e5c42f98a.js" defer=""></script><script src="/_next/static/ZGbZlygZyLIQOjr9fv5FR/_buildManifest.js" defer=""></script><script src="/_next/static/ZGbZlygZyLIQOjr9fv5FR/_ssgManifest.js" defer=""></script><style id="__jsx-3261757971">:root{--theme-light: #ffffff;
--theme-on-light: #050806;
--theme-dark: #000000;
--theme-on-dark: #FBFFF2;
--theme-primary: #0804F6;
--theme-on-primary: #FBFFF2;
--theme-secondary: #FE491F;
--theme-on-secondary: #050806;
--theme-complementary: #565862;
--theme-on-complementary: #FBFFF2;
--theme-font-body: "DM Mono", monospace;
--theme-heading-weight: 400;
--theme-heading-case: uppercase;
}</style></head><body><div id="__next"></div><script id="__NEXT_DATA__" type="application/json">{"props":{"pageProps":{"type":"PageLayout","title":"Home","colors":"colors-a","backgroundImage":{"type":"BackgroundImage","url":"/images/bg1.jpg","backgroundSize":"cover","backgroundPosition":"center","backgroundRepeat":"no-repeat","opacity":75,"__metadata":{"modelName":"BackgroundImage"}},"sections":[{"elementId":"","colors":"colors-f","backgroundSize":"full","title":"I’m a developer, digital artist, consultant and a bunch of other impressive titles and buzz words.","subtitle":"This is my info—I’m sharing it all this with ya’ll to impress you with all the hard work I’ve done in the past few years. Once you’re impressed, you can continue to scroll down to see more details and credentials about me.","styles":{"self":{"height":"auto","width":"wide","margin":["mt-0","mb-0","ml-0","mr-0"],"padding":["pt-36","pb-48","pl-4","pr-4"],"flexDirection":"row-reverse","textAlign":"left"}},"type":"HeroSection","actions":[],"__metadata":{"modelName":"HeroSection"}},{"colors":"colors-f","type":"FeaturedProjectsSection","elementId":"","actions":[{"type":"Link","label":"See all projects","url":"/projects","__metadata":{"modelName":"Link"}}],"showDate":false,"showDescription":true,"showFeaturedImage":true,"showReadMoreLink":true,"variant":"variant-b","projects":[{"type":"ProjectLayout","title":"Another cool project","colors":"colors-a","date":"2021-12-20","client":"Awesome client","description":"It’s hard to imagine that I’ve that I wrote all this code by myself, probably because I worked with an entire team :) but they definitely followed my lead most of the time.","featuredImage":{"type":"ImageBlock","url":"/images/bg2.jpg","altText":"Project thumbnail image","__metadata":{"modelName":"ImageBlock"}},"media":{"type":"ImageBlock","url":"/images/bg2.jpg","altText":"Project image","__metadata":{"modelName":"ImageBlock"}},"markdownContent":"Lorem ipsum dolor sit amet, consectetur adipiscing elit. Sed ante lorem, tincidunt ac leo efficitur, feugiat tempor odio. Curabitur at auctor sapien. Etiam at cursus enim. Suspendisse sed augue tortor. Nunc eu magna vitae lorem pellentesque fermentum. Sed in facilisis dui. Nulla molestie risus in mi dapibus, eget porta lorem semper. Donec sed facilisis nibh. Curabitur eget dui in libero euismod commodo nec sit amet est. Etiam id ipsum aliquam, vehicula erat sit amet, consequat tortor.\n\nEtiam facilisis lacus nec pretium lobortis. Praesent dapibus justo non efficitur efficitur. Nullam viverra justo arcu, eget egestas tortor pretium id. Sed imperdiet mattis eleifend. Vivamus suscipit
Open service 35.157.26.135:443 · cwai.vu22dx.com
2026-01-13 00:32
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1015
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:32:27 GMT
Etag: "926b1de4a217bc51647f0eab0463b262-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC9BQ7791AMZ3SQ13C5MFG
Connection: close
Page title: VU22DX CW Decoder
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>VU22DX CW Decoder</title>
<link rel="preconnect" href="https://fonts.googleapis.com" />
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin />
<link
href="https://fonts.googleapis.com/css2?family=Roboto+Mono:wght@500&display=swap"
rel="stylesheet"
/>
<script src="https://cdn.jsdelivr.net/npm/onnxruntime-web@1.22.0/dist/ort.min.js"></script>
<script type="module" crossorigin src="./assets/main-C1ZqasZn.js"></script>
<link rel="modulepreload" crossorigin href="./assets/global-C1lvCNDk.js">
<link rel="stylesheet" crossorigin href="./assets/global-Do7ljZe9.css">
<link rel="stylesheet" crossorigin href="./assets/main-BI_wDG85.css">
<script async src="https://bolt.new/badge.js?s=19bce399-8dca-420a-ab6a-935bafb489ad"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · cwai.vu22dx.com
2026-01-13 00:32
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:32:34 GMT Location: https://cwai.vu22dx.com/ Server: Netlify X-Nf-Request-Id: 01KETC9K26NG77H30TWSP1E8B8 Content-Length: 39 Connection: close Redirecting to https://cwai.vu22dx.com/
Open service 35.157.26.135:80 · canary.inprodwetest.com
2026-01-13 00:32
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:32:36 GMT Location: https://canary.inprodwetest.com/ Server: Netlify X-Nf-Request-Id: 01KETC9MFBE4QNX6CAS563YTW3 Content-Length: 47 Connection: close Redirecting to https://canary.inprodwetest.com/
Open service 35.157.26.135:443 · flowsuu.busrasuhaydar.com
2026-01-13 00:32
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 11044
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:32:25 GMT
Etag: "789cf73e13d9d172942105bd907eaadd-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC9A0TK5702KMTNGX1YG9N
Connection: close
Page title: Piano Fluid - FIXED
<!DOCTYPE html>
<html lang="en">
<head>
<title>Piano Fluid - FIXED</title>
<style>
* {
margin: 0;
padding: 0;
box-sizing: border-box;
}
html, body {
width: 100vw !important;
height: 100vh !important;
background-color: #000;
overflow: hidden;
position: fixed;
top: 0;
left: 0;
}
canvas {
display: block;
position: fixed !important;
top: 0 !important;
left: 0 !important;
width: 100vw !important;
height: 100vh !important;
outline: 0;
z-index: 1;
}
div:not(#root), span, p, h1, h2, h3, h4, h5, h6, a, label, button,
[class*="fps"], [class*="cpu"], [class*="gpu"], [class*="info"],
[class*="cables"], [id*="stats"], [id*="info"] {
display: none !important;
visibility: hidden !important;
opacity: 0 !important;
pointer-events: none !important;
}
* {
-webkit-tap-highlight-color: transparent;
-webkit-touch-callout: none;
-webkit-user-select: none;
user-select: none;
}
</style>
<meta charset="utf-8">
<meta name="viewport" content="width=device-width, user-scalable=no, initial-scale=1">
</head>
<body>
<canvas id="glcanvas" width="100vw" height="100vh" tabindex="1"></canvas>
<script type="text/javascript" src="js/patch.js" async></script>
<script type="text/javascript">
let patchReady = false;
let cablesLoaded = false;
function showError(initiator,...args) {
// Error logging disabled
}
function patchInitialized(patch) {
patchReady = true;
forceFullscreen();
hideAllText();
setInterval(hideAllText, 100);
// Test color variables
setTimeout(() => {
testColorVariables();
}, 1000);
}
function testColorVariables() {
if (!patchReady || typeof CABLES === 'undefined' || !CABLES.patch) {
return;
}
const testVars = ['SplatColor', 'color', 'pianoColorR', 'colorR'];
testVars.forEach(varName => {
try {
const val = CABLES.patch.getVariable(varName);
} catch(e) {
// Variable not found
}
});
}
function forceFullscreen() {
const canvas = document.getElementById('glcanvas');
if (!canvas) return;
const w = window.innerWidth;
const h = window.innerHeight;
canvas.width = w;
canvas.height = h;
canvas.style.cssText = `
position: fixed !important;
top: 0 !important;
left: 0 !important;
width: ${w}px !important;
height: ${h}px !important;
display: block !important;
z-index: 1 !important;
`;
document.body.style.cssText = `
width: 100vw !important;
height: 100vh !important;
overflow: hidden !important;
position: fixed !important;
top: 0 !important;
left: 0 !important;
`;
}
function hideAllText() {
document.querySelectorAll('div, span, p, h1, h2, h3, h4, h5, h6, a, label, button').forEach(el => {
if (el.id !== 'root' && el.tagName.toLowerCase() !== 'canvas') {
el.style.display = 'none';
el.style.visibility = 'hidden';
el.style.opacity = '0';
}
});
}
window.addEventListener('resize', forceFullscreen);
window.addEventListener('load', () => {
fo
Open service 35.157.26.135:80 · flowsuu.busrasuhaydar.com
2026-01-13 00:32
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:32:33 GMT Location: https://flowsuu.busrasuhaydar.com/ Server: Netlify X-Nf-Request-Id: 01KETC9J2AKJJ4QHB2EV818NJH Content-Length: 49 Connection: close Redirecting to https://flowsuu.busrasuhaydar.com/
Open service 35.157.26.135:80 · www.krlabs.co.uk
2026-01-13 00:32
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:32:32 GMT Location: https://www.krlabs.co.uk/ Server: Netlify X-Nf-Request-Id: 01KETC9GZ797PGYFZ3QBDY2VVK Content-Length: 40 Connection: close Redirecting to https://www.krlabs.co.uk/
Open service 35.157.26.135:443 · www.krlabs.co.uk
2026-01-13 00:32
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 794
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:32:25 GMT
Etag: "6a0c31f1350fc656d648717bc3c93a5c-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC99K95RD64Y2XTHKMEPA9
Connection: close
Page title: KR Labs - Transform Your Business with AI Solutions
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>KR Labs - Transform Your Business with AI Solutions</title>
<meta name="description" content="Leading AI solutions provider specializing in machine learning, chatbots, automation, and data intelligence. Transform your business with custom AI applications.">
<script type="module" crossorigin src="/assets/index-4BfRFW7B.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DnurKF7C.css">
<script async src="https://bolt.new/badge.js?s=e5324160-43a7-40da-b63b-a55a0080b267"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.proveo.shop
2026-01-13 00:31
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:31:45 GMT Location: https://www.proveo.shop/ Server: Netlify X-Nf-Request-Id: 01KETC836X142V460118TP0JGE Content-Length: 39 Connection: close Redirecting to https://www.proveo.shop/
Open service 35.157.26.135:443 · www.proveo.shop
2026-01-13 00:31
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:31:36 GMT Location: https://proveo.shop/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETC7SS8W0Y0H585KVSBHB84 Content-Length: 35 Connection: close Redirecting to https://proveo.shop/
Open service 35.157.26.135:80 · moontuner.xyz
2026-01-13 00:31
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:31:42 GMT Location: https://moontuner.xyz/ Server: Netlify X-Nf-Request-Id: 01KETC7ZMKDSJA2K0D0FZFY77T Content-Length: 37 Connection: close Redirecting to https://moontuner.xyz/
Open service 35.157.26.135:443 · moontuner.xyz
2026-01-13 00:31
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 915 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:31:34 GMT Etag: "e82b1994e9e364d04f5f28cc245e2f71-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETC7QZDM6XEY3TZ53GEH469 Connection: close Page title: Moontuner | Phase-Based Guidance <!doctype html> <html lang="en"> <head> <meta charset="UTF-8" /> <link rel="icon" type="image/svg+xml" href="/favicon.svg" /> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <title>Moontuner | Phase-Based Guidance</title> <meta name="description" content="26 workbooks for your lunar synchronization. Continuous guidance from new moon to full moon." /> <link rel="preconnect" href="https://fonts.googleapis.com" /> <link rel="preconnect" href="https://fonts.gstatic.com" crossorigin /> <link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500&family=Playfair+Display:italic,wght@400;700&family=Syne:wght@700;800&display=swap" rel="stylesheet" /> <script type="module" crossorigin src="./assets/index-BiITFCyw.js"></script> <link rel="stylesheet" crossorigin href="./assets/index-D6FEGSKC.css"> </head> <body> <div id="root"></div> </body> </html>
Open service 35.157.26.135:443 · www.connect-source.com
2026-01-13 00:31
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:31:34 GMT Location: https://connect-source.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETC7RCMMR59JRE8KP6EH89W Content-Length: 42 Connection: close Redirecting to https://connect-source.com/
Open service 35.157.26.135:80 · www.connect-source.com
2026-01-13 00:31
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:31:41 GMT Location: https://www.connect-source.com/ Server: Netlify X-Nf-Request-Id: 01KETC7ZATRKVZ6SQEW69QC4FT Content-Length: 46 Connection: close Redirecting to https://www.connect-source.com/
Open service 35.157.26.135:443 · www.syncsquads.com
2026-01-13 00:30
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:30:59 GMT Location: https://syncsquads.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETC6PAE8WN91JJRYHPHYH7Z Content-Length: 38 Connection: close Redirecting to https://syncsquads.com/
Open service 35.157.26.135:80 · www.syncsquads.com
2026-01-13 00:30
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:31:07 GMT Location: https://www.syncsquads.com/ Server: Netlify X-Nf-Request-Id: 01KETC6Y2QF35C838JF3X0GBYT Content-Length: 42 Connection: close Redirecting to https://www.syncsquads.com/
Open service 35.157.26.135:80 · lvkcc24.org
2026-01-13 00:30
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:30:45 GMT Location: https://lvkcc24.org/ Server: Netlify X-Nf-Request-Id: 01KETC67WN0G3JG248TSRAY5G8 Content-Length: 35 Connection: close Redirecting to https://lvkcc24.org/
Open service 35.157.26.135:443 · lvkcc24.org
2026-01-13 00:30
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1055
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:30:37 GMT
Etag: "fc940b8c557558cd1836b256048af5f6-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC60KRCE5PCS36PV74V2WG
Connection: close
Page title: Las Vegas Korean Chamber Choir
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Las Vegas Korean Chamber Choir</title>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link
href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600&family=Playfair+Display:wght@400;600;700&display=swap"
rel="stylesheet">
<script type="module" crossorigin src="/assets/index-CPYkPQS-.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CbO-B_rv.css">
</head>
<body>
<!-- Netlify Form Detection -->
<form name="contact" netlify netlify-honeypot="bot-field" hidden>
<input type="text" name="name" />
<input type="text" name="part" />
<input type="text" name="contact" />
<textarea name="introduction"></textarea>
</form>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · norgardenespaciosverdes.app
2026-01-13 00:30
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:30:39 GMT Location: https://norgardenespaciosverdes.app/ Server: Netlify X-Nf-Request-Id: 01KETC6281ST77QDWQS4KH43X7 Content-Length: 51 Connection: close Redirecting to https://norgardenespaciosverdes.app/
Open service 35.157.26.135:443 · norgardenespaciosverdes.app
2026-01-13 00:30
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 825
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:30:32 GMT
Etag: "41e863409a466761b29a155d340d13d0-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC5V7KHGM02FCEKK01TBW6
Connection: close
Page title: Norgarden Reclamos
<!doctype html>
<html lang="es">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<meta name="description" content="Sistema de gestión de reclamos y mantenimiento de espacios verdes" />
<meta name="theme-color" content="#16a34a" />
<link rel="manifest" href="/manifest.json" />
<link rel="apple-touch-icon" href="/icon-192.png" />
<title>Norgarden Reclamos</title>
<script type="module" crossorigin src="/assets/index-DyD2-mwh.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CEG6qMRc.css">
<script async src="https://bolt.new/badge.js?s=2d631075-effe-4977-ac95-73cf090bcd7b"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · moul.io
2026-01-13 00:30
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:30:23 GMT Location: https://moul.io/ Server: Netlify X-Nf-Request-Id: 01KETC5JCM9NXRRD7ZNNXKC6CW Content-Length: 31 Connection: close Redirecting to https://moul.io/
Open service 35.157.26.135:443 · moul.io
2026-01-13 00:30
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 12407
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 6760
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:30:14 GMT
Etag: "a904f02b0796c791825151c837dcf808-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC59VQ8P62F1CDJEQD6C2B
Connection: close
Page title: moul.io Go modules
<html>
<head>
<title>moul.io Go modules</title>
<link rel="stylesheet" type="text/css" href="/style.css">
<meta property="og:title" content="moul.io Go modules">
<meta property="og:type" content="website">
<meta property="og:url" content="https://moul.io/">
<meta property="og:image" content="https://moul.io/moul-codes.png">
<link rel="apple-touch-icon" sizes="180x180" href="/apple-touch-icon.png">
<link rel="icon" type="image/png" sizes="32x32" href="/favicon-32x32.png">
<link rel="icon" type="image/png" sizes="16x16" href="/favicon-16x16.png">
<link rel="manifest" href="/site.webmanifest">
<link rel="mask-icon" href="/safari-pinned-tab.svg" color="#5bbad5">
<meta name="msapplication-TileColor" content="#9f00a7">
<meta name="theme-color" content="#ffffff">
</head>
<body>
<h1>moul.io Go Modules</h1>
<ul>
<li><a href="./adapterkit/">moul.io/adapterkit</a></li>
<li><a href="./adapterkit-module-demo/">moul.io/adapterkit-module-demo</a></li>
<li><a href="./airgap-tools/">moul.io/airgap-tools</a></li>
<li><a href="./alfred-workflow-u/">moul.io/alfred-workflow-u</a></li>
<li><a href="./anonuuid/">moul.io/anonuuid</a></li>
<li><a href="./ansicat/">moul.io/ansicat</a></li>
<li><a href="./asanaman/">moul.io/asanaman</a></li>
<li><a href="./ascii2svg/">moul.io/ascii2svg</a></li>
<li><a href="./asciimoul/">moul.io/asciimoul</a></li>
<li><a href="./assh/">moul.io/assh</a></li>
<li><a href="./banner/">moul.io/banner</a></li>
<li><a href="./berty-discord-webhook/">moul.io/berty-discord-webhook</a></li>
<li><a href="./berty-library-test/">moul.io/berty-library-test</a></li>
<li><a href="./betterdiff/">moul.io/betterdiff</a></li>
<li><a href="./betterless/">moul.io/betterless</a></li>
<li><a href="./build/">moul.io/build</a></li>
<li><a href="./captcha/">moul.io/captcha</a></li>
<li><a href="./chizap/">moul.io/chizap</a></li>
<li><a href="./climan/">moul.io/climan</a></li>
<li><a href="./converter/">moul.io/converter</a></li>
<li><a href="./cosmos-snapshot/">moul.io/cosmos-snapshot</a></li>
<li><a href="./cryptoguess/">moul.io/cryptoguess</a></li>
<li><a href="./dl/">moul.io/dl</a></li>
<li><a href="./dockerself/">moul.io/dockerself</a></li>
<li><a href="./drunken-bishop/">moul.io/drunken-bishop</a></li>
<li><a href="./einstein-riddle-generator/">moul.io/einstein-riddle-generator</a></li>
<li><a href="./event/">moul.io/event</a></li>
<li><a href="./flowtest/">moul.io/flowtest</a></li>
<li><a href="./fs-bundler/">moul.io/fs-bundler</a></li>
<li><a href="./funcenter/">moul.io/funcenter</a></li>
<li><a href="./generate-fake-data/">moul.io/generate-fake-data</a></li>
<li><a href="./ghsql/">moul.io/ghsql</a></li>
<li><a href="./ghtop/">moul.io/ghtop</a></li>
<li><a href="./git-ci/">moul.io/git-ci</a></li>
<li><a href="./gno-basics/">moul.io/gno-basics</a></li>
<li><a href="./gno-stuff/">moul.io/gno-stuff</a></li>
<li><a href="./godev/">moul.io/godev</a></li>
<li><a href="./goke/">moul.io/goke</a></li>
<li><a href="./golang-repo-template/">moul.io/golang-repo-template</a></li>
<li><a href="./graphman/">moul.io/graphman</a></li>
<li><a href="./grpcbin/">moul.io/grpcbin</a></li>
<li><a href="./guilhunize/">moul.io/guilhunize</a></li>
<li><a href="./hacker-typing/">moul.io/hacker-typing</a></li>
<li><a href="./hcfilters/">moul.io/hcfilters</a></li>
<li><a href="./http2curl/">moul.io/http2curl</a></li>
<li><a href="./junk/">moul.io/junk</a></li>
<li><a href="./lexique/">moul.io/lexique</a></li>
<li><a href="./logman/">moul.io/logman</a></li>
<li><a href="./makerlog/">moul.io/makerlog</a></li>
<li><a href="./mdcodec/">moul.io/mdcodec</a></li>
<li><a href="./mdtable/">moul.io/mdtable<
Open service 35.157.26.135:443 · www.kovacusuireiki.com.tr
2026-01-13 00:29
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:30:01 GMT Location: https://kovacusuireiki.com.tr/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETC4X0FH5QV5TX299ER0HE7 Content-Length: 45 Connection: close Redirecting to https://kovacusuireiki.com.tr/
Open service 35.157.26.135:80 · www.kovacusuireiki.com.tr
2026-01-13 00:29
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:30:09 GMT Location: https://www.kovacusuireiki.com.tr/ Server: Netlify X-Nf-Request-Id: 01KETC54PM1X2C29E0HE05MKJR Content-Length: 49 Connection: close Redirecting to https://www.kovacusuireiki.com.tr/
Open service 35.157.26.135:443 · georginayeboah.com
2026-01-13 00:29
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 4
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 311949
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:29:08 GMT
Etag: "e1d02e7c8e1fa5376133061f4a73bb30-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC392HPSYWPBJ0114EJ4CF
Connection: close
Page title: Georgina Yeboah
<!DOCTYPE html> <html lang=en> <head> <meta charset=utf-8> <meta content="width=device-width,initial-scale=1,maximum-scale=1,user-scalable=no" name=viewport> <meta content=#333333 name=theme-color> <base href=/ > <link href=index.css rel=preload as=style> <link href=index.css rel=stylesheet> <link href=/apple-touch-icon.png rel=apple-touch-icon sizes=180x180> <link href=/favicon-32x32.png rel=icon type=image/png sizes=32x32> <link href=/favicon-16x16.png rel=icon type=image/png sizes=16x16> <link href=/site.webmanifest rel=manifest> <link href=/safari-pinned-tab.svg rel=mask-icon color=#3150c6> <meta content=#da532c name=msapplication-TileColor> <meta content=#ffffff name=theme-color> <link href=https://dgf765uuww7bi.cloudfront.net rel=preconnect> <link href=work-sans-latin-300-normal.woff2 rel=preload as=font crossorigin=anonymous type=font/woff2> <link href=work-sans-latin-300-italic.woff2 rel=preload as=font crossorigin=anonymous type=font/woff2> <link href=work-sans-latin-400-normal.woff2 rel=preload as=font crossorigin=anonymous type=font/woff2> <link href=work-sans-latin-400-italic.woff2 rel=preload as=font crossorigin=anonymous type=font/woff2> <link href=work-sans-latin-700-normal.woff2 rel=preload as=font crossorigin=anonymous type=font/woff2> <link href=work-sans-latin-700-italic.woff2 rel=preload as=font crossorigin=anonymous type=font/woff2> <title>Georgina Yeboah</title><meta content="Georgina Yeboah’s online portfolio, comics, photography, installations, small projects, etc." data-svelte=svelte-wdz75c name=description><meta content=georgina data-svelte=svelte-wdz75c property=og:site_name><meta content=en_US data-svelte=svelte-wdz75c property=og:locale><meta content=https://georginayeboah.com data-svelte=svelte-wdz75c property=og:url><meta content=website data-svelte=svelte-wdz75c property=og:type><meta content="Georgina Yeboah" data-svelte=svelte-wdz75c property=og:title><meta content="Georgina Yeboah’s online portfolio, comics, photography, installations, small projects, etc." data-svelte=svelte-wdz75c property=og:description><meta data-svelte=svelte-wdz75c property=og:image><meta content="Georgina Yeboah’s online portfolio, comics, photography, installations, small projects, etc." data-svelte=svelte-wdz75c property=og:image:alt><meta content=@GGYY001 data-svelte=svelte-wdz75c name=twitter:creator><meta content=https://georginayeboah.com/android-chrome-512x512.png data-svelte=svelte-wdz75c name=twitter:image><meta content="Georgina Yeboah" data-svelte=svelte-wdz75c name=twitter:title><meta content="Georgina Yeboah’s online portfolio, comics, photography, installations, small projects, etc." data-svelte=svelte-wdz75c name=twitter:description><meta content="Georgina Yeboah’s online portfolio, comics, photography, installations, small projects, etc." data-svelte=svelte-wdz75c name=twitter:image:alt> <link href=client/client-a3079b78.css rel=stylesheet><link href=client/Media-44da91dd.css rel=stylesheet><link href=client/Category-1abfdce4.css rel=stylesheet><link href=client/index-45d9c06a.css rel=stylesheet> <script type=module>var W=({prefix:r="pdm",modes:w=["light","dark"]}={})=>{var n=r,l=window.localStorage,t=w,c=new Set,h=e=>{t=e,c.forEach(o=>o(e))},O={subscribe(e){return e(t),c.add(e),()=>c.delete(e)},set:h,update(e){h(e(t))}},u=new Set,a=matchMedia("(prefers-color-scheme: dark)"),m,f=({matches:e})=>{m=e?"dark":"light",u.forEach(o=>o(m))};a.addEventListener?a.addEventListener("change",f):a.addListener(f),f(a);var v={subscribe(e){return e(m),u.add(e),()=>u.delete(e)}},P=e=>!e||!t.includes(e)?void 0:e,p=new Set,s=P(l.getItem(n)),M=(e,o=!0)=>{if(e===s)return;o&&(e!==void 0?l.setItem(n,e):l.removeItem(n)),p.forEach(T=>T(e)),s=e};window.addEventListener("storage",e=>e.key===n&&M(e.newValue||void 0,!1));var i={subscribe(e){return e(s),p.add(e),()=>p.delete(e)},set:M,update(e){M(e(s))}},g,k,d,b=new Set,x=()=>{var e=g||k;e!==d&&(d=e,b.forEach(o=>o(d)))};i.subscribe(e=>{g=e,x()}),v.subscribe(e=>{k=e,x()});var E={subscribe(e){return e(d),b.add(e),()=>b.delete(e)},set:i.set,update(e){var o=t.indexOf(d);o
Open service 35.157.26.135:80 · georginayeboah.com
2026-01-13 00:29
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:29:15 GMT Location: https://georginayeboah.com/ Server: Netlify X-Nf-Request-Id: 01KETC3GRF4DQCXQ49PB9R8J57 Content-Length: 42 Connection: close Redirecting to https://georginayeboah.com/
Open service 35.157.26.135:80 · arthurmurraysalem.com
2026-01-13 00:28
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:28:38 GMT Location: https://arthurmurraysalem.com/ Server: Netlify X-Nf-Request-Id: 01KETC2BYP5DQSY3R6VKKYPKGT Content-Length: 45 Connection: close Redirecting to https://arthurmurraysalem.com/
Open service 35.157.26.135:443 · arthurmurraysalem.com
2026-01-13 00:28
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 55754
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:28:30 GMT
Etag: "565814c23674bf5fe67cb0cb0ecef8b4-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC24AE7WXCYMGHCQBQ8QH2
Connection: close
Page title: Ballroom Dance Lessons | Arthur Murray Salem
<!DOCTYPE html>
<html lang="en">
<head>
<title>Ballroom Dance Lessons | Arthur Murray Salem</title>
<meta charset="UTF-8" />
<meta http-equiv="X-UA-Compatible" content="IE=edge" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<meta
name="keywords"
content="Ballroom Dance Lessons, Dance Studio, Oregon, Salem, Eugene, Keizer, Albany."
/>
<meta
name="author"
content="Kyle Campbell, Christina Campbell, OnBeat Marketing"
/>
<meta property="og:title" content="Arthur Murray Dance Studio Salem" />
<meta property="og:type" content="website" />
<meta property="og:url" content="https://arthurmurraysalem.com" />
<meta
property="og:image"
content="https://arthurmurraysalem.com/images/CouplesDanceLessons.jpg"
/>
<meta
property="og:image:alt"
content="Walk in, Dance out! Start learning to dance today!"
/>
<meta
property="og:description"
content="Arthur Murray Dance Studios specialize in teaching beginner dancers everything they need to know to survive on the dance floor. Our interrelated system makes learning to dance to any style of music fun, quick, and easy!"
/>
<link rel="shortcut icon" href="/images/favicon.ico" />
<link rel="apple-touch-icon" href="/images/apple-touch-icon.png" />
<meta
name="description"
content="Arthur Murray specializes in teaching beginner dancers everything they need to know to survive on the dance floor. Our interrelated system makes learning to dance to any style of music fun, quick, and easy!"
/>
<link
rel="stylesheet"
href="/fonts/JosephinSans/josefinSans.css"
type="text/css"
media="all"
/>
<link
rel="stylesheet"
href="/fonts/Montserrat/montserrat.css"
type="text/css"
media="all"
/>
<script async src="/scripts/animation.js"></script>
<script
defer
src="https://kit.fontawesome.com/9959b546c4.js"
crossorigin="anonymous"
></script>
<!-- Google tag (gtag.js) -->
<script
async
src="https://www.googletagmanager.com/gtag/js?id=G-3KWEM3QQ47"
></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag() {
dataLayer.push(arguments);
}
gtag("js", new Date());
gtag("config", "G-3KWEM3QQ47");
</script>
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "LocalBusiness",
"image": [
"https://arthurmurraysalem.com/images/AMLogo.svg",
"https://arthurmurraysalem.com/images/CouplesDanceLessons.jpg"
],
"logo": "https://arthurmurraysalem.com/images/AMLogo.svg",
"name": "Arthur Murray Dance Studio Salem",
"address": {
"@type": "PostalAddress",
"streetAddress": "2755 Commercial St SE #202",
"addressLocality": "Salem",
"addressRegion": "OR",
"postalCode": "97302",
"addressCountry": "US"
},
"telephone": "+15033397483",
"location": {
"@type": "Place",
"geo": {
"@type": "GeoCoordinates",
"latitude": 44.9139521313258,
"longitude": -123.04602277136532
}
},
"sameAs": [
"https://www.instagram.com/arthur_murray_salem/",
"https://www.facebook.com/AMDSSalem/"
],
"areaServed": {
"@type": "City",
"name": ["Salem", "Albany", "Keizer"]
},
"priceRange": "$$$",
"openingHoursSpecification": [
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": ["Monday", "Tuesday", "Wednesday", "Thursday", "Friday"],
"opens": "12:00",
"closes": "22:00"
},
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "Saturday",
"opens": "9:00",
"closes": "18:00"
}
],
"aggregateRating": {
"@type": "AggregateRating",
"ratingValue": "4.9",
"reviewCount": "33"
},
"review": [
{
"@type": "Review",
"author": {
"@type": "Person",
"name": "Dale Bales"
},
"reviewBody": "We've been dancing at Arthur Murray for the past year and we have loved every minute of it. Dancing has brought us closer as a couple and given us a fun activity to do together. The staff is nice and ve
Open service 35.157.26.135:443 · smartacademyia.org
2026-01-13 00:28
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 32414
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:28:29 GMT
Etag: "679af0dd717e5de1aeaff04183f572a7-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC23MXZ3BX41Q92V3TJ7M6
Connection: close
Page title: SmartAcademy.ia | La Mayor Librería de Prompts
<!DOCTYPE html>
<html lang="es" data-theme="light">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<meta name="description" content="Plataforma líder en ingeniería de prompts educativos.">
<title>SmartAcademy.ia | La Mayor Librería de Prompts</title>
<link href="https://fonts.googleapis.com/css2?family=Outfit:wght@300;400;500;600;700;800&display=swap" rel="stylesheet">
<link href="https://unpkg.com/aos@2.3.1/dist/aos.css" rel="stylesheet">
<link href="https://cdn.jsdelivr.net/npm/remixicon@3.5.0/fonts/remixicon.css" rel="stylesheet">
<style>
/* --- VARIABLES & THEME --- */
:root {
--primary: #4f46e5; --primary-dark: #4338ca;
--bg: #f8fafc; --card: #ffffff; --text: #0f172a; --text-light: #64748b;
--border: #e2e8f0; --shadow: 0 10px 30px -10px rgba(0,0,0,0.1);
--max-width: 1200px;
--gradient: linear-gradient(135deg, #4f46e5 0%, #ec4899 100%);
}
[data-theme="dark"] {
--bg: #0f172a; --card: #1e293b; --text: #f1f5f9; --text-light: #94a3b8;
--border: #334155; --shadow: 0 20px 50px -12px rgba(0,0,0,0.5);
}
* { box-sizing: border-box; transition: all 0.3s ease; scroll-behavior: smooth; }
body { font-family: 'Outfit', sans-serif; margin: 0; background: var(--bg); color: var(--text); overflow-x: hidden; }
.container-center { max-width: var(--max-width); margin: 0 auto; padding: 0 20px; width: 100%; }
/* --- NAVBAR --- */
nav {
background: rgba(255,255,255,0.9); backdrop-filter: blur(10px);
border-bottom: 1px solid var(--border); height: 70px; display: flex; align-items: center;
position: sticky; top: 0; z-index: 999;
}
.nav-content { display: flex; justify-content: space-between; align-items: center; }
.logo { font-weight: 800; font-size: 1.4rem; background: var(--gradient); -webkit-background-clip: text; -webkit-text-fill-color: transparent; text-decoration: none; display: flex; gap: 8px; align-items: center; }
.btn-icon { background: var(--card); border: 1px solid var(--border); padding: 8px 12px; border-radius: 10px; cursor: pointer; color: var(--text); display: flex; align-items: center; gap: 5px; }
.btn-icon:hover { border-color: var(--primary); color: var(--primary); }
/* --- HERO --- */
.hero-section { padding: 80px 0 60px; text-align: center; position: relative; }
.blob { position: absolute; border-radius: 50%; filter: blur(90px); opacity: 0.25; z-index: -1; }
.b1 { top: -100px; left: -100px; width: 500px; height: 500px; background: #4f46e5; animation: float 8s infinite alternate; }
.b2 { bottom: 0; right: -100px; width: 400px; height: 400px; background: #ec4899; animation: float 10s infinite alternate-reverse; }
.hero-title { font-size: 3.5rem; margin-bottom: 20px; font-weight: 800; line-height: 1.1; letter-spacing: -1.5px; }
.hero-desc { font-size: 1.2rem; color: var(--text-light); max-width: 600px; margin: 0 auto 40px; }
/* Stats & Builder */
.stats-bar { display: inline-flex; gap: 40px; background: var(--card); padding: 20px 40px; border-radius: 20px; box-shadow: var(--shadow); border: 1px solid var(--border); margin-bottom: 50px; flex-wrap: wrap; justify-content: center; }
.stat-item h3 { margin: 0; font-size: 1.8rem; color: var(--primary); font-weight: 800; }
.stat-item p { margin: 0; font-size: 0.8rem; color: var(--text-light); text-transform: uppercase; letter-spacing: 1px; }
.builder-box { background: var(--card); border-radius: 24px; padding: 40px; max-width: 800px; margin: 0 auto; box-shadow: var(--shadow); border: 1px solid var(--border); text-align: left; }
.builder-grid { display: grid; grid-template-columns: repeat(auto-fit, minmax(200px, 1fr)); gap: 20px; margin-bottom: 20px; }
label { display:
Open service 35.157.26.135:80 · smartacademyia.org
2026-01-13 00:28
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:28:37 GMT Location: https://smartacademyia.org/ Server: Netlify X-Nf-Request-Id: 01KETC2B67P1VR3VHDRX3MKX4P Content-Length: 42 Connection: close Redirecting to https://smartacademyia.org/
Open service 35.157.26.135:443 · zeoxzhang.com
2026-01-13 00:28
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 2098
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:28:18 GMT
Etag: "18f17dd27a81497b8a928b1e73f6cc33-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC1RRE5QKDFCRZ8AX5Z26N
Connection: close
Page title: Zeo - Creative Personal Portfolio
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/png" href="assets\images\ZeoSignTransparent.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<meta name="description" content="Zeo - Creative Personal Portfolio" />
<meta name="keywords" content="personal, portfolio, project manager, software engineer, global operations" />
<meta name="author" content="Zeo" />
<!-- Open Graph / Social Media Preview -->
<meta property="og:type" content="website" />
<meta property="og:title" content="Zeo - Creative Personal Portfolio" />
<meta property="og:description" content="Project Manager & Software Engineer" />
<meta property="og:image" content="/assets/images/og-cat.svg" />
<meta property="og:image:width" content="1200" />
<meta property="og:image:height" content="630" />
<!-- Twitter Card -->
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:title" content="Zeo - Creative Personal Portfolio" />
<meta name="twitter:description" content="Project Manager & Software Engineer" />
<meta name="twitter:image" content="/assets/images/og-cat.svg" />
<title>Zeo - Creative Personal Portfolio</title>
<!-- Google Fonts -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=DM+Sans:ital,opsz,wght@0,9..40,100..1000;1,9..40,100..1000&display=swap" rel="stylesheet">
<!-- CSS from public folder -->
<link rel="stylesheet" href="/assets/css/bootstrap.min.css">
<link rel="stylesheet" href="/assets/css/style.css">
<link rel="stylesheet" href="/assets/css/spacing.css">
<link rel="stylesheet" href="/assets/css/responsive.css">
<script type="module" crossorigin src="/assets/index-Dm1HtS3D.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-EmM056jX.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · zeoxzhang.com
2026-01-13 00:28
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:28:27 GMT Location: https://zeoxzhang.com/ Server: Netlify X-Nf-Request-Id: 01KETC21ABP859CBYNVVNQRC8K Content-Length: 37 Connection: close Redirecting to https://zeoxzhang.com/
Open service 35.157.26.135:443 · flowcafe.gr
2026-01-13 00:27
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 784 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:28:01 GMT Etag: "8e4ecd648f256193a1713f8df47036dd-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETC18724Q5K596CDZN31T7H Connection: close Page title: FLOW | HANDMADE PIES & COFFEE <!doctype html><html lang="en"><head><meta charset="utf-8"/><link rel="icon" href="./PublicImages/tab-logo.png"/><meta name="viewport" content="width=device-width,initial-scale=1"/><meta name="theme-color" content="#000000"/><meta name="description" content="Web site created using create-react-app"/><link href="https://unpkg.com/boxicons@2.1.4/css/boxicons.min.css" rel="stylesheet"/><link rel="stylesheet" href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/4.7.0/css/font-awesome.min.css"/><title>FLOW | HANDMADE PIES & COFFEE</title><script defer="defer" src="/static/js/main.55efe0a9.js"></script><link href="/static/css/main.24c8dd82.css" rel="stylesheet"></head><body><noscript>You need to enable JavaScript to run this app.</noscript><div id="root"></div></body></html>
Open service 35.157.26.135:80 · flowcafe.gr
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:28:09 GMT Location: https://flowcafe.gr/ Server: Netlify X-Nf-Request-Id: 01KETC1G45VH3E8WT1H9BBRF5S Content-Length: 35 Connection: close Redirecting to https://flowcafe.gr/
Open service 35.157.26.135:80 · voiture-hs.fr
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:53 GMT Location: https://voiture-hs.fr/ Server: Netlify X-Nf-Request-Id: 01KETC1004K2DZX0K1WJFY1RHT Content-Length: 37 Connection: close Redirecting to https://voiture-hs.fr/
Open service 35.157.26.135:443 · voiture-hs.fr
2026-01-13 00:27
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 4156
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:27:45 GMT
Etag: "ae0f241e6922faea1916a5ec0d86c65b-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC0R7BPAP802BTHB6SP4NG
Connection: close
<!doctype html>
<html lang="fr">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- Essential meta (non-SEO) -->
<meta name="author" content="voiture-hs.fr" />
<meta name="theme-color" content="#1E293B" />
<meta name="geo.region" content="FR-IDF" />
<meta name="geo.placename" content="Villejuif, Île-de-France" />
<!-- Favicon -->
<link rel="icon" href="/favicon.svg" type="image/svg+xml" />
<link rel="apple-touch-icon" href="/favicon.svg" />
<!-- Manifest -->
<link rel="manifest" href="/manifest.json" />
<!-- Critical CSS inline for above-the-fold content -->
<style>
/* Critical CSS - Fonts */
@font-face {
font-family: 'Inter';
font-style: normal;
font-weight: 400;
font-display: swap;
src: local('Inter Regular'), local('Inter-Regular'),
url('/fonts/inter-regular.woff2') format('woff2');
}
@font-face {
font-family: 'Inter';
font-style: normal;
font-weight: 500;
font-display: swap;
src: local('Inter Medium'), local('Inter-Medium'),
url('/fonts/inter-medium.woff2') format('woff2');
}
@font-face {
font-family: 'Inter';
font-style: normal;
font-weight: 600;
font-display: swap;
src: local('Inter SemiBold'), local('Inter-SemiBold'),
url('/fonts/inter-semibold.woff2') format('woff2');
}
@font-face {
font-family: 'DM Sans';
font-style: normal;
font-weight: 500;
font-display: swap;
src: local('DM Sans Medium'), local('DMSans-Medium'),
url('/fonts/dm-sans-medium.woff2') format('woff2');
}
@font-face {
font-family: 'DM Sans';
font-style: normal;
font-weight: 700;
font-display: swap;
src: local('DM Sans Bold'), local('DMSans-Bold'),
url('/fonts/dm-sans-bold.woff2') format('woff2');
}
/* Critical CSS for initial render */
*,*::before,*::after{box-sizing:border-box;border-width:0;border-style:solid}
html{line-height:1.5;-webkit-text-size-adjust:100%;scroll-behavior:smooth}
body{margin:0;font-family:'Inter',system-ui,-apple-system,sans-serif;-webkit-font-smoothing:antialiased;-moz-osx-font-smoothing:grayscale;background-color:hsl(216 33% 97%);color:hsl(221 39% 11%)}
#root{min-height:100vh;display:flex;flex-direction:column}
h1,h2,h3,h4,h5,h6{font-family:'DM Sans',system-ui,sans-serif;font-weight:700}
/* Prevent CLS from font loading */
.font-display{font-family:'DM Sans',system-ui,sans-serif}
/* Hero section critical styles */
.gradient-hero{background:linear-gradient(135deg,hsl(221 39% 11%) 0%,hsl(221 39% 16%) 100%)}
/* Loading state */
.loading-skeleton{background:linear-gradient(90deg,hsl(220 14% 91%) 25%,hsl(220 14% 96%) 50%,hsl(220 14% 91%) 75%);background-size:200% 100%;animation:shimmer 1.5s infinite}
@keyframes shimmer{0%{background-position:200% 0}100%{background-position:-200% 0}}
/* Header styles */
header{position:sticky;top:0;z-index:50;background-color:hsl(221 39% 17%);max-height:70px}
/* Button critical styles */
.btn-primary{display:inline-flex;align-items:center;justify-content:center;background-color:hsl(221 83% 53%);color:white;font-weight:600;border-radius:0.5rem;transition:background-color 0.2s}
.btn-primary:hover{background-color:hsl(221 39% 17%)}
</style>
<script type="module" crossorigin src="/assets/index-DZPk0zjd.js"></script>
<link rel="modulepreload" crossorigin href="/assets/vendor-react-NYwmtz3H.js">
<link rel="modulepreload" crossorigin href="/assets/vendor-ui-CsYXbLIs.js">
<link rel="modulepreload" crossorigin href="/assets/vendor-query-o-bRdi1v.js">
<link rel="modulepreload" crossorigin href="/assets/vendor-motion-4ObKA54w.js">
<link rel="stylesheet" crossorigin href="/assets/index-e3yuP1W1.css">
<
Open service 35.157.26.135:80 · tinyhouselistings.com
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:42 GMT Location: https://tinyhouselistings.com/ Server: Netlify X-Nf-Request-Id: 01KETC0NM2EC67SC7FAX9M4KKY Content-Length: 45 Connection: close Redirecting to https://tinyhouselistings.com/
Open service 35.157.26.135:443 · safteynet.app
2026-01-13 00:27
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 50182
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:27:21 GMT
Etag: "5971f65c11fc54bc08e39be34fd3f406-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETC00T6KQQFVEMHVJYRAE73
X-Robots-Tag: noindex
Connection: close
Page title: Finance Office Portal
<!DOCTYPE HTML>
<html>
<head>
<title>Finance Office Portal</title>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1, user-scalable=no" />
<meta name="description" content="Banking and dfs finance to help you invest and get investments">
<meta name="keywords" content="global financial services,money,mortgage,pay,invest,bank,finance,financial planning jobs,credit card,loans">
<link rel="icon" type="image/png" href="favicon.png">
<link rel="stylesheet" href="/assets/css/main.min.css">
<noscript><link rel="stylesheet" href="/assets/css/noscript.min.css" /></noscript>
</head>
<body class="is-preload">
<div id="wrapper" class="divided">
<section class="banner style1 orient-left content-align-center image-position-right onload-content-fade-up onload-image-fade-in invert color1 fullscreen">
<div class="content">
<h1>Undergoing a transformation. We'll be back before you know it!</h1>
<form method="post" action="#">
<div class="fields">
<div class="field">
<label for="name">Password</label>
<input type="password" name="pass" value="" />
</div>
<div class="field ">
<a href="#" class="button ">Check it out</a>
</div>
</div>
</form>
</div>
<div class="image">
<img src="images/image.jpg"/>
</div>
</section>
<div hidden>
Holistic Financial Strategy Blending investment, Tax, Estate Planning & Insurance Advice
Comprehensive Financial Advice Tailored To You
As fee-based fiduciaries, we are legally & ethically bound to act in your best interest
</div>
<div style="height: 0; padding: 0; overflow: hidden;">
<p>
Finance is a term for matters regarding the management, creation, and study of money and investments.[1] Specifically, it deals with the questions of how and why an individual, company or government acquires the money needed – called capital in the company context – and how they spend or invest that money.[2] Finance is then often split into the following major categories: corporate finance, personal finance and public finance.[1]. . At the same time, and correspondingly, finance is about the overall "system" [1] – i.e., the financial markets that allow the flow of money, via investments and other financial instruments, between and within these areas; this "flow" is facilitated by the financial services sector. A major focus within finance is thus investment management – called money management for individuals, and asset management for institutions – and finance then includes the associated activities of securities trading and stock broking, investment banking, financial engineering, and risk management.. . Given its wide scope, finance is studied in several academic disciplines, and, correspondingly, there are several related professional qualifications that can lead to the field.. . The financial system consists of the flows of capital that take place between individuals (personal finance), governments (public finance), and businesses (corporate finance). Although they are closely related, the disciplines of economics and finance are distinct. The "economy" is a social institution that organizes a society's production, distribution, and consumption of goods and services, all of which must be financed.. . In general, an entity whose income exceeds its expenditure can lend or invest the excess, intending to earn a fair return. Correspondingly, an entity where income is less than expenditure can raise capital usually in one of two ways: (i) by borrowing, in the form of a loan (private individuals), or by selling bonds (may be government bonds or corporate bonds); (ii) by a corporate selling equity, also called stock or shares (may take various forms: preferred stock or common stock). The owners of both bonds and stock may be instituti
Open service 35.157.26.135:80 · safteynet.app
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:29 GMT Location: https://safteynet.app/ Server: Netlify X-Nf-Request-Id: 01KETC08FGNT05B9YNCH2Z1J3E Content-Length: 37 Connection: close Redirecting to https://safteynet.app/
Open service 35.157.26.135:443 · velixantechnologies.com
2026-01-13 00:27
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1501
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:27:11 GMT
Etag: "e2ce5faf9407a71a7504084cda3dc0c6-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBZPSHBHSZC7Y72VY30NHY
Connection: close
Page title: Velixan Technologies Inc. | Custom Software Development
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Velixan Technologies Inc. | Custom Software Development</title>
<meta name="description" content="Building the Future of Digital. Your partner in custom software development, from concept to launch. Web Development, Mobile Apps, AI/ML Solutions." />
<meta name="author" content="Velixan Technologies Inc." />
<meta property="og:title" content="Velixan Technologies Inc. | Custom Software Development" />
<meta property="og:description" content="Building the Future of Digital. Your partner in custom software development, from concept to launch." />
<meta property="og:type" content="website" />
<meta property="og:image" content="/placeholder.svg" />
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:site" content="@VelixanTech" />
<meta name="twitter:image" content="/placeholder.svg" />
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600;700;800&display=swap" rel="stylesheet">
<script type="module" crossorigin src="/assets/index-BkIZdN9B.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CPzU43kt.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.velixantechnologies.com
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:10 GMT Location: https://velixantechnologies.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBZPE5TGBJVHMBJENR88GE Content-Length: 47 Connection: close Redirecting to https://velixantechnologies.com/
Open service 35.157.26.135:80 · velixantechnologies.com
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:18 GMT Location: https://velixantechnologies.com/ Server: Netlify X-Nf-Request-Id: 01KETBZXWAPB4B7NVT1QHRV9Y6 Content-Length: 47 Connection: close Redirecting to https://velixantechnologies.com/
Open service 35.157.26.135:80 · www.velixantechnologies.com
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:18 GMT Location: https://www.velixantechnologies.com/ Server: Netlify X-Nf-Request-Id: 01KETBZXZM75FXEWQY2B4BH8VX Content-Length: 51 Connection: close Redirecting to https://www.velixantechnologies.com/
Open service 35.157.26.135:443 · waxwondersindia.com
2026-01-13 00:27
HTTP/1.1 404 Not Found
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3449
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:27:09 GMT
Etag: 1765606291-ssl
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBZNMJM249X51WRFAH8SVC
Connection: close
Page title: Page not found
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Page not found</title>
<style>
:root {
--colorRgbFacetsTeal600: 2 128 125;
--colorTealAction: var(--colorRgbFacetsTeal600);
--colorRgbFacetsNeutralLight200: 233 235 237;
--colorHr: var(--colorRgbFacetsNeutralLight200);
--colorRgbFacetsNeutralLight700: 53 58 62;
--colorGrayDarkest: var(--colorRgbFacetsNeutralLight700);
--colorGrayLighter: var(--colorRgbFacetsNeutralLight200);
--colorText: var(--colorGrayDarkest);
--effectShadowLightShallow: 0 1px 10px 0 rgb(53 58 62 / 6%),
0 2px 4px 0 rgb(53 58 62 / 8%);
--colorRgbFacetsNeutralDark900: 6 11 16;
}
body {
font-family: system-ui, -apple-system, BlinkMacSystemFont, "Segoe UI",
Roboto, Helvetica, Arial, sans-serif, "Apple Color Emoji",
"Segoe UI Emoji", "Segoe UI Symbol";
background: white;
overflow: hidden;
margin: 0;
padding: 0;
line-height: 1.5;
color: rgb(var(--colorText));
}
@media (prefers-color-scheme: dark) {
body {
background: rgb(var(--colorRgbFacetsNeutralDark900));
}
}
h1 {
margin: 0;
font-size: 1.375rem;
line-height: 1;
}
h1 + p {
margin-top: 8px;
}
.main {
position: relative;
display: flex;
flex-direction: column;
align-items: center;
justify-content: center;
height: 100vh;
width: 100vw;
}
.card {
position: relative;
width: 75%;
max-width: 364px;
padding: 24px;
background: white;
border-radius: 8px;
box-shadow: var(--effectShadowLightShallow);
border: 1px solid rgb(var(--colorGrayLighter));
}
a {
margin: 0;
font-weight: 600;
color: rgb(var(--colorTealAction));
text-decoration-skip-ink: all;
text-decoration-thickness: 1px;
text-underline-offset: 2px;
text-decoration-color: rgb(var(--colorTealAction) / 0.5);
transition: text-decoration-color 0.15s ease-in-out;
}
a:hover,
a:focus-visible {
text-decoration-color: rgb(var(--colorTealAction));
}
p:last-of-type {
margin-bottom: 0;
}
hr {
border: 0;
height: 1px;
background: rgb(var(--colorHr));
margin-top: 16px;
margin-bottom: 16px;
}
.your-site {
font-size: 0.875rem;
}
</style>
</head>
<body>
<div class="main">
<div class="card">
<h1>Page not found</h1>
<p>
Looks like you’ve followed a broken link or entered a URL that doesn’t
exist on this site.
</p>
<hr />
<p class="your-site">
If this is your site, and you weren’t expecting a 404 for this path,
please visit Netlify’s
<a
href="https://answers.netlify.com/t/support-guide-i-ve-deployed-my-site-but-i-still-see-page-not-found/125?utm_source=404page&utm_campaign=community_tracking"
>“page not found” support guide</a
>
for troubleshooting tips.
</p>
</div>
</div>
</body>
</html>
Open service 35.157.26.135:80 · www.waxwondersindia.com
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:17 GMT Location: https://www.waxwondersindia.com/ Server: Netlify X-Nf-Request-Id: 01KETBZX7HWN3298K5F1EQ56R6 Content-Length: 47 Connection: close Redirecting to https://www.waxwondersindia.com/
Open service 35.157.26.135:80 · waxwondersindia.com
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:17 GMT Location: https://waxwondersindia.com/ Server: Netlify X-Nf-Request-Id: 01KETBZX6EXM9ABJQQ3M73R9XQ Content-Length: 43 Connection: close Redirecting to https://waxwondersindia.com/
Open service 35.157.26.135:443 · www.waxwondersindia.com
2026-01-13 00:27
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:08 GMT Location: https://waxwondersindia.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBZMMMZ6XF0CD35ZGR4R6A Content-Length: 43 Connection: close Redirecting to https://waxwondersindia.com/
Open service 35.157.26.135:80 · chrisworthgroup.com
2026-01-13 00:26
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:27:06 GMT Location: https://chrisworthgroup.com/ Server: Netlify X-Nf-Request-Id: 01KETBZJHQQ4SPEZCD4Z9SHNBP Content-Length: 43 Connection: close Redirecting to https://chrisworthgroup.com/
Open service 35.157.26.135:443 · chrisworthgroup.com
2026-01-13 00:26
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1538
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:26:57 GMT
Etag: "0276db53e708884450d244f2d69f51a8-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBZ9VQ15NT1MMGKT4RJ0Z7
Connection: close
Page title: Chrisworth Group
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Chrisworth Group</title>
<meta name="description" content="The permanent solution to plumbing leakages in Nigeria. Chrisworth multilayer pipes eliminate leaks, rust, and pressure failure. Offices in Abuja & Lagos." />
<meta name="keywords" content="plumbing Nigeria, multilayer pipes, PEX pipes, water pipes Abuja, water pipes Lagos, no leak pipes, Chrisworth" />
<meta name="author" content="Chrisworthgroup" />
<meta name="robots" content="index, follow" />
<link rel="canonical" href="https://chrisworthgroup.com" />
<!-- Open Graph -->
<meta property="og:title" content="Chrisworth Piping System | Premium Plumbing Solutions" />
<meta property="og:description" content="The permanent solution to plumbing leakages in Nigeria. Premium multilayer pipes that eliminate leaks, rust, and pressure failure." />
<meta property="og:type" content="website" />
<meta property="og:locale" content="en_NG" />
<meta property="og:image" content="#" />
<!-- <meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:site" content="@Chrisworth" />
<meta name="twitter:image" content="#" /> -->
<script type="module" crossorigin src="/assets/index-CuQB9HB1.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-AsX5D8X5.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · bestcryptoswap.com
2026-01-13 00:26
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:26:56 GMT Location: https://bestcryptoswap.com/ Server: Netlify X-Nf-Request-Id: 01KETBZ8J005Z9GJ4R9FRCE745 Content-Length: 42 Connection: close Redirecting to https://bestcryptoswap.com/
Open service 35.157.26.135:443 · bestcryptoswap.com
2026-01-13 00:26
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 36343
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:26:46 GMT
Etag: "d74c267442dfefd8bd3b085bf08c733d-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBYZ8CKGNY9KCHNYFF976M
Connection: close
Page title: BestCrypto Swap | GhostSwap-Powered Cross-Chain DEX Aggregator
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8">
<title>BestCrypto Swap | GhostSwap-Powered Cross-Chain DEX Aggregator</title>
<meta name="description" content="BestCrypto Swap is a GhostSwap-aligned DEX meta aggregator that routes swaps to ghostswap.io for deep liquidity, low slippage, and cross-chain coverage.">
<meta name="keywords" content="GhostSwap, BestCrypto Swap, crypto swap, DEX aggregator, cross-chain swaps, low slippage, defi">
<meta name="viewport" content="width=device-width,initial-scale=1">
<meta name="msvalidate.01" content="9F140B3C613C1EA3781671851F1591D6" />
<link rel="canonical" href="https://bestcryptoswap.com/">
<link rel="icon" href="assets/favicon.svg" type="image/svg+xml">
<meta property="og:title" content="BestCrypto Swap | GhostSwap-Powered Cross-Chain DEX Aggregator">
<meta property="og:description" content="Execute the best crypto swap routes with GhostSwap liquidity baked in. Built for speed, security, and SEO-perfect discoverability.">
<meta property="og:type" content="website">
<meta property="og:url" content="https://bestcryptoswap.com/">
<meta property="og:image" content="https://bestcryptoswap.com/assets/logo.svg">
<meta name="twitter:card" content="summary_large_image">
<meta name="twitter:title" content="BestCrypto Swap">
<meta name="twitter:description" content="GhostSwap-connected routing, optimized UX, and transparent pricing for every swap.">
<link rel="stylesheet" href="assets/styles.css">
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "Organization",
"name": "BestCrypto Swap",
"url": "https://bestcryptoswap.com",
"logo": "https://bestcryptoswap.com/assets/logo.svg",
"sameAs": [
"https://ghostswap.io"
]
}
</script>
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "WebSite",
"name": "BestCrypto Swap",
"url": "https://bestcryptoswap.com",
"potentialAction": {
"@type": "SearchAction",
"target": "https://bestcryptoswap.com/blog/?q={search_term_string}",
"query-input": "required name=search_term_string"
}
}
</script>
</head>
<body>
<div class="page">
<div class="glow a"></div>
<div class="glow b"></div>
<header>
<div class="container nav">
<a class="brand" href="#">
<img src="assets/logo.svg" alt="BestCrypto Swap logo">
<span>BestCrypto Swap</span>
</a>
<nav class="nav-links">
<a href="features/">Features</a>
<a href="markets/">Markets</a>
<a href="exchange/">Exchange</a>
<a href="live-data/">Live Data</a>
<a href="blog/">Blog</a>
<a href="faq/">FAQ</a>
</nav>
<a class="btn primary" href="https://ghostswap.io" target="_blank" rel="noreferrer noopener">Launch on GhostSwap</a>
</div>
</header>
<main class="container">
<section class="hero">
<div class="hero-grid">
<div>
<div class="eyebrow">
<svg viewBox="0 0 24 24" fill="currentColor" aria-hidden="true">
<path d="M12 2 2 7v10l10 5 10-5V7L12 2zm0 2.18L19.5 8 12 11.82 4.5 8 12 4.18zM4 9.35l7 3.5v6.97L4 16.3V9.35zm9 10.47v-6.97l7-3.5v6.95l-7 3.52z"/>
</svg>
GhostSwap-backed liquidity · BestCrypto brand
</div>
<h1>BestCrypto Swap fuels <span class="accent">every trade</span> with GhostSwap depth.</h1>
<p class="lead">A fast, SEO-perfect landing page and experience that forwards every swap into GhostSwap rails for slippage-resistant execution. New brand, same battle-tested engine.</p>
<div class="cta-row">
<a class="btn primary" href="https://ghostswap.io/exchange" target="_blank" rel="noreferrer noopener">Start Swapping on GhostSwap</a>
<a class="btn ghost" href="https://ghostswap.io" target="_blank" rel="noreferrer noopener">GhostSwap Core</a>
</div>
<div class="cta-note">All routes are comp
Open service 35.157.26.135:443 · panetonesecia.site
2026-01-13 00:26
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 204582
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:26:12 GMT
Etag: "ea8e8b506c3c98d425da07f20088d2c4-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBXY1ZHVZR9T6PEH0V92BA
Connection: close
Page title: Fature no Natal Ganhe Dinheiro com artigos natalinosFature no Natal Ganhe Dinheiro com artigos natalinos
<!DOCTYPE html><html lang="pt-BR"><head>
<meta charset="UTF-8">
<title>Fature no Natal Ganhe Dinheiro com artigos natalinos</title>
<meta name="viewport" content="width=device-width, initial-scale=1">
<meta name="robots" content="max-image-preview:large">
<style>img:is([sizes="auto" i], [sizes^="auto," i]) { contain-intrinsic-size: 3000px 1500px }</style>
<title>Fature no Natal Ganhe Dinheiro com artigos natalinos</title>
<link rel="alternate" type="application/rss+xml" title="Feed para Fature no Natal " href="https://www.setimonivel.com/faturenonatal/feed/">
<link rel="alternate" type="application/rss+xml" title="Feed de comentários para Fature no Natal " href="https://www.setimonivel.com/faturenonatal/comments/feed/">
<script>
window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/16.0.1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/16.0.1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.setimonivel.com\/faturenonatal\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.8.3"}};
/*! This file is auto-generated */
!function(s,n){var o,i,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),a=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===a[t]})}function u(e,t){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);for(var n=e.getImageData(16,16,1,1),a=0;a<n.data.length;a++)if(0!==n.data[a])return!1;return!0}function f(e,t,n,a){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\udde8\ud83c\uddf6","\ud83c\udde8\u200b\ud83c\uddf6")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!a(e,"\ud83e\udedf")}return!1}function g(e,t,n,a){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):s.createElement("canvas"),o=r.getContext("2d",{willReadFrequently:!0}),i=(o.textBaseline="top",o.font="600 32px Arial",{});return e.forEach(function(e){i[e]=t(o,e,n,a)}),i}function t(e){var t=s.createElement("script");t.src=e,t.defer=!0,s.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",i=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){s.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+g.toString()+"("+[JSON.stringify(i),f.toString(),p.toString(),u.toString()].join(",")+"));",a=new Blob([e],{type:"text/javascript"}),r=new Worker(URL.createObjectURL(a),{name:"wpTestEmojiSupports"});return void(r.onmessage=function(e){c(n=e.data),r.terminate(),t(n)})}catch(e){}c(n=g(i,f,p,u))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t
Open service 35.157.26.135:80 · panetonesecia.site
2026-01-13 00:26
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:26:21 GMT Location: https://panetonesecia.site/ Server: Netlify X-Nf-Request-Id: 01KETBY5ZX5PR724MGNGFVKXXZ Content-Length: 42 Connection: close Redirecting to https://panetonesecia.site/
Open service 35.157.26.135:80 · directorioia.com.ar
2026-01-13 00:26
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:26:14 GMT Location: https://directorioia.com.ar/ Server: Netlify X-Nf-Request-Id: 01KETBXZ70RVWM4G87A1CJDT3G Content-Length: 43 Connection: close Redirecting to https://directorioia.com.ar/
Open service 35.157.26.135:443 · directorioia.com.ar
2026-01-13 00:26
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1430749
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:26:05 GMT
Etag: "4d596ae8ad41c9fc2b62a944cd85f2bb-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBXPYHHSN78ZSJ2WG35KCK
Connection: close
Page title: Directorio IA: Encuentra tu mejor herramienta 2026
<!DOCTYPE html><html lang="es" class="dark"> <head><meta charset="utf-8"><meta name="google-site-verification" content="Dnv-Yd3IEPR3c7u4WKLnk3w0naQkA-1KoWMdtHHQnas"><meta content="width=device-width, initial-scale=1.0" name="viewport"><title>Directorio IA: Encuentra tu mejor herramienta 2026</title><script type="module" src="/_astro/Layout.astro_astro_type_script_index_0_lang.DlsCMEsi.js"></script><link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600;700&display=swap" rel="stylesheet"><link href="https://fonts.googleapis.com/icon?family=Material+Icons" rel="stylesheet"><style>.line-clamp-2[data-astro-cid-j7pv25f6]{display:-webkit-box;-webkit-line-clamp:2;-webkit-box-orient:vertical;overflow:hidden}.grupo-btn[data-astro-cid-j7pv25f6].active{pointer-events:none;cursor:default}@media(max-width:640px){.flex-wrap[data-astro-cid-j7pv25f6]{gap:.5rem;justify-content:flex-start;overflow-x:auto;padding-bottom:10px;white-space:nowrap;display:flex;flex-wrap:nowrap;-webkit-overflow-scrolling:touch}.grupo-btn[data-astro-cid-j7pv25f6]{flex-shrink:0}}
</style>
<link rel="stylesheet" href="/_astro/contacto.DDONLhrx.css"></head><body class="bg-[#0B1120] font-['Inter',sans-serif] antialiased min-h-screen flex flex-col"> <main class="w-full max-w-7xl mx-auto px-4 sm:px-6 lg:px-8 py-16 grow" data-astro-cid-j7pv25f6> <div class="text-center mb-12 sm:mb-20" data-astro-cid-j7pv25f6> <h1 class="text-4xl sm:text-5xl font-extrabold tracking-tight mb-4" data-astro-cid-j7pv25f6> <span class="bg-clip-text text-transparent bg-linear-to-r from-blue-500 to-teal-400" data-astro-cid-j7pv25f6>
Explora el Mundo de la IA
</span> </h1> <p class="text-lg sm:text-xl text-gray-600 dark:text-gray-400 font-light max-w-2xl mx-auto" data-astro-cid-j7pv25f6>
Más de 900 herramientas seleccionadas para potenciar tu trabajo
</p> </div> <div class="flex flex-wrap justify-center gap-3 mb-12" data-astro-cid-j7pv25f6> <button onclick="filtrarGrupo('todas', this)" class="grupo-btn active px-6 py-2 rounded-full text-sm font-bold border border-blue-500 bg-blue-500 text-white transition-all shadow-lg shadow-blue-900/20" data-astro-cid-j7pv25f6>
Todas
</button> <button onclick="filtrarGrupo('Generación de Imágenes Artísticas,IA para Retoque Fotográfico Profesional,Generadores de Logos y Branding,IA para Generar Tipografías,Restauración de Fotos Antiguas,IA para Diseño de Interiores,Generadores de Paletas de Colores,IA para Crear Íconos y Vectores', this)" class="grupo-btn px-6 py-2 rounded-full text-sm font-bold border border-gray-700 text-gray-400 hover:border-blue-500 hover:text-blue-500 transition-all bg-[#0B1120]" data-astro-cid-j7pv25f6> Imagen </button><button onclick="filtrarGrupo('Edición de Video Automática para Shorts,IA para Clonación de Rostros (Deepfake),Generadores de Avatares para YouTube,IA para Quitar Objetos de Videos,Generadores de Video a partir de Texto,IA para Subtitulado Multilingüe,Mejora de Resolución de Video (Upscaling),Animación de Fotos Estáticas', this)" class="grupo-btn px-6 py-2 rounded-full text-sm font-bold border border-gray-700 text-gray-400 hover:border-blue-500 hover:text-blue-500 transition-all bg-[#0B1120]" data-astro-cid-j7pv25f6> Video </button><button onclick="filtrarGrupo('Redacción de Artículos para Blogs,IA para Guiones de YouTube y TikTok,Herramientas de Copywriting para Ads,Correctores Estilísticos Avanzados,Optimización de Contenido para SEO,IA para Resumir Libros y PDFs,Generadores de Nombres de Marca,IA para Escribir Libros de Ficción', this)" class="grupo-btn px-6 py-2 rounded-full text-sm font-bold border border-gray-700 text-gray-400 hover:border-blue-500 hover:text-blue-500 transition-all bg-[#0B1120]" data-astro-cid-j7pv25f6> Escritura </button><button onclick="filtrarGrupo('Copilotos para Programadores Python,IA para Generar Código Frontend (React/Vue),Convertidores de Lenguajes de Programación,IA para Crear Consultas SQL,Generadores de Documentación de Código,IA para Testeo Automático de Software,Creadores de Sitios Web con IA,IA para Análisis de Ciberseguridad', this)
Open service 35.157.26.135:80 · bnoma.com
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:56 GMT Location: https://bnoma.com/ Server: Netlify X-Nf-Request-Id: 01KETBXE7V0TSK616GT8JXK9JY Content-Length: 33 Connection: close Redirecting to https://bnoma.com/
Open service 35.157.26.135:80 · www.loganindustry.com
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:53 GMT Location: https://www.loganindustry.com/ Server: Netlify X-Nf-Request-Id: 01KETBXB4G3A3XQ156J7J16C20 Content-Length: 45 Connection: close Redirecting to https://www.loganindustry.com/
Open service 35.157.26.135:443 · www.loganindustry.com
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:44 GMT Location: https://loganindustry.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBX2CM7JKTHJQJC02KDDN2 Content-Length: 41 Connection: close Redirecting to https://loganindustry.com/
Open service 35.157.26.135:80 · quiz-ai.progreslab.net
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:27 GMT Location: https://quiz-ai.progreslab.net/ Server: Netlify X-Nf-Request-Id: 01KETBWHHZ6Q8835HDW29WRSJ3 Content-Length: 46 Connection: close Redirecting to https://quiz-ai.progreslab.net/
Open service 35.157.26.135:443 · quiz-ai.progreslab.net
2026-01-13 00:25
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1524
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:25:18 GMT
Etag: "a4e86d068b086b5e2b4b54aeeed13751-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBW8V4BZ9ZX6JPZS4Y9GA3
Connection: close
Page title: Twój Wynik AI - Quiz Dojrzałości AI | ProgresLab
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/png" href="/favicon.png" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Twój Wynik AI - Quiz Dojrzałości AI | ProgresLab</title>
<meta name="description" content="Sprawdź swój poziom dojrzałości AI i odbierz spersonalizowany raport od ProgresLab." />
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website" />
<meta property="og:url" content="https://quiz.progreslab.net/" />
<meta property="og:title" content="Sprawdź swój poziom dojrzałości AI | ProgresLab" />
<meta property="og:description" content="Rozwiąż quiz i dowiedz się, na jakim etapie adopcji AI jest Twoja firma." />
<meta property="og:image" content="/social-share.jpg" />
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image" />
<meta property="twitter:url" content="https://quiz.progreslab.net/" />
<meta property="twitter:title" content="Sprawdź swój poziom dojrzałości AI | ProgresLab" />
<meta property="twitter:description" content="Rozwiąż quiz i dowiedz się, na jakim etapie adopcji AI jest Twoja firma." />
<meta property="twitter:image" content="/social-share.jpg" />
<script type="module" crossorigin src="/assets/index-oVxb_Xam.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CBKovheS.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · loganindustry.com
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:24 GMT Location: https://loganindustry.com/ Server: Netlify X-Nf-Request-Id: 01KETBWEBCD589344QRXJVMXJ7 Content-Length: 41 Connection: close Redirecting to https://loganindustry.com/
Open service 35.157.26.135:443 · loganindustry.com
2026-01-13 00:25
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 86862
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:25:15 GMT
Etag: "8807ce29c483ee240b63709b275deae6-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBW6CF6EEMH16QS5CR0P28
Connection: close
Page title: Logan Industry
<!--
███████╗██╗ ██╗███╗ ██╗██╗ ██╗██╗ ██╗ █████╗ ██╗ ██╗███████╗
██╔════╝██║ ██║████╗ ██║██║ ██╔╝██║ ██║██╔══██╗██║ ██║██╔════╝
█████╗ ██║ ██║██╔██╗ ██║█████╔╝ ███████║███████║██║ ██║███████╗
██╔══╝ ██║ ██║██║╚██╗██║██╔═██╗ ██╔══██║██╔══██║██║ ██║╚════██║
██║ ╚██████╔╝██║ ╚████║██║ ██╗██║ ██║██║ ██║╚██████╔╝███████║
╚═╝ ╚═════╝ ╚═╝ ╚═══╝╚═╝ ╚═╝╚═╝ ╚═╝╚═╝ ╚═╝ ╚═════╝ ╚══════╝
www.funkhaus.us
-->
<!doctype html>
<html data-n-head-ssr lang="en" data-n-head="%7B%22lang%22:%7B%22ssr%22:%22en%22%7D%7D">
<head>
<title>Logan Industry</title><meta data-n-head="ssr" charset="utf-8"><meta data-n-head="ssr" name="viewport" content="width=device-width,initial-scale=1"><meta data-n-head="ssr" property="og:url" content="https://loganindustry.com/"><meta data-n-head="ssr" property="og:site_name" content="Logan Industry"><meta data-n-head="ssr" property="og:type" content="website"><meta data-n-head="ssr" data-hid="description" name="description" property="og:description" content="Built with a multi-national collective motivated to craft narratives and content with an ageless approach: to tell human stories organically."><meta data-n-head="ssr" data-hid="og:image" property="og:image" content="https://api.loganindustry.com/wp-content/themes/loganindustry-backend/screenshot.png"><meta data-n-head="ssr" data-hid="og:title" property="og:title" content="Logan Industry"><link data-n-head="ssr" rel="icon" type="image/x-icon" href="/favicon.png"><link rel="preload" href="/_nuxt/d7d989f.js" as="script"><link rel="preload" href="/_nuxt/bef29b9.js" as="script"><link rel="preload" href="/_nuxt/cd23cc0.js" as="script"><link rel="preload" href="/_nuxt/78895f7.js" as="script"><link rel="preload" href="/_nuxt/75beb39.js" as="script"><style data-vue-ssr-id="b6b2f088:0 44e936f8:0 7cb78fcc:0 2721f277:0 019e1cef:0 52a21104:0 d7836a2c:0 6a1d1abb:0 3a6704eb:0 5fd63b62:0 7a851386:0 c64c4436:0 e0aa5f56:0 dd4b882a:0 5411a2f9:0 187d7095:0 883a505c:0 27235506:0 095cb185:0 7464f030:0">:root{--color-white:#fff;--color-black:#000;--color-grey:#666;--color-loading:var(--color-white);--unit-100vh:100vh;--unit-gap:60px;--unit-gutter:100px;--font-primary:"Avenir Pro Condensed",sans-serif;--font-secondary:"Barques",sans-serif}@media only screen and (max-width:750px){:root{--unit-gap:10px;--unit-gutter:20px}}
body{font-family:var(--font-primary);font-size:16px;color:var(--color-black);background-color:var(--color-white);margin:0;-webkit-font-smoothing:antialiased;-moz-osx-font-smoothing:grayscale;font-feature-settings:"kern" 1,"kern";-webkit-font-kerning:normal;font-kerning:normal;background:var(--color-black);overscroll-behavior-y:none}::-moz-selection{color:var(--color-white);background:var(--color-black)}::selection{color:var(--color-white);background:var(--color-black)}::-webkit-scrollbar{display:none;width:0}h1,h2,h3,h4,h5{font-weight:400}a{text-decoration:none;color:inherit;transition:color .4s}button{-webkit-appearance:none;-moz-appearance:none;appearance:none;border:none;background-color:transparent;cursor:pointer;outline:none;margin:0}.title .line{display:block}.overlay{position:absolute;bottom:0;right:0;left:0;top:0;background:rgba(0,0,0,.3)}.page{overflow:hidden;z-index:100}.footer{z-index:200}.header{z-index:300}.menu-main,.panel-menu{z-index:400}.global-hamburger,.global-logo{z-index:500}.entry{margin:80px auto;text-align:center}.entry,.entry a{co
Open service 35.157.26.135:443 · www.halisaha.art
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:13 GMT Location: https://halisaha.art/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBW4607ADHTXJVVA6BJRDR Content-Length: 36 Connection: close Redirecting to https://halisaha.art/
Open service 35.157.26.135:80 · www.halisaha.art
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:21 GMT Location: https://www.halisaha.art/ Server: Netlify X-Nf-Request-Id: 01KETBWBZZX74J5P40YV78RVP2 Content-Length: 40 Connection: close Redirecting to https://www.halisaha.art/
Open service 35.157.26.135:443 · pumpashelter.org
2026-01-13 00:25
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 8453
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:25:02 GMT
Etag: "19539c433b211ea7bdf9942e4863ec75-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBVSJZ9N8R4N2XMT2GEE1E
Connection: close
Page title: $PAWS | Pump A Worthy Shelter
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width,initial-scale=1" />
<title>$PAWS | Pump A Worthy Shelter</title>
<link rel="icon" type="image/png" href="paw_logo.png">
<link href="https://cdnjs.cloudflare.com/ajax/libs/font-awesome/6.4.0/css/all.min.css" rel="stylesheet">
<style>
:root{--accent:#ff6b6b;--accent-dark:#e66757;--bg1:#fff5e1;--bg2:#ffde9e}
html,body{height:100%}
body{margin:0;font-family:Inter,system-ui,Arial,sans-serif;background:linear-gradient(135deg,var(--bg2),var(--bg1));color:#222;text-align:center;display:flex;flex-direction:column}
header{background:linear-gradient(90deg,#ffb347,#ff7f50);color:white;padding:28px 16px;box-shadow:0 4px 12px rgba(0,0,0,0.08)}
.container{max-width:1100px;margin:20px auto;padding:0 16px;flex:1}
.hero{padding:28px 0}
.logo{height:120px;width:120px;object-fit:contain;border-radius:18px;background:white;padding:10px;display:inline-block}
h1{margin:14px 0 6px;font-size:34px}
p.lead{margin:0 0 12px;color:#3b2f2f;opacity:0.95}
.cta{margin:14px 0}
.btn{display:inline-block;padding:12px 24px;background:var(--accent);color:#fff;border-radius:12px;text-decoration:none;font-weight:700;box-shadow:0 8px 18px rgba(255,107,107,0.18);transition:all .18s}
.btn:hover{transform:translateY(-3px);box-shadow:0 18px 30px rgba(0,0,0,0.08)}
.btn.disabled{background:#bbb;cursor:not-allowed;box-shadow:none;opacity:0.95}
.meta{margin-top:8px;color:#5a4b4b;font-size:14px}
.grid{display:grid;grid-template-columns:1fr 420px;gap:24px;align-items:start;margin-top:28px}
.card{background:white;border-radius:14px;padding:18px;box-shadow:0 6px 18px rgba(0,0,0,0.06);text-align:left}
.card h3{margin:0 0 8px;font-size:18px}
iframe{width:100%;height:300px;border-radius:10px;border:none}
.socials{text-align:center;margin-top:18px}
.socials a{display:inline-flex;align-items:center;gap:8px;padding:10px 14px;margin:6px;border-radius:10px;background:var(--accent);color:#fff;text-decoration:none;font-weight:600}
.socials a.secondary{background:#4da3ff}
.tracker{height:16px;background:#f0f0f0;border-radius:12px;overflow:hidden;margin-top:10px}
.tracker .fill{height:100%;width:0%;background:var(--accent);transition:width .6s ease}
footer{padding:18px 8px;background:#2f2b2b;color:white;font-size:13px;border-top:1px solid rgba(255,255,255,0.03);margin-top:28px}
@media (max-width:880px){.grid{grid-template-columns:1fr} .logo{height:96px;width:96px} h1{font-size:26px}}
</style>
</head>
<body>
<header>
<div class="container">
<div style="display:flex;align-items:center;gap:16px;justify-content:center;">
<img class="logo" src="paw_logo.png" alt="$PAWS logo">
<div style="text-align:left;">
<div style="font-weight:800;font-size:20px">PAWS <span style="font-weight:600;color:white;opacity:0.9;">| Pump A Worthy Shelter</span></div>
<div style="color:rgba(255,255,255,0.95);margin-top:6px;font-size:14px">Every pump saves a pup — meme coin with a mission</div>
</div>
</div>
</div>
</header>
<main class="container">
<section class="hero">
<img src="paw_logo.png" alt="$PAWS logo" class="logo" style="height:150px;width:150px;">
<h1>$PAWS — Pump A Worthy Shelter</h1>
<p class="lead">Meme coin with a heartbeat. A % of trades funds real animal shelters. Join the pack.</p>
<div class="cta">
<a id="buyBtn" class="btn disabled" href="#" target="_blank" rel="noopener">🚀 Launching Soon</a>
</div>
<div id="countdown" class="meta">Countdown: loading...</div>
</section>
<div class="grid" role="region" aria-label="Main content">
<div>
<div class="card">
<h3><i class="fa-solid fa-chart-line"></i> Live Chart</h3>
<iframe src="https://dexscreener.com/solana" title="Dexscreener chart"></iframe>
<div style="margin-top:12px;font-size:14px;color:#5a4b4b">Track the trade live. Add to your watchlist on
Open service 35.157.26.135:80 · pumpashelter.org
2026-01-13 00:25
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:10 GMT Location: https://pumpashelter.org/ Server: Netlify X-Nf-Request-Id: 01KETBW0SCJKCCPZ8RXXY5J8M2 Content-Length: 40 Connection: close Redirecting to https://pumpashelter.org/
Open service 35.157.26.135:80 · www.nexgenlabs.site
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:10 GMT Location: https://www.nexgenlabs.site/ Server: Netlify X-Nf-Request-Id: 01KETBW0VTQMQCW3CYA1BEZZQN Content-Length: 43 Connection: close Redirecting to https://www.nexgenlabs.site/
Open service 35.157.26.135:443 · www.nexgenlabs.site
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:25:01 GMT Location: https://nexgenlabs.site/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBVR5YTENDND1DG4GEJ5TA Content-Length: 39 Connection: close Redirecting to https://nexgenlabs.site/
Open service 35.157.26.135:443 · www.tensortribe.in
2026-01-13 00:24
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 31141
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:24:47 GMT
Etag: "5077b9a9cf572296721c252d7ff8c1fb-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBVAHWMFWXE4TF7TXHGEX3
Connection: close
Page title: TensorTribe
<!DOCTYPE html>
<html lang="en">
<head>
<title>TensorTribe</title>
<link rel="icon" href="images/Logos/Event_logo(Black)[PNG].png" type="image/gif" sizes="16x16">
<meta content="text/html;charset=utf-8" http-equiv="Content-Type">
<meta content="width=device-width, initial-scale=1.0" name="viewport" >
<meta content="width=device-width, initial-scale=1.0" name="viewport" >
<meta content="" name="keywords" >
<!-- CSS Files
================================================== -->
<!-- Font Awesome -->
<link href="https://use.fontawesome.com/releases/v5.3.1/css/all.css" rel="stylesheet" />
<!-- ALL MIN CSS -->
<link rel="stylesheet" href="assets/css/all.min.css">
<!-- File Normalization -->
<link rel="stylesheet" href="assets/css/normalize.css">
<link href="css/bootstrap.min.css" rel="stylesheet" type="text/css" id="bootstrap">
<link href="css/plugins.css" rel="stylesheet" type="text/css" >
<link href="css/swiper.css" rel="stylesheet" type="text/css" >
<link href="css/style.css" rel="stylesheet" type="text/css" >
<link href="css/coloring.css" rel="stylesheet" type="text/css" >
<!-- color scheme -->
<link id="colors" href="css/colors/scheme-01.css" rel="stylesheet" type="text/css" >
<style>
#space-background {
position: absolute;
top: 0;
left: 0;
width: 100%;
height: 100%;
z-index: -1; /* Keeps it behind the content */
pointer-events: none; /* Prevents interactions with background */
}
/* Reveal Section Styling */
.reveal-section {
position: relative;
overflow: hidden;
text-align: center;
perspective: 1000px;
display: flex;
flex-direction: column;
align-items: center;
justify-content: center;
height: 100vh;
}
/* Background Animation */
#particles-js {
position: absolute;
top: 0;
left: 0;
width: 100%;
height: 100%;
z-index: 0;
}
/* College Logo & Text */
.college-info {
position: relative;
z-index: 1;
display: flex;
flex-direction: column;
align-items: center;
gap: 10px;
margin-bottom: 20px;
opacity: 1; /* Start hidden for animation */
}
.college-logo {
height: 150px;;
max-width: 100%;
}
.college-text {
background: linear-gradient(var(--gradient-text));
-webkit-background-clip: text;
-webkit-text-fill-color: transparent;
font-size: 2.9rem;
font-weight: bold;
text-align: center;
line-height: 1.3;
}
</style>
</head>
<body class="dark-scheme">
<div id="wrapper">
<div class="float-text show-on-scroll">
<span><a href="#">Scroll to top</a></span>
</div>
<div class="scrollbar-v show-on-scroll"></div>
<!-- page preloader begin -->
<div id="de-loader"></div>
<!-- page preloader close -->
<!-- header begin -->
<header class="transparent">
<div class="container">
<div class="row">
<div class="col-md-12">
<div class="de-flex sm-pt10">
<div class="de-flex-col">
<div class="de-flex-col">
<!-- logo begin -->
<div id="logo">
<a href='/'>
<img class="logo-main"
src="images/Logos/Event_logo(PNG)1.png
" alt>
<img class="logo-mobile"
src="images/Logos/logo-mobile.png"
alt>
</a>
</div>
<!-- logo close -->
</div>
Open service 35.157.26.135:80 · www.tensortribe.in
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:55 GMT Location: https://www.tensortribe.in/ Server: Netlify X-Nf-Request-Id: 01KETBVJ4X63RFB7SKZ04BH2D5 Content-Length: 42 Connection: close Redirecting to https://www.tensortribe.in/
Open service 35.157.26.135:443 · gentlesaintbernardpuppies.com
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:27 GMT Location: https://www.gentlesaintbernardpuppies.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBTPT9NVF962C4VVKMMN2G Content-Length: 57 Connection: close Redirecting to https://www.gentlesaintbernardpuppies.com/
Open service 35.157.26.135:80 · gentlesaintbernardpuppies.com
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:35 GMT Location: https://gentlesaintbernardpuppies.com/ Server: Netlify X-Nf-Request-Id: 01KETBTZCM850V26W03FJAGMTW Content-Length: 53 Connection: close Redirecting to https://gentlesaintbernardpuppies.com/
Open service 35.157.26.135:443 · optiloyalty.com
2026-01-13 00:24
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1924
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:24:19 GMT
Etag: "cd56e9008db8732458026a7d2f1a7375-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBTF8R5S5Y9T9QB1TTEWNK
Connection: close
Page title: Opti AI CRM - Turn Your Customer List Into a Revenue Machine
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/CCDC5F83-C335-49A5-9836-0CD763C630C9.PNG" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<link href="https://fonts.googleapis.com/css2?family=Afacad:wght@400;500;600;700&display=swap" rel="stylesheet">
<title>Opti AI CRM - Turn Your Customer List Into a Revenue Machine</title>
<meta name="description" content="Stop losing money on missed follow-ups. Our AI-powered CRM system automates customer management, increases repeat sales by 50%, and turns your customer list into a 24/7 revenue-generating machine.">
<meta name="keywords" content="AI CRM, customer management, sales automation, revenue optimization, customer retention, business automation">
<!-- Open Graph / Facebook -->
<meta property="og:type" content="website">
<meta property="og:url" content="https://optiaisolutions.co">
<meta property="og:title" content="Opti AI CRM - Turn Your Customer List Into a Revenue Machine">
<meta property="og:description" content="Stop losing money on missed follow-ups. Our AI-powered CRM system automates customer management and increases repeat sales by 50%.">
<!-- Twitter -->
<meta property="twitter:card" content="summary_large_image">
<meta property="twitter:url" content="https://optiaisolutions.co">
<meta property="twitter:title" content="Opti AI CRM - Turn Your Customer List Into a Revenue Machine">
<meta property="twitter:description" content="Stop losing money on missed follow-ups. Our AI-powered CRM system automates customer management and increases repeat sales by 50%.">
<script type="module" crossorigin src="/assets/index-CUbxstAX.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-PZXdIea7.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · www.optiloyalty.com
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:20 GMT Location: https://optiloyalty.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBTFTN9Q52WB6AKTCEG9WV Content-Length: 39 Connection: close Redirecting to https://optiloyalty.com/
Open service 35.157.26.135:80 · optiloyalty.com
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:27 GMT Location: https://optiloyalty.com/ Server: Netlify X-Nf-Request-Id: 01KETBTPYG365APNXYGDD240AV Content-Length: 39 Connection: close Redirecting to https://optiloyalty.com/
Open service 35.157.26.135:80 · www.optiloyalty.com
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:27 GMT Location: https://www.optiloyalty.com/ Server: Netlify X-Nf-Request-Id: 01KETBTPY5VPWNB92PESQ1Y70X Content-Length: 43 Connection: close Redirecting to https://www.optiloyalty.com/
Open service 35.157.26.135:80 · www.laserwareaero.com
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:13 GMT Location: https://www.laserwareaero.com/ Server: Netlify X-Nf-Request-Id: 01KETBT9KEYDM80NYHK3078T3P Content-Length: 45 Connection: close Redirecting to https://www.laserwareaero.com/
Open service 35.157.26.135:443 · www.laserwareaero.com
2026-01-13 00:24
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:04 GMT Location: https://laserwareaero.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBT0HN2WY34S8DMRKEEMZ2 Content-Length: 41 Connection: close Redirecting to https://laserwareaero.com/
Open service 35.157.26.135:443 · alpha.inprodwetest.com
2026-01-13 00:23
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 25816
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:23:53 GMT
Etag: "6af895f83600fb2c1d41a1d3792b142e-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBSNWA5D9YVF7ECWSCBC6A
Connection: close
Page title: Welcome to Starlight | My Docs
<!DOCTYPE html><html lang="en" dir="ltr" data-theme="dark" data-has-hero class="astro-bguv2lll"> <head><meta charset="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><title>Welcome to Starlight | My Docs</title><link rel="canonical"/><link rel="shortcut icon" href="/favicon.svg" type="image/svg+xml"/><meta name="generator" content="Astro v5.15.6"/><meta name="generator" content="Starlight v0.36.2"/><meta property="og:title" content="Welcome to Starlight"/><meta property="og:type" content="article"/><meta property="og:url"/><meta property="og:locale" content="en"/><meta property="og:description" content="Get started building your docs site with Starlight."/><meta property="og:site_name" content="My Docs"/><meta name="twitter:card" content="summary_large_image"/><meta name="description" content="Get started building your docs site with Starlight."/><script>
window.StarlightThemeProvider = (() => {
const storedTheme =
typeof localStorage !== 'undefined' && localStorage.getItem('starlight-theme');
const theme =
storedTheme ||
(window.matchMedia('(prefers-color-scheme: light)').matches ? 'light' : 'dark');
document.documentElement.dataset.theme = theme === 'light' ? 'light' : 'dark';
return {
updatePickers(theme = storedTheme || 'auto') {
document.querySelectorAll('starlight-theme-select').forEach((picker) => {
const select = picker.querySelector('select');
if (select) select.value = theme;
/** @type {HTMLTemplateElement | null} */
const tmpl = document.querySelector(`#theme-icons`);
const newIcon = tmpl && tmpl.content.querySelector('.' + theme);
if (newIcon) {
const oldIcon = picker.querySelector('svg.label-icon');
if (oldIcon) {
oldIcon.replaceChildren(...newIcon.cloneNode(true).childNodes);
}
}
});
},
};
})();
</script><template id="theme-icons"><svg aria-hidden="true" class="light astro-c6vsoqas" width="16" height="16" viewBox="0 0 24 24" fill="currentColor" style="--sl-icon-size: 1em;"><path d="M5 12a1 1 0 0 0-1-1H3a1 1 0 0 0 0 2h1a1 1 0 0 0 1-1Zm.64 5-.71.71a1 1 0 0 0 0 1.41 1 1 0 0 0 1.41 0l.71-.71A1 1 0 0 0 5.64 17ZM12 5a1 1 0 0 0 1-1V3a1 1 0 0 0-2 0v1a1 1 0 0 0 1 1Zm5.66 2.34a1 1 0 0 0 .7-.29l.71-.71a1 1 0 1 0-1.41-1.41l-.66.71a1 1 0 0 0 0 1.41 1 1 0 0 0 .66.29Zm-12-.29a1 1 0 0 0 1.41 0 1 1 0 0 0 0-1.41l-.71-.71a1.004 1.004 0 1 0-1.43 1.41l.73.71ZM21 11h-1a1 1 0 0 0 0 2h1a1 1 0 0 0 0-2Zm-2.64 6A1 1 0 0 0 17 18.36l.71.71a1 1 0 0 0 1.41 0 1 1 0 0 0 0-1.41l-.76-.66ZM12 6.5a5.5 5.5 0 1 0 5.5 5.5A5.51 5.51 0 0 0 12 6.5Zm0 9a3.5 3.5 0 1 1 0-7 3.5 3.5 0 0 1 0 7Zm0 3.5a1 1 0 0 0-1 1v1a1 1 0 0 0 2 0v-1a1 1 0 0 0-1-1Z"/></svg><svg aria-hidden="true" class="dark astro-c6vsoqas" width="16" height="16" viewBox="0 0 24 24" fill="currentColor" style="--sl-icon-size: 1em;"><path d="M21.64 13a1 1 0 0 0-1.05-.14 8.049 8.049 0 0 1-3.37.73 8.15 8.15 0 0 1-8.14-8.1 8.59 8.59 0 0 1 .25-2A1 1 0 0 0 8 2.36a10.14 10.14 0 1 0 14 11.69 1 1 0 0 0-.36-1.05Zm-9.5 6.69A8.14 8.14 0 0 1 7.08 5.22v.27a10.15 10.15 0 0 0 10.14 10.14 9.784 9.784 0 0 0 2.1-.22 8.11 8.11 0 0 1-7.18 4.32v-.04Z"/></svg><svg aria-hidden="true" class="auto astro-c6vsoqas" width="16" height="16" viewBox="0 0 24 24" fill="currentColor" style="--sl-icon-size: 1em;"><path d="M21 14h-1V7a3 3 0 0 0-3-3H7a3 3 0 0 0-3 3v7H3a1 1 0 0 0-1 1v2a3 3 0 0 0 3 3h14a3 3 0 0 0 3-3v-2a1 1 0 0 0-1-1ZM6 7a1 1 0 0 1 1-1h10a1 1 0 0 1 1 1v7H6V7Zm14 10a1 1 0 0 1-1 1H5a1 1 0 0 1-1-1v-1h16v1Z"/></svg></template><link rel="stylesheet" href="/_astro/print.DNXP8c50.css" media="print"><link rel="stylesheet" href="/_astro/index.BK102pm3.css">
<style>@layer starlight.components{:root{--sl-badge-default-border: var(--sl-color-accent);--sl-badge-default-bg: var(--sl-color-accent-low);--sl-badge-default-text: #fff;--sl-badge-note-border: var(--sl-color-blue);--sl-badge-note-bg: var(--sl-color-blue-low);--sl-badge-note-text: #fff;--sl-badge-danger-border: var(--sl-color-red);--sl-badge-danger-bg: var(--sl-color-red-low);--sl-badge-danger-text: #fff;--sl-badge-success-border: var(--sl-color-
Open service 35.157.26.135:80 · alpha.inprodwetest.com
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:01 GMT Location: https://alpha.inprodwetest.com/ Server: Netlify X-Nf-Request-Id: 01KETBSXJPZD16PHTY23B9K5YT Content-Length: 46 Connection: close Redirecting to https://alpha.inprodwetest.com/
Open service 35.157.26.135:443 · scanbrand.co
2026-01-13 00:23
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 26428
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:23:53 GMT
Etag: "ee690ecfc80869721790c17dc332d685-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBSNKNAADYAR591KX448H3
Connection: close
Page title: ScanBrand Website
<!DOCTYPE html>
<html lang="es" class="scroll-smooth">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>ScanBrand Website</title>
<script src="https://cdn.tailwindcss.com"></script>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;600;700;800&display=swap" rel="stylesheet">
<style>
/* Estilos base corporativos */
body {
font-family: 'Inter', sans-serif;
background-color: #f7fafc;
}
/* Estilos de botones */
.btn {
padding: 0.75rem 1.5rem;
font-weight: 600;
border-radius: 9999px;
transition-property: all;
transition-duration: 300ms;
transform-property: transform;
font-size: 1rem;
}
.btn-primary {
background-color: #4f46e5; /* Indigo fuerte */
color: white;
box-shadow: 0 4px 15px rgba(79, 70, 229, 0.4);
}
.btn-primary:hover {
background-color: #4338ca;
transform: translateY(-2px);
box-shadow: 0 6px 20px rgba(79, 70, 229, 0.6);
}
.btn-secondary {
background-color: white;
color: #4f46e5;
border: 2px solid #4f46e5;
}
.btn-secondary:hover {
background-color: #eef2ff;
color: #4f46e5;
transform: translateY(-2px);
}
/* Animación para carga */
.pulse {
animation: pulse 2s cubic-bezier(0.4, 0, 0.6, 1) infinite;
}
@keyframes pulse {
0%, 100% { opacity: 1; }
50% { opacity: .5; }
}
/* Estilos para el modal */
.modal-overlay {
position: fixed;
top: 0;
left: 0;
width: 100%;
height: 100%;
background-color: rgba(17, 24, 39, 0.8); /* Gris oscuro semi-transparente */
display: flex;
justify-content: center;
align-items: center;
z-index: 100;
}
.modal-content {
position: relative;
background-color: white;
padding: 2.5rem;
border-radius: 1rem;
box-shadow: 0 25px 50px -12px rgba(0, 0, 0, 0.25);
max-width: 90%;
width: 550px;
}
/* Iconos SVG personalizados para la sección de Aliados */
.partner-icon {
color: #4f46e5;
width: 3rem;
height: 3rem;
margin-bottom: 1rem;
}
</style>
</head>
<body class="bg-gray-50 min-h-screen font-sans antialiased">
<!-- Encabezado y navegación -->
<header class="fixed w-full z-50 top-0 left-0 bg-white shadow-xl py-3 md:py-4">
<nav class="container mx-auto px-4 sm:px-6 lg:px-8 flex flex-col md:flex-row justify-between items-center space-y-4 md:space-y-0">
<a href="#" class="text-3xl font-extrabold text-gray-900 tracking-tight">Scan<span class="text-indigo-600">Brand</span></a>
<div class="flex items-center w-full md:w-auto space-x-3 md:space-x-6">
<!-- Navegación principal -->
<a href="#our-process" class="text-gray-600 hover:text-indigo-600 font-medium transition duration-200 hidden sm:block">Proceso</a>
<a href="#case-studies" class="text-gray-600 hover:text-indigo-600 font-medium transition duration-200 hidden sm:block">Casos</a>
<a href="#partners" class="text-indigo-600 hover:text-indigo-700 font-bold transition duration-200">Aliados</a>
<!-- Botón de Contacto (en el header) -->
<button id="contact-button" class="btn btn-primary px-5 py-2">
Contáctenos
</button>
</div>
</nav>
</header>
<!-- Hero Section con Escaneo de Valor -
Open service 35.157.26.135:80 · scanbrand.co
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:24:00 GMT Location: https://scanbrand.co/ Server: Netlify X-Nf-Request-Id: 01KETBSX2YFXQNCA3WJBX8AVNB Content-Length: 36 Connection: close Redirecting to https://scanbrand.co/
Open service 35.157.26.135:443 · www.razzorbackprintsanddesign.com
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:42 GMT Location: https://razzorbackprintsanddesign.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBSAWGFV08V6GB4FW8TWS9 Content-Length: 53 Connection: close Redirecting to https://razzorbackprintsanddesign.com/
Open service 35.157.26.135:80 · www.razzorbackprintsanddesign.com
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:50 GMT Location: https://www.razzorbackprintsanddesign.com/ Server: Netlify X-Nf-Request-Id: 01KETBSJRA3SEJ9CBZWG0AHFVB Content-Length: 57 Connection: close Redirecting to https://www.razzorbackprintsanddesign.com/
Open service 35.157.26.135:443 · www.builddigital.com.au
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:42 GMT Location: https://builddigital.com.au/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBSBBWN8R3R28XE8DPXEKX Content-Length: 43 Connection: close Redirecting to https://builddigital.com.au/
Open service 35.157.26.135:80 · www.builddigital.com.au
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:50 GMT Location: https://www.builddigital.com.au/ Server: Netlify X-Nf-Request-Id: 01KETBSJVN202AE5KK6436Y4RP Content-Length: 47 Connection: close Redirecting to https://www.builddigital.com.au/
Open service 35.157.26.135:80 · www.lukemoody.ai
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:40 GMT Location: https://www.lukemoody.ai/ Server: Netlify X-Nf-Request-Id: 01KETBS8WKCPP0NTFTDKQCRWGG Content-Length: 40 Connection: close Redirecting to https://www.lukemoody.ai/
Open service 35.157.26.135:443 · www.lukemoody.ai
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:31 GMT Location: https://lukemoody.ai/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBS05FV03WA58Z4BDT5P45 Content-Length: 36 Connection: close Redirecting to https://lukemoody.ai/
Open service 35.157.26.135:443 · image.mlprint.com.au
2026-01-13 00:23
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 305 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:23:30 GMT Etag: "0174102d0a767e09439221b99f4cd775-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBRZVKGDYBAWBKTVX7MNYK Connection: close Page title: ML Print Images <!DOCTYPE html> <html> <head> <meta name="robots" content="noindex, nofollow" charset="utf-8"> <title>ML Print Images</title> </head> <body> <h2>ML Print Image Hosting</h2> <p>This site is used to host images for email signatures and documents.</p> <p>Domain: mlprint.com.au</p> </body> </html>
Open service 35.157.26.135:80 · image.mlprint.com.au
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:38 GMT Location: https://image.mlprint.com.au/ Server: Netlify X-Nf-Request-Id: 01KETBS7EXTAM2MYCB071NKAW9 Content-Length: 44 Connection: close Redirecting to https://image.mlprint.com.au/
Open service 35.157.26.135:443 · wow.inprodwetest.com
2026-01-13 00:23
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 4957
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:23:21 GMT
Etag: "bb91820bafd4573bea119a2fea7dcadd-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBRPD7HK02BV3SZ6703B1X
Connection: close
Page title: 🌟 hiii
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<meta name="theme-color" content="#000000" />
<title>🌟 hiii</title>
<!-- Google Tag Manager -->
<script>(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':
new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0],
j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src=
'https://www.googletagmanager.com/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);
})(window,document,'script','dataLayer','GTM-5QGMG9FX');</script>
<!-- End Google Tag Manager -->
<!-- 🐐 goat counter -->
<script data-goatcounter="https://brie.goatcounter.com/count"
async src="//gc.zgo.at/count.js"></script>
<!-- 🥚 crazy egg -->
<script type="text/javascript" src="//script.crazyegg.com/pages/scripts/0131/3896.js" async="async"></script>
<script type="module" crossorigin src="/assets/index-DElvpebG.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-BGxXKYeD.css">
</head>
<body>
<!-- Google Tag Manager (noscript) -->
<noscript><iframe src="https://www.googletagmanager.com/ns.html?id=GTM-5QGMG9FX"
height="0" width="0" style="display:none;visibility:hidden"></iframe></noscript>
<!-- End Google Tag Manager (noscript) -->
<noscript>You need to enable JavaScript to run this app.</noscript>
<div id="root"></div>
<!-- After adding this script, call setConsentBannerParams({uuid: <unique id> }) to set unique ID for a customer. -->
<!-- remove the script below to use ONLY GTM -->
<!-- After adding this script, call setConsentBannerParams({uuid: <unique id> }) to set unique ID for a customer. -->
<!--
<script>
(function () {
var s = document.createElement('script');
s.src = 'https://cdn-prod.securiti.ai/consent/cookie-consent-sdk-loader.js';
s.setAttribute('data-tenant-uuid', 'faad8916-af48-44fc-b205-0433d115c295');
s.setAttribute('data-domain-uuid', 'ea4865bd-343d-4ceb-aa63-1382ba81f257');
s.setAttribute('data-backend-url', 'https://app.securiti.ai');
s.setAttribute('data-skip-css', 'false');
s.defer = true;
var parent_node = document.head || document.body;
parent_node.appendChild(s);
})()
</script>
-->
<script>
!function(t,e){var o,n,p,r;e.__SV||(window.posthog && window.posthog.__loaded)||(window.posthog=e,e._i=[],e.init=function(i,s,a){function g(t,e){var o=e.split(".");2==o.length&&(t=t[o[0]],e=o[1]),t[e]=function(){t.push([e].concat(Array.prototype.slice.call(arguments,0)))}}(p=t.createElement("script")).type="text/javascript",p.crossOrigin="anonymous",p.async=!0,p.src=s.api_host.replace(".i.posthog.com","-assets.i.posthog.com")+"/static/array.js",(r=t.getElementsByTagName("script")[0]).parentNode.insertBefore(p,r);var u=e;for(void 0!==a?u=e[a]=[]:a="posthog",u.people=u.people||[],u.toString=function(t){var e="posthog";return"posthog"!==a&&(e+="."+a),t||(e+=" (stub)"),e},u.people.toString=function(){return u.toString(1)+".people (stub)"},o="init Rr Mr fi Cr Ar ci Tr Fr capture Mi calculateEventProperties Lr register register_once register_for_session unregister unregister_for_session Hr getFeatureFlag getFeatureFlagPayload isFeatureEnabled reloadFeatureFlags updateEarlyAccessFeatureEnrollment getEarlyAccessFeatures on onFeatureFlags onSurveysLoaded onSessionId getSurveys getActiveMatchingSurveys renderSurvey displaySurvey canRenderSurvey canRenderSurveyAsync identify setPersonProperties group resetGroups setPersonPropertiesForFlags resetPersonPropertiesForFlags setGroupPropertiesForFlags resetGroupPropertiesForFlags reset get_distinct_id getGroups get_session_id get_session_replay_url alias set_config startSessionRecording stopSessionRecording sessionRecordingStarted captureException loadToolbar get_property getSessionProperty Ur jr createPersonProfile zr kr Br opt_in_capturing opt_out_capturing has_opted_in_capturing has_opted_out_capturing get_explicit_consent_status is_capturing clear_opt_in_out_capturing Dr debug M Nr getPageViewId captureTraceFeedback captureTraceMetric $r".split(" "),n=0;n
Open service 35.157.26.135:80 · wow.inprodwetest.com
2026-01-13 00:23
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:28 GMT Location: https://wow.inprodwetest.com/ Server: Netlify X-Nf-Request-Id: 01KETBRXFANH9PA5B7P4QRYK7F Content-Length: 44 Connection: close Redirecting to https://wow.inprodwetest.com/
Open service 35.157.26.135:80 · gradac.ba
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:03 GMT Location: https://gradac.ba/ Server: Netlify X-Nf-Request-Id: 01KETBR53B0FG920FTHXZS0YZ4 Content-Length: 33 Connection: close Redirecting to https://gradac.ba/
Open service 35.157.26.135:443 · gradac.ba
2026-01-13 00:22
HTTP/1.1 200 OK Age: 11588 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 51160 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:56 GMT Etag: "c344hcggkk13f3" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: RSC,Next-Router-State-Tree,Next-Router-Prefetch,Accept-Encoding X-Content-Type-Options: nosniff X-Nextjs-Date: Tue, 13 Jan 2026 00:22:53 GMT X-Nf-Request-Id: 01KETBQY2AE67DR589YSXY6A3S X-Powered-By: Next.js Connection: close Page title: Learn design, coding, web tools, and get inspired! <!DOCTYPE html><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="stylesheet" href="/_next/static/css/794711d77109f528.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-f7c9b11e1546b22e.js"/><script src="/_next/static/chunks/fd9d1056-b11b2651f33aae7f.js" async=""></script><script src="/_next/static/chunks/117-ac426705b1056d05.js" async=""></script><script src="/_next/static/chunks/main-app-f1e2f05f66ca4fbd.js" async=""></script><script src="/_next/static/chunks/110-5341545da557509c.js" async=""></script><script src="/_next/static/chunks/972-2d26ddfb969cf3aa.js" async=""></script><script src="/_next/static/chunks/953-cade8d3f21896745.js" async=""></script><script src="/_next/static/chunks/app/page-85977f7a7ba00970.js" async=""></script><script src="/_next/static/chunks/app/layout-f9d2fc44d55bd795.js" async=""></script><script async="" src="https://identity.netlify.com/v1/netlify-identity-widget.js"></script><link rel="icon" type="image/svg+xml" href="/favicon.svg"/><title>Learn design, coding, web tools, and get inspired!</title><meta name="description" content="Discover the best tools and ideas to improve your design and web skills. Find useful resources to learn design, coding, and web tools, and get inspired."/><meta property="og:title" content="Learn design, coding, web tools, and get inspired!"/><meta property="og:description" content="Discover the best tools and ideas to improve your design and web skills. Find useful resources to learn design, coding, and web tools, and get inspired."/><meta property="og:url" content="https://design-code.tips/"/><meta property="og:site_name" content="design-code.tips"/><meta property="og:image" content="https://design-code.tips/og-card.png"/><meta property="og:image:width" content="1600"/><meta property="og:image:height" content="800"/><meta property="og:image:alt" content="design-code.tips"/><meta property="og:image:type" content="image/jpeg"/><meta name="twitter:card" content="summary_large_image"/><meta name="twitter:title" content="Learn design, coding, web tools, and get inspired!"/><meta name="twitter:description" content="Discover the best tools and ideas to improve your design and web skills. Find useful resources to learn design, coding, and web tools, and get inspired."/><meta name="twitter:image" content="https://design-code.tips/og-card.png"/><meta name="twitter:image:width" content="1600"/><meta name="twitter:image:height" content="800"/><meta name="twitter:image:alt" content="design-code.tips"/><meta name="twitter:image:type" content="image/jpeg"/><script src="/_next/static/chunks/polyfills-42372ed130431b0a.js" noModule=""></script></head><body class="flex flex-col h-[100vh] text-slate-900 dark:text-slate-50 dark:bg-slate-900 hyphens-auto"><header class="flex p-4 sm:p-6 fixed w-full z-10 pointer-events-none"><nav class="flex w-full justify-between items-center"><a class="font-bold opacity-80 hover:opacity-100 transition-opacity rounded outline-offset-8 pointer-events-auto" href="/">dc.tips</a><div class="absolute right-0 top-4 sm:top-5 group pointer-events-auto"><button class="p-2 text-xs uppercase font-bold rounded-lg absolute right-4 sm:right-6 z-10 bg-white text-slate-700 dark:bg-slate-300 shadow-md hover:shadow-lg transition-shadow" type="button"><span class="flex gap-2 items-center group text-xs">Menu<svg xmlns="http://www.w3.org/2000/svg" fill="none" viewBox="0 0 24 24" stroke-width="1.5" stroke="currentColor" aria-hidden="true" data-slot="icon" class="size-4"><path stroke-linecap="round" stroke-linejoin="round" d="M3.75 9h16.5m-16.5 6.75h16.5"></path></svg></span></button><div class="hidden"><menu class="min-w-48 flex flex-col absolute right-4 sm:right-6 py-3 bg-white dark:bg-slate-100 rounded-xl shadow-md group-hover:shadow-lg transition-shadow"><li><a class="w-full flex items-center gap-3 p-3 px-6 text-sm tracking-wide text-slate-700 dark:text-slate-700 hover:text-slate-800 dark:hover:text-slate-950 hover:font-semibold tr
Open service 35.157.26.135:443 · www.fringe.travel
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:54 GMT Location: https://fringe.travel/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBQWCMT5YM226PJJ8VKBPQ Content-Length: 37 Connection: close Redirecting to https://fringe.travel/
Open service 35.157.26.135:80 · www.fringe.travel
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:23:02 GMT Location: https://www.fringe.travel/ Server: Netlify X-Nf-Request-Id: 01KETBR44KJTSZAHCSM27PAXMJ Content-Length: 41 Connection: close Redirecting to https://www.fringe.travel/
Open service 35.157.26.135:443 · www.jjmahone.com
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:36 GMT Location: https://jjmahone.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBQAC6VKS06MQNM3FVQCNW Content-Length: 36 Connection: close Redirecting to https://jjmahone.com/
Open service 35.157.26.135:80 · www.jjmahone.com
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:43 GMT Location: https://www.jjmahone.com/ Server: Netlify X-Nf-Request-Id: 01KETBQHDX07SRSNX6CZRY3Y4N Content-Length: 40 Connection: close Redirecting to https://www.jjmahone.com/
Open service 35.157.26.135:443 · findme.gg
2026-01-13 00:22
HTTP/1.1 200 OK Age: 252 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Encoding: gzip Content-Length: 11489 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:34 GMT Etag: "17brb2v46ya1lx4" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: rsc,next-router-state-tree,next-router-prefetch,next-router-segment-prefetch X-Content-Type-Options: nosniff X-Nextjs-Date: Tue, 13 Jan 2026 00:22:32 GMT X-Nextjs-Prerender: 1, 1 X-Nextjs-Stale-Time: 300 X-Nf-Request-Id: 01KETBQ90JYT6KWRN9F5D48EE8 X-Powered-By: Next.js Connection: close Page title: findme.gg - Geolocation Livestream Game <!DOCTYPE html><!--65zSxFKiQyRNVQ5niMqEu--><html lang="en" class="dark"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/797e433ab948586e-s.p.dbea232f.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/caa3a2e1cccd8315-s.p.853070df.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="stylesheet" href="/_next/static/chunks/ab057517c8b61856.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/9a222d335e71e5b6.js"/><script src="/_next/static/chunks/236f7e5abd6f09ff.js" async=""></script><script src="/_next/static/chunks/cc759f7c2413b7ff.js" async=""></script><script src="/_next/static/chunks/47ee4ddfb8cb97c3.js" async=""></script><script src="/_next/static/chunks/turbopack-fa058909c53081a4.js" async=""></script><script src="/_next/static/chunks/2994c2eb5d7a89c9.js" async=""></script><script src="/_next/static/chunks/861a006f5158eda7.js" async=""></script><script src="/_next/static/chunks/2a54615a76580586.js" async=""></script><script src="/_next/static/chunks/ff1a16fafef87110.js" async=""></script><script src="/_next/static/chunks/7340adf74ff47ec0.js" async=""></script><script src="/_next/static/chunks/ac50401995f0f10a.js" async=""></script><meta name="next-size-adjust" content=""/><title>findme.gg - Geolocation Livestream Game</title><meta name="description" content="Join the hunt. Find the location. Win the prize. A free-to-play geolocation challenge."/><link rel="icon" href="/favicon.ico?favicon.0b3bf435.ico" sizes="256x256" type="image/x-icon"/><link rel="icon" href="/icon?eb22bd0ba2242a4e" type="image/png" sizes="32x32"/><link rel="apple-touch-icon" href="/apple-icon?e8104c058c24aaee" type="image/png" sizes="180x180"/><script src="/_next/static/chunks/a6dad97d9634a72d.js" noModule=""></script></head><body class="geist_a71539c9-module__T19VSG__variable geist_mono_8d43a2aa-module__8Li5zG__variable antialiased min-h-screen flex flex-col bg-background font-sans"><div hidden=""><!--$--><!--/$--></div><nav class="sticky top-0 z-50 w-full border-b bg-background/95 backdrop-blur supports-[backdrop-filter]:bg-background/60"><div class="container mx-auto px-4 flex h-16 items-center justify-between"><a class="flex items-center" href="/"><span class="font-extrabold tracking-tight text-xl"><span class="text-foreground">find</span><span class="text-foreground">me</span><span class="text-muted-foreground font-semibold">.gg</span></span></a><div class="hidden md:flex gap-6 items-center"><a class="text-sm font-medium transition-colors hover:text-primary text-primary" href="/">Home</a><a class="text-sm font-medium transition-colors hover:text-primary text-muted-foreground" href="/live">Live Drop</a><a class="text-sm font-medium transition-colors hover:text-primary text-muted-foreground" href="/rules">Rules</a><a class="text-sm font-medium transition-colors hover:text-primary text-muted-foreground" href="/drops">Past Drops</a></div><div class="md:hidden"><button data-slot="sheet-trigger" data-variant="ghost" data-size="icon" class="inline-flex items-center justify-center gap-2 whitespace-nowrap rounded-md text-sm font-medium transition-all disabled:pointer-events-none disabled:opacity-50 [&_svg]:pointer-events-none [&_svg:not([class*='size-'])]:size-4 shrink-0 [&_svg]:shrink-0 outline-none focus-visible:border-ring focus-visible:ring-ring/50 focus-visible:ring-[3px] aria-invalid:ring-destructive/20 dark:aria-invalid:ring-destructive/40 aria-invalid:border-destructive hover:bg-accent hover:text-accent-foreground dark:hover:bg-accent/50 size-9" type="button" aria-haspopup="dialog" aria-expanded="false" aria-controls="radix-_R_rb_" data-state="closed"><svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="lucide lucide-menu h-5 w-5" aria-hidden="true"><path d="M4 5h16"></path><path d="M4
Open service 35.157.26.135:80 · findme.gg
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:42 GMT Location: https://findme.gg/ Server: Netlify X-Nf-Request-Id: 01KETBQG9Q3YD0YXPNZWAHET19 Content-Length: 33 Connection: close Redirecting to https://findme.gg/
Open service 35.157.26.135:443 · peterskousen.dk
2026-01-13 00:22
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 4 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 3356 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:22:23 GMT Etag: "96d5998b0658e1a534675a3d3b68b872-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBPXZS36KJX9E9BZ2AEWTD Connection: close Page title: Peter Skousen <!DOCTYPE html><html lang="en"> <head><meta charset="utf-8"><link rel="icon" type="image/svg+xml" href="/favicon.svg"><meta name="viewport" content="width=device-width"><meta name="generator" content="Astro v5.4.2"><title>Peter Skousen</title><link rel="stylesheet" href="/_astro/index.CEcuUaTF.css"></head> <body class="bg-gray-default"> <section class="h-screen w-screen flex flex-col justify-center items-center relative" id="first-section"> <h1 class="text-5xl font-bold capitalize text-gray-800"> <span id="typedjs"></span> </h1> <!-- Arrow indicator at the bottom --> <div class="absolute bottom-8 animate-bounce cursor-pointer" id="arrow-indicator" style="opacity: 0;"> <svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 24 24" fill="currentColor" class="w-12 h-12 text-orange-500" style="stroke: currentColor; stroke-width: 0.5;"> <path fill-rule="evenodd" d="M12.53 16.28a.75.75 0 0 1-1.06 0l-7.5-7.5a.75.75 0 0 1 1.06-1.06L12 14.69l6.97-6.97a.75.75 0 1 1 1.06 1.06l-7.5 7.5Z" clip-rule="evenodd"></path> </svg> </div> </section> <section class="w-screen flex flex-col justify-center items-center md:px-24 lg:px-40" id="second-section"> <!--Grid--> <div class="grid md:grid-cols-3 gap-10 font-sans md:mt-0 sm:mt-32"> <div class="flex items-center justify-left md:col-span-2 font-sans md:h-screen"> <p class="text-4xl/12 font-bold text-gray-800"> Digital designer with a critical, value-based, and human-centered approach to creative problem solving involving computers. </p> </div> <div class="flex flex-col place-content-center font-sans h-screen"> <img src="/portrait.png" class="w-full" alt="Portrait"> <p class="font-light text-justify mt-4"> (This image is a few years old, but apart from straighter teeth, I look pretty much the same) </p> </div> </div> <div class="flex flex-col justify-left h-screen "> <p class="text-4xl/8 font-bold text-orange-600 italic"> What does that even mean? </p> <p class="text-xl/9 font-normal mt-8 text-gray-800 text-justify"> Honestly, I’m not entirely sure myself. It does sound catchy, though. </p> <p class="text-xl/9 font-normal mt-8 text-gray-800 text-justify"> But what I do know is that I’m fairly adequate at programming, know how to use Figma, and have done <span class="italic">a lot</span> of design thinking with other students and in collaboration with organizations for the past 3.5 years. </p> <p class="text-xl/9 font-normal mt-8 text-gray-800 text-justify"> I think that some of the most important qualities of a good designer are to be humble, to put user needs before personal preference, to ask questions and to challenge assumptions. I believe that designers have huge ethical responsibilities when coming up with solutions that end up in the real world and affect real people. </p> <p class="text-xl/9 font-normal mt-8 text-gray-800 text-justify"> I also have a wide range of personal interests, including playing music, doing photography, arranging themed friday bars, cassette futurism, tangible user interfaces, reading about tech, and drinking coffee. I have also been the Dungeon Master of a local Dungeons and Dragons campaign for a short while, but am a bit shy to say that out loud. </p> </div> </section> <script type="module" src="/_astro/index.astro_astro_type_script_index_0_lang.BlpCuCkc.js"></script> </body> </html>
Open service 35.157.26.135:80 · peterskousen.dk
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:32 GMT Location: https://peterskousen.dk/ Server: Netlify X-Nf-Request-Id: 01KETBQ6BE8SAF54GMY4WBKM3C Content-Length: 39 Connection: close Redirecting to https://peterskousen.dk/
Open service 35.157.26.135:80 · raimundoconsultant.services
2026-01-13 00:22
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:22:19 GMT Location: https://raimundoconsultant.services/ Server: Netlify X-Nf-Request-Id: 01KETBPSYY2RWYBXM33HDCMVY0 Content-Length: 51 Connection: close Redirecting to https://raimundoconsultant.services/
Open service 35.157.26.135:443 · raimundoconsultant.services
2026-01-13 00:22
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 10302
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:22:10 GMT
Etag: "3e5627f120a0dec450181f3aac0c7908-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBPH9687E55JWFBH4DSGK0
Connection: close
Page title: Mr. Raimundo - Media Consultant & Digital Marketing
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Mr. Raimundo - Media Consultant & Digital Marketing</title>
<style>
* {
margin: 0;
padding: 0;
box-sizing: border-box;
}
:root {
--primary: #208C85;
--secondary: #F5F5F5;
--text: #1F2121;
--light: #FCFCF9;
}
body {
font-family: -apple-system, BlinkMacSystemFont, 'Segoe UI', sans-serif;
color: var(--text);
line-height: 1.6;
background: var(--light);
}
header {
background: var(--light);
padding: 1.5rem 2rem;
border-bottom: 1px solid #E0E0E0;
position: sticky;
top: 0;
z-index: 100;
}
nav {
max-width: 1200px;
margin: 0 auto;
display: flex;
justify-content: space-between;
align-items: center;
}
.logo {
font-size: 1.5rem;
font-weight: 600;
color: var(--primary);
}
nav ul {
display: flex;
list-style: none;
gap: 2rem;
}
nav a {
text-decoration: none;
color: var(--text);
transition: color 0.3s;
}
nav a:hover {
color: var(--primary);
}
.hero {
max-width: 1200px;
margin: 3rem auto;
padding: 0 2rem;
text-align: center;
}
.hero h1 {
font-size: 3rem;
margin-bottom: 1rem;
color: var(--text);
}
.hero p {
font-size: 1.2rem;
color: #626C7C;
margin-bottom: 2rem;
}
.cta-button {
display: inline-block;
background: var(--primary);
color: white;
padding: 0.75rem 2rem;
border-radius: 8px;
text-decoration: none;
transition: background 0.3s;
font-weight: 500;
}
.cta-button:hover {
background: #1B7A74;
}
.container {
max-width: 1200px;
margin: 0 auto;
padding: 2rem;
}
section {
margin: 3rem 0;
}
section h2 {
font-size: 2rem;
margin-bottom: 1.5rem;
color: var(--text);
text-align: center;
}
.services {
display: grid;
grid-template-columns: repeat(auto-fit, minmax(280px, 1fr));
gap: 2rem;
}
.service-card {
background: white;
padding: 2rem;
border-radius: 8px;
border: 1px solid #E0E0E0;
text-align: center;
}
.service-card h3 {
color: var(--primary);
margin-bottom: 1rem;
}
.faq {
background: var(--secondary);
padding: 2rem;
border-radius: 8px;
}
.faq-item {
margin-bottom: 1.5rem;
padding-bottom: 1.5rem;
border-bottom: 1px solid #D0D0D0;
}
.faq-item:last-child {
border-bottom: none;
}
.faq-item h4 {
color: var(--primary);
margin-bottom: 0.5rem;
cursor: pointer;
}
.about-content {
background: white;
padding: 2rem;
border-radius: 8px;
border: 1px solid #E0E0E0;
}
footer {
background: var(--text);
color: white;
text-align: center;
padding: 2rem;
margin-top: 3rem;
}
.nav-toggle {
display: none;
}
@media (max-width: 768px) {
.nav-toggle {
display: block;
b
Open service 35.157.26.135:443 · ice.sa
2026-01-13 00:21
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 66602
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:21:04 GMT
Etag: "3ba1348649039c40ff32160d175055e7-ssl"
Netlify-Vary: cookie=__next_preview_data:presence|__prerender_bypass:presence
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBMGMFTVST16RWP6D8HTD9
Connection: close
Page title: التنافسية الدولية
<!DOCTYPE html><html dir="rtl" class="h-full" style="font-size:1em" lang="ar-SA"><head><meta name="viewport" content="width=device-width"/><meta charSet="utf-8"/><title>التنافسية الدولية</title><link rel="preload" as="image" imageSrcSet="/_next/image?url=%2Fslider%2F3.jpg&w=640&q=75 640w, /_next/image?url=%2Fslider%2F3.jpg&w=750&q=75 750w, /_next/image?url=%2Fslider%2F3.jpg&w=828&q=75 828w, /_next/image?url=%2Fslider%2F3.jpg&w=1080&q=75 1080w, /_next/image?url=%2Fslider%2F3.jpg&w=1200&q=75 1200w, /_next/image?url=%2Fslider%2F3.jpg&w=1920&q=75 1920w, /_next/image?url=%2Fslider%2F3.jpg&w=2048&q=75 2048w, /_next/image?url=%2Fslider%2F3.jpg&w=3840&q=75 3840w" imageSizes="100vw"/><meta name="next-head-count" content="4"/><meta name="description" content="مجموعة التنافسية الدولية، أو ببساطة ICE، هي مجموعة من الشركات الاستشارية في مختلف المجالات. خدماتنا تركز على دعم عملائنا عن طريق توقع احتياجاتهم وتطوير حلول مبتكرة. في جميع الأسواق والقطاعات التي ننشط فيها، نحن نهدف إلى بناء تنافسية مستدامة عن طريق خلق علاقة ثقة مع عملائنا وإقامة شراكات رابحة مع موردينا. للقيام بذلك، نحن دائما نعتقد ان علاقاتنا مع طرفي أنشطة أعمالنا يجب أن تدار من خلال اعتماد نموذج عمل مرن ذا فاعلية وكفاءة عالية."/><link rel="dns-prefetch"/><link rel="apple-touch-icon" href="/apple-touch-icon.png"/><style>
#__next {
height: 100%;
isolation: isolate;
}
</style><link rel="preload" href="/_next/static/css/da316c1e67a883b8.css" as="style"/><link rel="stylesheet" href="/_next/static/css/da316c1e67a883b8.css" data-n-g=""/><noscript data-n-css=""></noscript><script defer="" nomodule="" src="/_next/static/chunks/polyfills-5cd94c89d3acac5f.js"></script><script src="/_next/static/chunks/webpack-69bfa6990bb9e155.js" defer=""></script><script src="/_next/static/chunks/framework-a87821de553db91d.js" defer=""></script><script src="/_next/static/chunks/main-6fc1304f0fc00875.js" defer=""></script><script src="/_next/static/chunks/pages/_app-d21a913f35ad4ec1.js" defer=""></script><script src="/_next/static/chunks/521-6447c356e2895c14.js" defer=""></script><script src="/_next/static/chunks/635-b1d556c5373e0a6d.js" defer=""></script><script src="/_next/static/chunks/pages/index-f09bcd9f425a553c.js" defer=""></script><script src="/_next/static/igUiulZ_ppYdS0YT8DN3H/_buildManifest.js" defer=""></script><script src="/_next/static/igUiulZ_ppYdS0YT8DN3H/_ssgManifest.js" defer=""></script><script src="/_next/static/igUiulZ_ppYdS0YT8DN3H/_middlewareManifest.js" defer=""></script></head><body class="h-full overflow-x-hidden bg-white font-sans"><div id="__next"><div class="flex min-h-full flex-col"><header class="container"><div class="space-y-4 md:flex md:items-baseline md:justify-between"><a class="mt-4 block text-center md:text-start" href="/"><span style="box-sizing:border-box;display:inline-block;overflow:hidden;width:initial;height:initial;background:none;opacity:1;border:0;margin:0;padding:0;position:relative;max-width:100%"><span style="box-sizing:border-box;display:block;width:initial;height:initial;background:none;opacity:1;border:0;margin:0;padding:0;max-width:100%"><img style="display:block;max-width:100%;width:initial;height:initial;background:none;opacity:1;border:0;margin:0;padding:0" alt="" aria-hidden="true" src="data:image/svg+xml,%3csvg%20xmlns=%27http://www.w3.org/2000/svg%27%20version=%271.1%27%20width=%27202%27%20height=%2764%27/%3e"/></span><img alt="التنافسية الدولية" src="data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7" decoding="async" data-nimg="intrinsic" style="position:absolute;top:0;left:0;bottom:0;right:0;box-sizin
Open service 35.157.26.135:80 · ice.sa
2026-01-13 00:21
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:21:11 GMT Location: https://ice.sa/ Server: Netlify X-Nf-Request-Id: 01KETBMQWSGJPJYR9MGJWZMM9Q Content-Length: 30 Connection: close Redirecting to https://ice.sa/
Open service 35.157.26.135:80 · lxdroddyfallacies.com
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:21:10 GMT Location: https://lxdroddyfallacies.com/ Server: Netlify X-Nf-Request-Id: 01KETBMP8WVFQ9Q4FWXGQNK4GY Content-Length: 45 Connection: close Redirecting to https://lxdroddyfallacies.com/
Open service 35.157.26.135:443 · lxdroddyfallacies.com
2026-01-13 00:20
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 9528
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:21:02 GMT
Etag: "a7a9176c8a62e76231076ecadb2b3d7b-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBMEQF2GR9S5H6RRF960J7
Connection: close
<!DOCTYPE html>
<html lang="en">
<head>
<meta name='viewport' content='initial-scale = 1, minimum-scale = 1, maximum-scale = 1'/>
<meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
<meta http-equiv="x-ua-compatible" content="IE=10">
<title></title>
<style type="text/css">#initialLoading{background:url(assets/htmlimages/loader.gif) no-repeat center center;background-color:#ffffff;position:absolute;margin:auto;top:0;left:0;right:0;bottom:0;z-index:10010;}</style>
"
"
<script>
var deviceReady = false;
var initCalled = false ;
var initialized = false;
function onBodyLoad()
{
if(typeof window.device === 'undefined')
{
document.addEventListener("deviceready", onDeviceReady, false);
}
else
{
onDeviceReady();
}
}
function isLivePreview()
{
return ( window.location.pathname.indexOf("\/livepreview") === 0 );
}
function onDeviceReady()
{
deviceReady = true ;
if(initCalled === true)
initializeCP();
}
function isLivePreviewDirty()
{
var reqUrl = window.location.protocol + "//" + window.location.host + "/livepreview/isLivePreviewDirty?folder=" + cp.previewFolder;
var request = new XMLHttpRequest();
request.open('GET', reqUrl);
request.responseType = 'text';
request.onload = function()
{
var response = JSON.parse(request.response);
if(response.isDirty == false)
{
return;
}
window.location.href = window.location.protocol + "//" + window.location.host + "/livepreview/" + response.folder + "/index.html";
};
request.send();
}
function initializeCP()
{
if(initialized)
return;
initCalled = true ;
if(cp.pg && deviceReady === false)
return;
function cpInit()
{
document.body.innerHTML = " <div class='cpMainContainer' id='cpDocument' style='left: 0px; top:0px;' > <div id='main_container' style='top:0px;position:absolute;width:100%;height:100%;'> <div id='projectBorder' style='top:0px;left:0px;width:100%;height:100%;position:absolute;display:block'></div> <div class='shadow' id='project_container' style='left: 0px; top:0px;width:100%;height:100%;position:absolute;overflow:hidden;' > <div id='project' class='cp-movie' style='width:100% ;height:100%;overflow:hidden;'> <div id='project_main' class='cp-timeline cp-main'> <div id='div_Slide' onclick='cp.handleClick(event)' style='top:0px; width:100% ;height:100% ;position:absolute;-webkit-tap-highlight-color: rgba(0,0,0,0);'></div> <canvas id='slide_transition_canvas'></canvas> </div> <div id='autoplayDiv' style='display:block;text-align:center;position:absolute;left:0px;top:0px;'> <img id='autoplayImage' src='' style='position:absolute;display:block;vertical-align:middle;'/> <div id='playImage' tabindex='9999' role='button' aria-label='play' onkeydown='cp.CPPlayButtonHandle(event)' onClick='cp.movie.play()' style='position:absolute;display:block;vertical-align:middle;'></div> </div> <div id='cc' style='left:0px; position:absolute;visibility:hidden;pointer-events:none;' onclick='cp.handleCCClick(event)'> <div id='ccText' style='left:0px;float:left;position:absolute;width:100%;height:100%;'> <p style='margin-left:8px;margin-right:8px;margin-top:2px;'> </p> </div> <div id='ccClose' style='background-image:url(./assets/htmlimages/ccClose.png);right:10px; position:absolute;cursor:pointer;width:13px;height:11px;' onclick='cp.showHideCC()'> </div> </div> </div> <div id='toc' style='left:0px;position:absolute;-webkit-tap-highlight-color: rgba(0,0,0,0);'> </div> <div id='playbar' style='bottom:0px; position:fixed'> </div> <div id='gestureIcon' class='gestureIcon'> </div> <div id='gestureHint' class='gestureHintDiv'> <div id='gImage' class='gesturesHint'></div> </div> <div id='pwdv' style='display:block;text-align:center;position:absolute;width:100%;height:100%;left:0px;top:0px'></div> <div id='exdv' style='display:block;text-align:center;position:absolute;width:100%;height:100%;left:0px;top:0px'></div> </div> </div></div><div id='lightBoxBackgroundDiv' style='left: 0px; top:0px;position:fixed;z-index:100;width:100%;height:100%;disp
Open service 35.157.26.135:80 · www.swiftcaploans.com
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:21:08 GMT Location: https://www.swiftcaploans.com/ Server: Netlify X-Nf-Request-Id: 01KETBMN45G8NJ1XT88QXCKM7J Content-Length: 45 Connection: close Redirecting to https://www.swiftcaploans.com/
Open service 35.157.26.135:443 · www.swiftcaploans.com
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:21:00 GMT Location: https://swiftcaploans.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBMCYWE3FP5R3D0MQR5VG6 Content-Length: 41 Connection: close Redirecting to https://swiftcaploans.com/
Open service 35.157.26.135:443 · experienciatricheta.com
2026-01-13 00:20
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 54178
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:20:50 GMT
Etag: "1754c5c3065fede2a732b6999079becf-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBM3EARH3S5F7D923JY4BF
Connection: close
Page title: Experiencia Tricheta - Bahía Blanca
<!DOCTYPE html>
<html lang="es">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Experiencia Tricheta - Bahía Blanca</title>
<!-- Tailwind CSS -->
<script src="https://cdn.tailwindcss.com"></script>
<!-- Iconos Lucide -->
<script src="https://unpkg.com/lucide@latest"></script>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;700;900&display=swap" rel="stylesheet">
<style>
:root {
--primary-blue: #104C73;
--accent-blue: #3B82F6; /* Azul más brillante para contraste */
--dark-bg: #050c14;
}
body {
font-family: 'Inter', sans-serif;
background-color: var(--dark-bg);
color: #f1f5f9;
overflow-x: hidden;
}
.scroll-smooth {
scroll-behavior: smooth;
}
/* Estilo para el texto "Tricheteá" centrado y llamativo */
.trichetea-glow {
color: #fff;
text-shadow: 0 0 15px rgba(59, 130, 246, 0.8), 0 0 30px rgba(16, 76, 115, 0.5);
letter-spacing: 0.3em;
font-weight: 900;
}
/* Borde inferior difuminado para la Nav Bar */
.nav-blur-border {
box-shadow: 0 4px 20px -2px rgba(16, 76, 115, 0.4);
border-bottom: 1px solid rgba(255, 255, 255, 0.05);
}
/* Ocultar barra de scroll en carrusel */
.no-scrollbar::-webkit-scrollbar { display: none; }
.no-scrollbar { -ms-overflow-style: none; scrollbar-width: none; }
/* Animación del Menú Móvil (Slide Down) */
#mobile-menu {
transition: transform 0.6s cubic-bezier(0.16, 1, 0.3, 1), opacity 0.4s ease;
transform: translateY(-100%);
opacity: 0;
pointer-events: none;
}
#mobile-menu.open {
transform: translateY(0);
opacity: 0.98;
pointer-events: auto;
}
.snap-x {
scroll-snap-type: x mandatory;
}
.snap-center {
scroll-snap-align: center;
}
/* Control de páginas */
.page-section {
display: none;
}
.page-section.active {
display: block;
}
/* Mejora de contraste para el título Hero */
.hero-title-shadow {
text-shadow: 0 4px 12px rgba(0, 0, 0, 0.5);
}
/* Animación sutil para la etiqueta de WhatsApp */
@keyframes subtleBounce {
0%, 100% { transform: translateX(0); }
50% { transform: translateX(-5px); }
}
.whatsapp-label-anim {
animation: subtleBounce 3s infinite ease-in-out;
}
/* Estilos para el video */
.video-container video {
display: none; /* Oculto inicialmente */
}
.video-container.playing video {
display: block; /* Se muestra al reproducir */
}
.video-container.playing .thumbnail-img,
.video-container.playing .video-overlay {
display: none; /* Se oculta la miniatura y el overlay al reproducir */
}
</style>
</head>
<body class="scroll-smooth">
<!-- NAVIGATION (Fondo sólido y borde difuminado) -->
<nav id="main-nav" class="fixed w-full z-[80] transition-all duration-500 py-4 bg-[#050c14] nav-blur-border backdrop-blur-md">
<div class="container mx-auto px-6 flex justify-between items-center relative z-[95]">
<div class="text-lg md:text-2xl font-black tracking-tighter cursor-pointer flex items-center gap-3 text-white" onclick="navigateTo('inicio')">
<!-- Logo PNG Circular -->
<div class="w-10 h-10 rounded-full overflow-hidden shadow-lg border border-white/20">
<img src="img/logoET.png" alt="Logo Experiencia Tricheta" class="w-full h-full object-cover"
Open service 35.157.26.135:443 · experienciatricheta.com.ar
2026-01-13 00:20
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; fwd=miss
Content-Length: 54178
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:20:50 GMT
Etag: "1754c5c3065fede2a732b6999079becf-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBM2KE2C501NNQSQMRYFKK
Connection: close
Page title: Experiencia Tricheta - Bahía Blanca
<!DOCTYPE html>
<html lang="es">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Experiencia Tricheta - Bahía Blanca</title>
<!-- Tailwind CSS -->
<script src="https://cdn.tailwindcss.com"></script>
<!-- Iconos Lucide -->
<script src="https://unpkg.com/lucide@latest"></script>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;700;900&display=swap" rel="stylesheet">
<style>
:root {
--primary-blue: #104C73;
--accent-blue: #3B82F6; /* Azul más brillante para contraste */
--dark-bg: #050c14;
}
body {
font-family: 'Inter', sans-serif;
background-color: var(--dark-bg);
color: #f1f5f9;
overflow-x: hidden;
}
.scroll-smooth {
scroll-behavior: smooth;
}
/* Estilo para el texto "Tricheteá" centrado y llamativo */
.trichetea-glow {
color: #fff;
text-shadow: 0 0 15px rgba(59, 130, 246, 0.8), 0 0 30px rgba(16, 76, 115, 0.5);
letter-spacing: 0.3em;
font-weight: 900;
}
/* Borde inferior difuminado para la Nav Bar */
.nav-blur-border {
box-shadow: 0 4px 20px -2px rgba(16, 76, 115, 0.4);
border-bottom: 1px solid rgba(255, 255, 255, 0.05);
}
/* Ocultar barra de scroll en carrusel */
.no-scrollbar::-webkit-scrollbar { display: none; }
.no-scrollbar { -ms-overflow-style: none; scrollbar-width: none; }
/* Animación del Menú Móvil (Slide Down) */
#mobile-menu {
transition: transform 0.6s cubic-bezier(0.16, 1, 0.3, 1), opacity 0.4s ease;
transform: translateY(-100%);
opacity: 0;
pointer-events: none;
}
#mobile-menu.open {
transform: translateY(0);
opacity: 0.98;
pointer-events: auto;
}
.snap-x {
scroll-snap-type: x mandatory;
}
.snap-center {
scroll-snap-align: center;
}
/* Control de páginas */
.page-section {
display: none;
}
.page-section.active {
display: block;
}
/* Mejora de contraste para el título Hero */
.hero-title-shadow {
text-shadow: 0 4px 12px rgba(0, 0, 0, 0.5);
}
/* Animación sutil para la etiqueta de WhatsApp */
@keyframes subtleBounce {
0%, 100% { transform: translateX(0); }
50% { transform: translateX(-5px); }
}
.whatsapp-label-anim {
animation: subtleBounce 3s infinite ease-in-out;
}
/* Estilos para el video */
.video-container video {
display: none; /* Oculto inicialmente */
}
.video-container.playing video {
display: block; /* Se muestra al reproducir */
}
.video-container.playing .thumbnail-img,
.video-container.playing .video-overlay {
display: none; /* Se oculta la miniatura y el overlay al reproducir */
}
</style>
</head>
<body class="scroll-smooth">
<!-- NAVIGATION (Fondo sólido y borde difuminado) -->
<nav id="main-nav" class="fixed w-full z-[80] transition-all duration-500 py-4 bg-[#050c14] nav-blur-border backdrop-blur-md">
<div class="container mx-auto px-6 flex justify-between items-center relative z-[95]">
<div class="text-lg md:text-2xl font-black tracking-tighter cursor-pointer flex items-center gap-3 text-white" onclick="navigateTo('inicio')">
<!-- Logo PNG Circular -->
<div class="w-10 h-10 rounded-full overflow-hidden shadow-lg border border-white/20">
<img src="img/logoET.png" alt="Logo Experiencia Tricheta" class="w-full h-full object-cover"
Open service 35.157.26.135:80 · experienciatricheta.com.ar
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:20:57 GMT Location: https://experienciatricheta.com.ar/ Server: Netlify X-Nf-Request-Id: 01KETBMA5E8H9KX17039604WKR Content-Length: 50 Connection: close Redirecting to https://experienciatricheta.com.ar/
Open service 35.157.26.135:80 · experienciatricheta.com
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:20:57 GMT Location: https://experienciatricheta.com/ Server: Netlify X-Nf-Request-Id: 01KETBMA4WKVZJR9SSPEEVDWQA Content-Length: 47 Connection: close Redirecting to https://experienciatricheta.com/
Open service 35.157.26.135:80 · koblia.com
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:20:34 GMT Location: https://koblia.com/ Server: Netlify X-Nf-Request-Id: 01KETBKKF4F9FR94E3N0T59VKA Content-Length: 34 Connection: close Redirecting to https://koblia.com/
Open service 35.157.26.135:443 · koblia.com
2026-01-13 00:20
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 34759
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:20:27 GMT
Etag: "dea50dcccbaabfef9cfcd498b33a2817-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBKCGZQMBSC7648X5NQERJ
Connection: close
Page title: 아기 성장 발달 계산기 - 2026 최신 기준2026 최신 아기 성장 발달 계산기
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<title>아기 성장 발달 계산기 - 2026 최신 기준</title>
</head>
<body>
<!DOCTYPE html>
<html lang="ko">
<head>
<!-- Google Tag Manager -->
<script>(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':
new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0],
j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src=
'https://www.googletagmanager.com/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);
})(window,document,'script','dataLayer','GTM-KC5RZMBZ');</script>
<!-- End Google Tag Manager -->
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>2026 최신 아기 성장 발달 계산기</title>
<meta name="description" content="2026년 최신 질병관리청 및 대한소아과의사학회 기준으로 우리 아이의 키, 몸무게, 머리둘레 백분위수를 정확하게 계산해 드립니다.">
<link rel="canonical" href="https://www.koblia.com">
<meta property="og:type" content="website">
<meta property="og:site_name" content="코블리아 아기 계산기">
<meta property="og:title" content="2026 최신 아기 성장 발달 계산기">
<meta property="og:description" content="1초 만에 확인하는 우리 아기 성장 발달 백분위! 지금 바로 무료로 확인해보세요.">
<meta property="og:url" content="https://www.koblia.com">
<meta property="og:image" content="https://i.ibb.co/5gBPgyn0/bear.jpg">
<meta property="og:image:width" content="400">
<meta property="og:image:height" content="400">
<meta name="twitter:card" content="summary">
<meta name="twitter:title" content="2026 최신 아기 성장 발달 계산기">
<meta name="twitter:description" content="1초 만에 확인하는 우리 아기 성장 발달 백분위! 지금 바로 무료로 확인해보세요.">
<meta name="twitter:image" content="https://i.ibb.co/5gBPgyn0/bear.jpg">
<meta name="twitter:domain" content="koblia.com">
<style>
@import url("https://cdn.jsdelivr.net/gh/orioncactus/pretendard@v1.3.9/dist/web/static/pretendard.min.css");
* {
margin: 0;
padding: 0;
box-sizing: border-box;
}
body {
font-family: "Pretendard", -apple-system, BlinkMacSystemFont, system-ui, Roboto, sans-serif;
font-weight: 400;
font-variant-numeric: tabular-nums;
background: #d2f3fd;
padding: 20px;
min-height: 100vh;
}
.container {
max-width: 1200px;
margin: 0 auto;
background: white;
border-radius: 15px;
padding: 40px;
box-shadow: 0 4px 20px rgba(0,0,0,0.08);
}
/* 제목 스타일 */
h1 {
text-align: center;
color: #2b2b2b;
font-size: 32px;
font-weight: 800;
margin-bottom: 15px;
display: flex;
align-items: center;
justify-content: center;
gap: 12px;
word-break: keep-all;
}
.title-icon {
width: 60px;
height: 60px;
object-fit: contain;
}
/* 설명글 스타일 */
.description {
text-align: center;
color: #666;
font-size: 16px;
line-height: 1.6;
margin-bottom: 40px;
word-break: keep-all;
padding: 20px;
background-color: #f4faff;
border-radius: 10px;
}
.description strong {
color: #333;
font-weight: 700;
background: linear-gradient(to top, #f9e86b 50%, transparent 50%);
}
/* 모바일 화면 최적화 */
@media (max-width: 600px) {
h1 {
font-size: 20px;
gap: 8px;
Open service 35.157.26.135:80 · www.proofofdestruction.com
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:20:32 GMT Location: https://www.proofofdestruction.com/ Server: Netlify X-Nf-Request-Id: 01KETBKH7PS4K4N513PF939192 Content-Length: 50 Connection: close Redirecting to https://www.proofofdestruction.com/
Open service 35.157.26.135:443 · www.proofofdestruction.com
2026-01-13 00:20
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:20:24 GMT Location: https://proofofdestruction.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBK9CN8NRWVTDBKN166TKC Content-Length: 46 Connection: close Redirecting to https://proofofdestruction.com/
Open service 35.157.26.135:443 · purityprocleaning.com
2026-01-13 00:19
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 832
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:19:54 GMT
Etag: "dc4c3184b3a40b8f10946d90803ab110-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBJCV5K6GZNY79P7NYVD13
Connection: close
Page title: Purity Pro - Professional Cleaning & Property Management Islandwide
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Purity Pro - Professional Cleaning & Property Management Islandwide</title>
<meta name="description" content="Jamaica's most trusted cleaning and property management service. Professional cleaners, flat pricing, WhatsApp-friendly booking. Serving Kingston, St. Andrew & expanding islandwide." />
<script type="module" crossorigin src="/assets/index-C5rF4YLh.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-f9k2cw5u.css">
<script async src="https://bolt.new/badge.js?s=799284fa-7415-455b-85ee-d3ae4e8e4026"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · purityprocleaning.com
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:20:02 GMT Location: https://purityprocleaning.com/ Server: Netlify X-Nf-Request-Id: 01KETBJMAT5WW6DHAHV4Z4Y9X9 Content-Length: 45 Connection: close Redirecting to https://purityprocleaning.com/
Open service 35.157.26.135:443 · www.verso.gg
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:29 GMT Location: https://verso.gg/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBHM5GXZPJ0TPS5X6W346V Content-Length: 32 Connection: close Redirecting to https://verso.gg/
Open service 35.157.26.135:80 · www.verso.gg
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:37 GMT Location: https://www.verso.gg/ Server: Netlify X-Nf-Request-Id: 01KETBHW77W2J2WY751HVZY8EE Content-Length: 36 Connection: close Redirecting to https://www.verso.gg/
Open service 35.157.26.135:443 · afroshopberlin.com
2026-01-13 00:19
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1412
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:19:21 GMT
Etag: "18a87ac2914c5cbd7dc0a08d77f123fc-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBHC0DXX1YYJ88MB6AR2XA
Connection: close
Page title: Afro Shops in Germany Guide
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Afro Shops in Germany Guide</title>
<meta name="description" content="Find Afro shops across Germany - Your guide to African stores, services, and products in Germany" />
<meta name="author" content="Lovable" />
<meta property="og:image" content="/og-image.png" />
<!-- Google tag (gtag.js) -->
<script async src="https://www.googletagmanager.com/gtag/js?id=G-471CTLJBB3"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-471CTLJBB3');
</script>
<script type="module" crossorigin src="/assets/index-DKjA9FOq.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-BU8tpZa2.css">
</head>
<body>
<div id="root"></div>
<!-- IMPORTANT: DO NOT REMOVE THIS SCRIPT TAG OR THIS VERY COMMENT! -->
<script src="https://cdn.gpteng.co/gptengineer.js" type="module"></script>
<!-- Google Analytics -->
<script async src="https://www.googletagmanager.com/gtag/js?id=G-471CTLJBB3"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-XXXXXXXXXX');
</script></body>
</html>
Open service 35.157.26.135:80 · afroshopberlin.com
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:28 GMT Location: https://afroshopberlin.com/ Server: Netlify X-Nf-Request-Id: 01KETBHJRGY63P6H6Q7FCNR6ME Content-Length: 42 Connection: close Redirecting to https://afroshopberlin.com/
Open service 35.157.26.135:80 · www.pshar.ma
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:27 GMT Location: https://www.pshar.ma/ Server: Netlify X-Nf-Request-Id: 01KETBHJ8J18RHBYKRWS6EB5Q4 Content-Length: 36 Connection: close Redirecting to https://www.pshar.ma/
Open service 35.157.26.135:443 · www.pshar.ma
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:20 GMT Location: https://pshar.ma/ Server: Netlify Strict-Transport-Security: max-age=63072000; includeSubDomains; preload X-Nf-Request-Id: 01KETBHB6YZFDYJC8CBK5R4DE8 Content-Length: 32 Connection: close Redirecting to https://pshar.ma/
Open service 35.157.26.135:80 · www.caafimaadai.com
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:27 GMT Location: http://caafimaadai.com/ Server: Netlify X-Nf-Request-Id: 01KETBHJF9AMF1Q1561R6VXSH0 Content-Length: 38 Connection: close Redirecting to http://caafimaadai.com/
Open service 35.157.26.135:443 · www.caafimaadai.com
2026-01-13 00:19
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 562
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:19:18 GMT
Etag: "ae2f82cae579e709edc57fd028e5d28e-ssl"
Server: Netlify
X-Nf-Request-Id: 01KETBH9AR5NCZ4VX240ZE4X1P
Connection: close
Page title: CaafimaadAI
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>CaafimaadAI</title>
<meta name="description" content="AI-powered health and skin analysis" />
<meta name="author" content="CaafimaadAI" />
<meta property="og:image" content="/og-image.png" />
</head>
<body>
<div id="root"></div>
<script src="https://cdn.gpteng.co/gptengineer.js" type="module"></script>
<script type="module" src="/src/main.tsx"></script>
</body>
</html>
Open service 35.157.26.135:80 · www.allmadheretherapy.com
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:15 GMT Location: https://www.allmadheretherapy.com/ Server: Netlify X-Nf-Request-Id: 01KETBH6RM9NPDZ4SM4DF4EMPX Content-Length: 49 Connection: close Redirecting to https://www.allmadheretherapy.com/
Open service 35.157.26.135:443 · www.allmadheretherapy.com
2026-01-13 00:19
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:19:06 GMT Location: https://allmadheretherapy.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBGXW2D1XR65H8HW2MM4BR Content-Length: 45 Connection: close Redirecting to https://allmadheretherapy.com/
Open service 35.157.26.135:443 · pocket.tinyatdragon.com
2026-01-13 00:18
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 9628
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:18:43 GMT
Etag: "989abb9dceefdde0bdcf1df3733178fe-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBG78W4RK6BMNWF6K55DC0
Connection: close
Page title: BB Pocket Log
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<title>BB Pocket Log</title>
<meta name="theme-color" content="#ef5e14" />
<link rel="manifest" href="./manifest.webmanifest" />
<link rel="apple-touch-icon" href="./icons/icon-192.png" />
<meta name="apple-mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-status-bar-style" content="black-translucent" />
<style>
:root{
--ty:#ef5e14;
--bg:#0f1517;
--panel:#141c1f;
--panel2:#10171a;
--text:#f7f7f7;
--muted:#b7c0c7;
--border:#223036;
--ok:#2bd576;
--warn:#f5c542;
--bad:#ff5a5f;
--shadow: 0 8px 24px rgba(0,0,0,.35);
--r:16px;
}
*{box-sizing:border-box}
html,body{margin:0;padding:0;background:var(--bg);color:var(--text);font-family:system-ui,-apple-system,Segoe UI,Roboto,Arial,sans-serif}
a{color:inherit}
.wrap{max-width:980px;margin:0 auto;padding:14px}
.hero{background:linear-gradient(180deg, rgba(239,94,20,.20), rgba(239,94,20,.05));border:1px solid var(--border);border-radius:24px;box-shadow:var(--shadow);padding:14px 14px 12px}
.heroTop{display:flex;gap:10px;align-items:center;justify-content:space-between;flex-wrap:wrap}
.title{display:flex;gap:10px;align-items:center}
.dot{width:12px;height:12px;border-radius:999px;background:var(--ty);box-shadow:0 0 0 3px rgba(239,94,20,.20)}
h1{margin:0;font-size:18px;letter-spacing:.2px}
.sub{color:var(--muted);font-size:12px}
.pillRow{display:flex;gap:8px;flex-wrap:wrap;margin-top:10px}
.pill{border:1px solid var(--border);background:rgba(255,255,255,.03);border-radius:999px;padding:6px 10px;font-size:12px;color:var(--muted)}
.pill b{color:var(--text);font-weight:700}
.grid{display:grid;grid-template-columns:1fr;gap:12px;margin-top:12px}
@media (min-width:900px){.grid{grid-template-columns:1.05fr .95fr}}
.card{background:var(--panel);border:1px solid var(--border);border-radius:24px;box-shadow:var(--shadow);padding:14px}
.card h2{margin:0 0 10px;font-size:14px}
label{display:block;font-size:12px;color:var(--muted);margin:8px 0 6px}
input,textarea,select{
width:100%;border:1px solid var(--border);background:var(--panel2);color:var(--text);
border-radius:14px;padding:10px 12px;font-size:14px;outline:none;
}
textarea{min-height:72px;resize:vertical}
.row{display:flex;gap:10px;flex-wrap:wrap}
.row > *{flex:1 1 180px}
.btnRow{display:flex;gap:10px;flex-wrap:wrap;margin-top:10px}
button{
border:1px solid var(--border);background:rgba(255,255,255,.04);color:var(--text);
border-radius:14px;padding:10px 12px;font-size:14px;cursor:pointer;
}
button:hover{border-color:rgba(239,94,20,.55)}
button.primary{background:rgba(239,94,20,.18);border-color:rgba(239,94,20,.55)}
button.danger{background:rgba(255,90,95,.14);border-color:rgba(255,90,95,.45)}
button.ghost{background:transparent}
button.mini{padding:6px 8px;border-radius:12px;font-size:12px}
button:disabled{opacity:.55;cursor:not-allowed}
.chips{display:flex;gap:8px;flex-wrap:wrap;margin-top:6px}
.chip{border:1px solid var(--border);background:rgba(255,255,255,.03);color:var(--muted);border-radius:999px;padding:7px 10px;font-size:12px;cursor:pointer;user-select:none}
.chip.on{border-color:rgba(239,94,20,.60);background:rgba(239,94,20,.16);color:var(--text)}
.list{margin-top:10px;border:1px solid var(--border);border-radius:18px;overflow:hidden}
.li{display:flex;gap:10px;align-items:flex-start;justify-content:space-between;padding:10px 12px;background:rgba(255,255,255,.02);border-bottom:1px solid rgba(255,255,255,.05)}
.li:nth-child(even){background:rgba(239,94,20,.06)}
.li:last-child{border-bottom:none}
.liMain{min-width:0}
.liTop{display:flex;gap:8px;align-items:center;flex-wrap:wrap}
.amt{font-weight:900}
.tag{font-size:11px;color:var(--muted);border:1px solid rgba(255,255,255,.10);padding:2px 8px;border-radius:999px}
.note{margin-top:4px;color:var(--muted);font-size:12px;white-space:pre-wrap;word-break:break-word}
.liBtn
Open service 35.157.26.135:80 · pocket.tinyatdragon.com
2026-01-13 00:18
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:18:51 GMT Location: https://pocket.tinyatdragon.com/ Server: Netlify X-Nf-Request-Id: 01KETBGEJT4YTYDBW41QK3564B Content-Length: 47 Connection: close Redirecting to https://pocket.tinyatdragon.com/
Open service 35.157.26.135:80 · tamiltyping.musivalingam.com
2026-01-13 00:18
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:18:47 GMT Location: https://tamiltyping.musivalingam.com/ Server: Netlify X-Nf-Request-Id: 01KETBGASPVYS2EZGG0MFBP21T Content-Length: 52 Connection: close Redirecting to https://tamiltyping.musivalingam.com/
Open service 35.157.26.135:443 · tamiltyping.musivalingam.com
2026-01-13 00:18
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 4829
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:18:39 GMT
Etag: "0c988da9eb1122c3508f5023f22c4727-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBG3E28MK063E5VRX6ZWY4
Connection: close
Page title: Tamil Voice to Text Tamil Font or Tamil Unicode
<!DOCTYPE html>
<html lang="en">
<head>
<script async src="https://www.googletagmanager.com/gtag/js?id=G-D7B736K6N6"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-D7B736K6N6');
</script>
<meta charset="UTF-8" />
<meta http-equiv="Cache-Control" content="no-cache, no-store, must-revalidate" />
<meta http-equiv="Pragma" content="no-cache" />
<meta http-equiv="Expires" content="0" />
<!-- Google tag (gtag.js) -->
<meta charset="UTF-8">
<title>Tamil Voice to Text Tamil Font or Tamil Unicode</title>
<style>
body {
font-family: Arial, sans-serif;
margin: 20px;
}
.tabs {
width: 100%;
}
input[type="radio"] {
display: none;
}
.tab-label {
display: inline-block;
padding: 10px 20px;
margin-right: -4px;
background: #ddd;
cursor: pointer;
border: 1px solid #ccc;
border-bottom: none;
border-radius: 6px 6px 0 0;
}
.tab-content {
border: 1px solid #ccc;
padding: 20px;
background: #f9f9f9;
display: none;
border-radius: 0 0 6px 6px;
}
input[type="radio"]:checked + .tab-label {
background: white;
border-bottom: 1px solid white;
}
#tab1:checked ~ #content1,
#tab2:checked ~ #content2,
#tab3:checked ~ #content3 {
display: block;
}
textarea {
width: 98%;
height: 200px;
margin: 10px 0;
padding: 10px;
font-size: 19px;
white-space: pre-line;
}
button { padding: 10px 20px; font-size: 16px; margin: 3px; }
.smallButton { padding: 5px 10px; font-size: 14px; margin: 2px; }
#recordingIndicator { font-size: 24px; color: red; display: none; margin-top: 10px; }
@font-face {
font-family: 'Bamini';
src: url('Bamini.ttf') format('truetype');
}
@font-face {
font-family: 'BAMINI-Tamil18';
src: url('BAMINI-Tamil18.ttf') format('truetype');
}
</style>
<script src="script.js"></script>
</head>
<body>
<div style="text-align: center;">
<h1>தமிழ் -> Voice to Text </h1>
<h4>Tamil Voice typing to Tamil Font (true type font ttf) (பாமினி Bamini Font) (Editable)</h4>
<button onclick="startRecognition()">🎤 தொடங்கு</button>
<button onclick="stopRecognition()">⏹ நிறுத்து</button>
<div id="recordingIndicator">🔴 பதிவு செய்கிறது...</div>
</div>
<div class="tabs">
<!-- <input type="radio" name="tab" id="tab1" >
<label for="tab1" class="tab-label">Bamini Font (பாமினி)</label> -->
<input type="radio" name="tab" id="tab2" checked>
<label for="tab2" class="tab-label">Unicode (யூனிகோட்)</label>
<input type="radio" name="tab" id="tab3" >
<a class='tab-label' for='tab2' href='/tamilspeachtotext'>Bamini Font keyboard Style</a>
<!-- <input type="radio" name="tab" id="tab3">
<label for="tab3" class="tab-label">Tab 3</label> -->
<div id="content1" class="tab-content">
<div>
<textarea id="baminiOutput" style="font-family: bamini,baamini,kalaham;"></textarea>
<div>
<button onclick='copyAndAppendText("baminiOutput", "finalOutput")' class="smallButton"> 💾 Save</button>
<button onclick='copyTexToClip("baminiOutput")' class="smallButton"> 📋 Copy</button>
<button style="margin-left: 50px;" onclick='clearText("baminiOutput");stopRecognition();startRecognition()' class="smallButton"> ❌ Clear</button>
</div>
<div style="margin-top: 50px;">
<h4>Saved Content : </h4>
</div>
<div>
<button onclick="addQuotesToSelection()" class="smallButton">""</button>
<button onclick='insertAtCursor("!")' class="smallButton">! </button>
<button onclick='insertAtCursor(".")' class="smallButton
Open service 35.157.26.135:443 · betitutors.com
2026-01-13 00:18
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 25003
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:18:40 GMT
Etag: "be2ee31400a36dd06fdfb073b79c071e-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBG3TBC1KTR5CWQ9TP1ANN
Connection: close
Page title: Beti's Tutoring - Winnipeg
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<meta name="description" content="Professional tutoring services in Winnipeg for Math, Science, ELA, Biology, Chemistry and Physics. Online $30/hr, In-person $40/hr.">
<meta name="keywords" content="tutoring, Winnipeg, math tutor, science tutor, online tutoring, in-person tutoring, biology, chemistry, physics, ELA">
<title>Beti's Tutoring - Winnipeg</title>
<link rel="canonical" href="https://www.yourdomain.com" />
<script src="https://cdn.tailwindcss.com"></script>
<script>
tailwind.config = {
theme: {
extend: {
colors: {
primary: '#000000',
secondary: '#ffffff',
accent: '#333333',
}
}
}
}
</script>
<link href="https://unpkg.com/aos@2.3.1/dist/aos.css" rel="stylesheet">
<script src="https://unpkg.com/aos@2.3.1/dist/aos.js"></script>
<script src="https://cdn.jsdelivr.net/npm/feather-icons/dist/feather.min.js"></script>
<style>
html { scroll-behavior: smooth; }
.hero-bg {
display: grid;
grid-template-columns: 1fr 1fr;
min-height: 500px;
}
.hero-left, .hero-right {
background-size: cover;
background-position: center;
display: flex;
align-items: center;
justify-content: center;
padding: 2rem;
color: #fff;
text-align: center;
}
.hero-left {
background-image: linear-gradient(rgba(0,0,0,0.7), rgba(0,0,0,0.7)), url('http://static.photos/education/640x360/1');
}
.hero-right {
background-image: linear-gradient(rgba(0,0,0,0.7), rgba(0,0,0,0.7)), url('http://static.photos/education/640x360/2');
}
.subject-card:hover {
transform: translateY(-5px);
box-shadow: 0 10px 20px rgba(0, 0, 0, 0.1);
}
.faq-question {
cursor: pointer;
}
</style>
<!-- FAQ JSON-LD Schema -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "FAQPage",
"mainEntity": [
{
"@type": "Question",
"name": "How do online sessions work?",
"acceptedAnswer": {
"@type": "Answer",
"text": "I provide a Teams meeting link and students can join through there. The lessons are just as effective as in-person sessions."
}
},
{
"@type": "Question",
"name": "How can I book a tutoring session?",
"acceptedAnswer": {
"@type": "Answer",
"text": "Shoot an email to betimussie123@gmail.com or call me on my personal cell at (204) 951-1895."
}
},
{
"@type": "Question",
"name": "Can you provide homework help?",
"acceptedAnswer": {
"@type": "Answer",
"text": "I can provide help with school homework and also offer my own homework exercises for extra practice."
}
}
]
}
</script>
<!-- LocalBusiness Schema -->
<script type="application/ld+json">
{
"@context": "https://schema.org",
"@type": "TutoringSchool",
"name": "Beti's Tutoring",
"image": "http://static.photos/education/640x360/1",
"address": {
"@type": "PostalAddress",
"streetAddress": "Winnipeg",
"addressLocality": "Winnipeg",
"addressRegion": "MB",
"postalCode": "R3X",
"addressCountry": "CA"
},
"telephone": "(204) 951-1895",
"email": "betimussie123@gmail.com",
"url": "https://www.yourdomain.com",
"priceRange": "$30-$40 per hour"
}
</script>
</head>
<body class="bg-secondary text-primary font-sans">
<!-- Navigation -->
<nav class="bg-primar
Open service 35.157.26.135:80 · betitutors.com
2026-01-13 00:18
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:18:46 GMT Location: https://betitutors.com/ Server: Netlify X-Nf-Request-Id: 01KETBGAJ44355PVWVW2K26WEZ Content-Length: 38 Connection: close Redirecting to https://betitutors.com/
Open service 35.157.26.135:80 · lolboxno1.com
2026-01-13 00:18
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:18:27 GMT Location: https://lolboxno1.com/ Server: Netlify X-Nf-Request-Id: 01KETBFQW9GD9Q4DBR1NF1DZBH Content-Length: 37 Connection: close Redirecting to https://lolboxno1.com/
Open service 35.157.26.135:443 · lolboxno1.com
2026-01-13 00:18
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 9015
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:18:20 GMT
Etag: "a1c03f2f49e1639553aec602094db315-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBFGDHPBHZNGEHZ6PZR63M
Connection: close
Page title: 홈 - 세이프트레이드
<!DOCTYPE html>
<html lang="ko">
<head>
<meta charset="utf-8"/>
<title>홈 - 세이프트레이드</title>
<link href="styles.css" rel="stylesheet"/>
<style>
.menu-grid {
display: grid;
grid-template-columns: repeat(auto-fit, minmax(180px, 1fr));
gap: 20px;
margin: 40px auto;
max-width: 1000px;
}
.menu-card {
background-color: #121212;
border: 1px solid #2c2c2c;
border-radius: 10px;
padding: 20px;
color: white;
}
.menu-card small {
display: block;
margin-bottom: 10px;
color: #999;
}
.menu-card h3 {
margin: 0 0 10px;
font-size: 1.2rem;
}
.menu-card p {
font-size: 0.9rem;
color: #ccc;
}
.menu-card a {
display: inline-block;
margin-top: 15px;
background-color: #00cc99;
color: white;
padding: 8px 16px;
border-radius: 5px;
text-decoration: none;
}
.chart-container {
max-width: 1200px;
margin: 50px auto;
}
iframe {
width: 100%;
height: 600px;
border: none;
border-radius: 10px;
}
.search-bar {
text-align: center;
margin-bottom: 20px;
}
.search-bar input {
width: 200px;
padding: 10px;
font-size: 1rem;
border-radius: 5px;
border: 1px solid #555;
background-color: #1f1f1f;
color: white;
}
.search-bar button {
padding: 10px 16px;
margin-left: 10px;
font-size: 1rem;
background-color: #00cc99;
color: white;
border: none;
border-radius: 5px;
cursor: pointer;
}
.search-bar button:hover {
background-color: #00b38f;
}
</style>
</head>
<body>
<!-- 네비게이션 바 -->
<div class="navbar">
<a href='/safetrade'>세이프트레이드</a>
<a href='/alex'>알렉스</a>
<a href='/stock'>주식 소식</a>
<a href='/community'>커뮤니티</a>
<a href='/news' target='_self'>비트코인 창시자</a>
</div>
<!-- 메뉴 카드 -->
<div class="chart-container">
<div class="menu-card">
<h3>세이프트레이드(SafeTrade)</h3>
<p><strong>세이프트레이드(SafeTrade)</strong>는 암호화폐 및 주식 투자자를 위한 자동화 수익 프로그램 및 정보 제공 플랫폼으로,
특히 테더(USDT) 같은 스테이블코인, 비트코인(BTC) 등의 실시간 시세와 국내외 가격 차이를 분석하여 수익을 극대화하는 구조입니다.</p>
또는 괴리율을 자동 감지하고, 이를 이용한 롱-숏 전략을 실행합니다. 예를 들어, 해외 거래소에서는 숏 포지션, 국내에서는 매수(롱) 포지션을
동시에 잡아 가격 변동과 무관하게 차익을 실현할 수 있는 구조입니다.</p>
<p>이 모든 거래는 사용자의 <strong>개인 계정에 연결된 API(Application Programming Interface)</strong>를 통해 이루어지며,
시세 조회, 주문 실행, 자산 이동까지 자동으로 처리됩니다. 특히 자산은 항상 고객 계정 내에서만 운용되며, 회사 계정으로의 이체나 예치 요구는
일절 없습니다, 이는 보안과 신뢰성 면에서 큰 강점입니다.</p>
<p>API 설정은 사용자가 직접 출금 권한 여부를 제어할 수 있으며, 자동화 기능이 필요 없는 경우 해당 항목은 체크 해제하고 사용 가능합니다.
이를 통해, 원하지 않는 접근이나 자산 이동을 방지할 수 있습니다.</p>
<p>또한, 세이프트레이드는 주식 시장 급등 종목, 암호화폐 시황, 비트코인 창시자 콘텐츠, 커뮤니티 의견까지
Open service 35.157.26.135:443 · ositosbendecidos.com
2026-01-13 00:17
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 2532
Content-Security-Policy: default-src 'self' https: data: 'unsafe-inline' 'unsafe-eval'; connect-src 'self' https://*.supabase.co https://api.stripe.com https://api.iconify.design https://api.unisvg.com https://api.simplesvg.com; frame-src https://checkout.stripe.com https://www.paypal.com https://js.stripe.com
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:17:57 GMT
Etag: "2accf94ca2920080b495b641d0fbf91b-ssl"
Permissions-Policy: geolocation=(), microphone=(), camera=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETBESVEK5M9WC02ZYDR4ACC
X-Xss-Protection: 1; mode=block
Connection: close
Page title: Ositos Bendecidos - Building Communities Through Faith
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/png" href="/ositos-logo-gold.png?v=4" />
<link rel="apple-touch-icon" href="/ositos-logo-gold.png?v=4" />
<meta name="theme-color" content="#FFD700" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Ositos Bendecidos - Building Communities Through Faith</title>
<!-- Primary Meta Tags -->
<meta name="title" content="Ositos Bendecidos - Building Communities Through Faith">
<meta name="description" content="Building communities through faith, empowerment, and mutual support across America. God's blessing is the best value—it's free.">
<!-- Open Graph / Facebook / Instagram / WhatsApp -->
<meta property="og:type" content="website">
<meta property="og:url" content="https://ositosbendecidos.com/">
<meta property="og:title" content="Ositos Bendecidos - Building Communities Through Faith">
<meta property="og:description" content="Building communities through faith, empowerment, and mutual support across America. God's blessing is the best value—it's free.">
<meta property="og:image" content="https://ositosbendecidos.com/og-image.jpg">
<meta property="og:image:width" content="1200">
<meta property="og:image:height" content="630">
<meta property="og:site_name" content="Ositos Bendecidos">
<meta property="og:locale" content="en_US">
<!-- Twitter / X -->
<meta property="twitter:card" content="summary_large_image">
<meta property="twitter:url" content="https://ositosbendecidos.com/">
<meta property="twitter:title" content="Ositos Bendecidos - Building Communities Through Faith">
<meta property="twitter:description" content="Building communities through faith, empowerment, and mutual support across America. God's blessing is the best value—it's free.">
<meta property="twitter:image" content="https://ositosbendecidos.com/og-image.jpg">
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Cinzel:wght@600;700;800;900&family=Inter:wght@400;500;600;700&display=swap" rel="stylesheet">
<script type="module" crossorigin src="/assets/index-gySgMh1v.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CUvRYJst.css">
</head>
<body class="dark">
<div id="root"></div>
</body>
</html>
/* Force cache clear */
Open service 35.157.26.135:80 · ositosbendecidos.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:18:05 GMT Location: https://ositosbendecidos.com/ Server: Netlify X-Nf-Request-Id: 01KETBF1SGSTHDJJNJCE3ZBW85 Content-Length: 44 Connection: close Redirecting to https://ositosbendecidos.com/
Open service 35.157.26.135:80 · www.ositosbendecidos.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:18:04 GMT Location: https://www.ositosbendecidos.com/ Server: Netlify X-Nf-Request-Id: 01KETBF16Q01PYFBF45BMMNW16 Content-Length: 48 Connection: close Redirecting to https://www.ositosbendecidos.com/
Open service 35.157.26.135:443 · www.ositosbendecidos.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:56 GMT Location: https://ositosbendecidos.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBESB955WGMFAGQ2E3AZTE Content-Length: 44 Connection: close Redirecting to https://ositosbendecidos.com/
Open service 35.157.26.135:443 · whisply.co
2026-01-13 00:17
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1132
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:17:34 GMT
Etag: "416ad431f419ab4a9db97425915a9d3a-ssl"
Permissions-Policy: camera=(), microphone=(), geolocation=()
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETBE433Q7MZN26ZJ4FZ40AC
Connection: close
Page title: whisply
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>whisply</title>
<link rel="icon" type="image/svg+xml" href="/logo.svg" />
<link rel="alternate icon" type="image/x-icon" href="/favicon.ico" />
<link rel="manifest" href="/manifest.webmanifest?v=3" />
<meta name="theme-color" content="#0f172a" />
<meta name="mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-capable" content="yes" />
<meta name="apple-mobile-web-app-status-bar-style" content="black-translucent" />
<link rel="apple-touch-icon" href="/logo.svg" />
<script async src="https://pagead2.googlesyndication.com/pagead/js/adsbygoogle.js?client=ca-pub-7401192886022280"
crossorigin="anonymous"></script>
<script type="module" crossorigin src="/assets/index-B6oizAS2.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-CneVic9i.css">
</head>
<body class="min-h-screen bg-gradient-to-br from-slate-900 via-indigo-900 to-slate-800 text-slate-100">
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.whisply.co
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:41 GMT Location: https://www.whisply.co/ Server: Netlify X-Nf-Request-Id: 01KETBEAXM6GDC6JMFRRHQKSJ3 Content-Length: 38 Connection: close Redirecting to https://www.whisply.co/
Open service 35.157.26.135:443 · www.whisply.co
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:33 GMT Location: https://whisply.co/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBE34C561B6A0947TY3GDY Content-Length: 34 Connection: close Redirecting to https://whisply.co/
Open service 35.157.26.135:80 · whisply.co
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:43 GMT Location: https://whisply.co/ Server: Netlify X-Nf-Request-Id: 01KETBEC7MXAY0Y3FM9T3J9A4B Content-Length: 34 Connection: close Redirecting to https://whisply.co/
Open service 35.157.26.135:80 · www.mellytek.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:36 GMT Location: https://www.mellytek.com/ Server: Netlify X-Nf-Request-Id: 01KETBE65FD8H88XJZJY21JFGB Content-Length: 40 Connection: close Redirecting to https://www.mellytek.com/
Open service 35.157.26.135:443 · www.mellytek.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:27 GMT Location: https://mellytek.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBDWRJBNK9VQF4A6G5B4KP Content-Length: 36 Connection: close Redirecting to https://mellytek.com/
Open service 35.157.26.135:443 · www.balihaisystem.online
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:27 GMT Location: https://balihaisystem.online/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBDX5FVW05ZXGVAB0N9TPA Content-Length: 44 Connection: close Redirecting to https://balihaisystem.online/
Open service 35.157.26.135:80 · www.balihaisystem.online
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:36 GMT Location: https://www.balihaisystem.online/ Server: Netlify X-Nf-Request-Id: 01KETBE5T6WN6Y9K8FBJ3RBVRP Content-Length: 48 Connection: close Redirecting to https://www.balihaisystem.online/
Open service 35.157.26.135:80 · www.hytalefans.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:30 GMT Location: https://www.hytalefans.com/ Server: Netlify X-Nf-Request-Id: 01KETBE03DZX0KDT0F31JNSF27 Content-Length: 42 Connection: close Redirecting to https://www.hytalefans.com/
Open service 35.157.26.135:443 · www.hytalefans.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:22 GMT Location: https://hytalefans.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBDQYTAN35APN8QT2RWRA4 Content-Length: 38 Connection: close Redirecting to https://hytalefans.com/
Open service 35.157.26.135:80 · keckcontractingkc.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:30 GMT Location: https://keckcontractingkc.com/ Server: Netlify X-Nf-Request-Id: 01KETBDZK338EG027QT6BTCGHM Content-Length: 45 Connection: close Redirecting to https://keckcontractingkc.com/
Open service 35.157.26.135:443 · keckcontractingkc.com
2026-01-13 00:17
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 17690
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:17:21 GMT
Etag: "509e4be7997364ed6b3f8cc13c23f4ad-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBDPWP0PD36A5J2WFTKJ8M
Connection: close
Page title: Keck Contracting | Kansas City General Contractor
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<meta name="description" content="Keck Contracting - Full-service general contractor in Kansas City. Commercial & residential property maintenance, remodeling, and property management services. Fully insured.">
<title>Keck Contracting | Kansas City General Contractor</title>
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700&display=swap" rel="stylesheet">
<link rel="stylesheet" href="css/styles.css">
</head>
<body>
<!-- Header -->
<header class="header">
<div class="container header-inner">
<a class='logo' href='/'>
<img src="images/logo.png" alt="Keck Contracting">
</a>
<nav class="nav">
<button class="nav-toggle" aria-label="Toggle navigation">
<span></span>
<span></span>
<span></span>
</button>
<ul class="nav-menu">
<li><a class='active' href='/'>Home</a></li>
<li><a href='/services'>Services</a></li>
<li><a href='/gallery'>Our Work</a></li>
<li><a href='/about'>About</a></li>
<li><a href='/contact'>Contact</a></li>
</ul>
</nav>
<a href="tel:816-281-6901" class="header-phone">
<svg xmlns="http://www.w3.org/2000/svg" width="20" height="20" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round"><path d="M22 16.92v3a2 2 0 0 1-2.18 2 19.79 19.79 0 0 1-8.63-3.07 19.5 19.5 0 0 1-6-6 19.79 19.79 0 0 1-3.07-8.67A2 2 0 0 1 4.11 2h3a2 2 0 0 1 2 1.72 12.84 12.84 0 0 0 .7 2.81 2 2 0 0 1-.45 2.11L8.09 9.91a16 16 0 0 0 6 6l1.27-1.27a2 2 0 0 1 2.11-.45 12.84 12.84 0 0 0 2.81.7A2 2 0 0 1 22 16.92z"></path></svg>
(816) 281-6901
</a>
</div>
</header>
<!-- Hero Section -->
<section class="hero">
<div class="container">
<div class="hero-content">
<h1>Quality Contracting Services in Kansas City</h1>
<p>Full-service property maintenance, remodeling, and management for commercial and residential properties. Fully insured and committed to exceeding your expectations.</p>
<div class="hero-cta">
<a href="tel:816-281-6901" class="btn btn-primary">Call (816) 281-6901</a>
<a class='btn btn-secondary' href='/services'>View Services</a>
</div>
</div>
</div>
</section>
<!-- Trust Badges -->
<section class="trust-bar">
<div class="container">
<div class="trust-items">
<div class="trust-item">
<svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round"><path d="M12 22s8-4 8-10V5l-8-3-8 3v7c0 6 8 10 8 10z"></path></svg>
<span>Fully Insured</span>
</div>
<div class="trust-item">
<svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round"><path d="M3 9l9-7 9 7v11a2 2 0 0 1-2 2H5a2 2 0 0 1-2-2z"></path><polyline points="9 22 9 12 15 12 15 22"></polyline></svg>
<span>Residential & Commercial</span>
</div>
<div class="trust-item">
<svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round"><circle
Open service 35.157.26.135:443 · abstractphotorealism.com
2026-01-13 00:17
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 10540
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:17:11 GMT
Etag: "7cd6a2a28bbbf9404ce7c342b9a0ad66-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBDD0J2DVTDYQ8MRMV7NAC
Connection: close
Page title: Abstract Photorealism™ | Cinematic Nautical Art
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- GOOGLE VERIFICATION -->
<!-- When you have your Google Search Console meta tag, paste it on the next line, e.g.:
<meta name="google-site-verification" content="YOUR_CODE_HERE" />
-->
<title>Abstract Photorealism™ | Cinematic Nautical Art</title>
<meta name="description" content="Abstract Photorealism™ — a luxury digital art studio blending cinematic composition, nautical influence, and surreal photorealism. Explore exclusive collections, cinematic stories, and curated underwater art." />
<!-- Connect domain to YouTube identity -->
<link rel="me" href="https://www.youtube.com/@AbstractPhotorealism" />
<style>
* {
box-sizing: border-box;
}
body {
margin: 0;
padding: 0;
background: #0a0f14;
color: #ffffff;
font-family: "Helvetica Neue", Arial, sans-serif;
overflow-x: hidden;
}
.page-wrapper {
min-height: 100vh;
display: flex;
flex-direction: column;
}
.hero {
min-height: 70vh;
background:
linear-gradient(to bottom right, rgba(7, 10, 15, 0.9), rgba(7, 10, 15, 0.6)),
url("https://images.unsplash.com/photo-1507525428034-b723cf961d3e?auto=format&fit=crop&w=1950&q=80");
background-size: cover;
background-position: center;
display: flex;
flex-direction: column;
justify-content: center;
padding: 0 8%;
position: relative;
}
.hero-content {
max-width: 780px;
}
.brand-title {
font-size: 3.3rem;
font-weight: 700;
margin: 0 0 10px 0;
letter-spacing: 2px;
text-transform: uppercase;
}
.brand-subtitle {
font-size: 1.1rem;
font-weight: 300;
line-height: 1.7;
margin: 0;
}
.cta-group {
margin-top: 32px;
display: flex;
flex-wrap: wrap;
gap: 14px;
}
.cta-button {
display: inline-block;
padding: 14px 28px;
background: #ff0000;
color: #ffffff;
text-decoration: none;
font-size: 0.98rem;
letter-spacing: 0.5px;
border-radius: 4px;
border: 1px solid rgba(255, 255, 255, 0.18);
transition: background 0.3s ease, transform 0.2s ease, box-shadow 0.2s ease;
text-align: center;
}
.cta-button.secondary {
background: #1e90ff;
}
.cta-button:hover {
transform: translateY(-1px);
box-shadow: 0 8px 18px rgba(0, 0, 0, 0.5);
}
.cta-button.primary:hover {
background: #cc0000;
}
.cta-button.secondary:hover {
background: #0f6ad1;
}
.video-section {
background-color: #05070b;
padding: 40px 8% 20px 8%;
}
.video-inner {
max-width: 960px;
margin: 0 auto;
}
.video-title {
font-size: 1.4rem;
font-weight: 600;
margin: 0 0 16px 0;
}
.video-subtext {
font-size: 0.98rem;
opacity: 0.8;
margin: 0 0 18px 0;
}
.video-wrapper {
position: relative;
padding-bottom: 56.25%;
height: 0;
overflow: hidden;
border-radius: 8px;
box-shadow: 0 18px 45px rgba(0, 0, 0, 0.7);
}
.video-wrapper iframe {
position: absolute;
top: 0;
Open service 35.157.26.135:80 · abstractphotorealism.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:19 GMT Location: https://abstractphotorealism.com/ Server: Netlify X-Nf-Request-Id: 01KETBDMTG5DEV70R6NMB0SDG2 Content-Length: 48 Connection: close Redirecting to https://abstractphotorealism.com/
Open service 35.157.26.135:443 · trumanheberle.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:07 GMT Location: https://www.trumanheberle.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBD9SP8GWGK5WQXHCD7VW2 Content-Length: 45 Connection: close Redirecting to https://www.trumanheberle.com/
Open service 35.157.26.135:80 · trumanheberle.com
2026-01-13 00:17
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:17:15 GMT Location: https://trumanheberle.com/ Server: Netlify X-Nf-Request-Id: 01KETBDHFMC6ZN9NJRQ4C1XSN5 Content-Length: 41 Connection: close Redirecting to https://trumanheberle.com/
Open service 35.157.26.135:443 · www.beforeafterpic.com
2026-01-13 00:16
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1658
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:16:46 GMT
Etag: "25405de5723934e4bd0f796c18d40fae-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBCN2FS3NF6R962B23VPPK
Connection: close
Page title: Before | After
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<!-- TODO: Set the document title to the name of your application -->
<title>Before | After</title>
<meta name="description" content="Generate a free before and after image.">
<meta name="author" content="Lovable" />
<!-- TODO: Update og:title to match your application name -->
<meta property="og:type" content="website" />
<meta property="og:image" content="https://storage.googleapis.com/gpt-engineer-file-uploads/kkARH5MXLQcZjEW9jP3SDlUcVQl1/social-images/social-1768263024622-Untitled design (4).jpg">
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:site" content="@Lovable" />
<meta name="twitter:image" content="https://storage.googleapis.com/gpt-engineer-file-uploads/kkARH5MXLQcZjEW9jP3SDlUcVQl1/social-images/social-1768263024622-Untitled design (4).jpg">
<meta property="og:title" content="Before | After">
<meta name="twitter:title" content="Before | After">
<meta property="og:description" content="Generate a free before and after image.">
<meta name="twitter:description" content="Generate a free before and after image.">
<link rel="icon" type="image/x-icon" href="https://storage.googleapis.com/gpt-engineer-file-uploads/kkARH5MXLQcZjEW9jP3SDlUcVQl1/uploads/1768263021504-favicon.jpg">
<script type="module" crossorigin src="/assets/index-DQuCKvob.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-DAMkrQuy.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.beforeafterpic.com
2026-01-13 00:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:55 GMT Location: https://www.beforeafterpic.com/ Server: Netlify X-Nf-Request-Id: 01KETBCXJVXCMQHQ1KV1P715F6 Content-Length: 46 Connection: close Redirecting to https://www.beforeafterpic.com/
Open service 35.157.26.135:443 · chaveirimcherryhill.com
2026-01-13 00:16
HTTP/1.1 200 OK Age: 5180593 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 43050 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:45 GMT Etag: "nmrb869dzxx7t" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: rsc,next-router-state-tree,next-router-prefetch,next-router-segment-prefetch,Accept-Encoding X-Content-Type-Options: nosniff X-Nextjs-Date: Mon, 15 Dec 2025 07:37:35 GMT X-Nextjs-Prerender: 1, 1 X-Nextjs-Stale-Time: 300 X-Nf-Request-Id: 01KETBCKH93CT8EF5W0GQSF7RH X-Powered-By: Next.js Connection: close Page title: Chaveirim of Cherry Hill - 24/6 Emergency Volunteer Services | Free Roadside Assistance NJ <!DOCTYPE html><!--6FQsdow2MNujmLr4o_ROS--><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=5"/><link rel="preload" href="/_next/static/media/797e433ab948586e-s.p.dbea232f.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/caa3a2e1cccd8315-s.p.853070df.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" as="image" href="https://chvrm.org/wp-content/uploads/2021/01/WhatsApp-Image-2019-01-31-at-11.24.21-AM.jpeg"/><link rel="preload" as="image" href="/IMG_1044.jpg"/><link rel="preload" as="image" href="https://donations.chaverim5t.org/wp-content/uploads/2022/07/WhatsApp-Image-2022-07-28-at-9.51.43-AM-1-768x768.jpeg"/><link rel="preload" as="image" href="/3c0ad63e-38cb-4bd9-9b18-0336db17e47e.png"/><link rel="stylesheet" href="/_next/static/chunks/fef02fcd94ea3972.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/c33d1971a7c5f9aa.js"/><script src="/_next/static/chunks/af984078aa3a48ea.js" async=""></script><script src="/_next/static/chunks/17b546d10c0cd2de.js" async=""></script><script src="/_next/static/chunks/turbopack-0c1ba5813a028d95.js" async=""></script><script src="/_next/static/chunks/42879de7b8087bc9.js" async=""></script><script src="/_next/static/chunks/01b468759b5f621a.js" async=""></script><meta name="next-size-adjust" content=""/><title>Chaveirim of Cherry Hill - 24/6 Emergency Volunteer Services | Free Roadside Assistance NJ</title><meta name="description" content="Chaveirim of Cherry Hill provides free 24/6 emergency roadside assistance, lockout services, search & rescue, and community support to residents of Cherry Hill, New Jersey. Call (856) 436-7800 for immediate help."/><meta name="author" content="Chaveirim of Cherry Hill"/><link rel="manifest" href="/site.webmanifest"/><meta name="keywords" content="Chaveirim Cherry Hill,Cherry Hill emergency services,roadside assistance Cherry Hill NJ,free towing Cherry Hill,lockout service Cherry Hill,jump start Cherry Hill,flat tire help Cherry Hill,community volunteers Cherry Hill,Jewish community services NJ,emergency help Cherry Hill,24/6 assistance New Jersey,search and rescue Cherry Hill,volunteer services NJ"/><meta name="creator" content="Chaveirim of Cherry Hill"/><meta name="publisher" content="Chaveirim of Cherry Hill"/><meta name="robots" content="index, follow"/><meta name="googlebot" content="index, follow, max-video-preview:-1, max-image-preview:large, max-snippet:-1"/><meta name="category" content="Emergency Services"/><link rel="canonical" href="https://chaveirimcherryhill.com"/><meta property="og:title" content="Chaveirim of Cherry Hill - 24/6 Emergency Volunteer Services"/><meta property="og:description" content="Free 24/6 emergency roadside assistance, lockout services, search & rescue, and community support in Cherry Hill, NJ. Call (856) 436-7800 for immediate help."/><meta property="og:url" content="https://chaveirimcherryhill.com"/><meta property="og:site_name" content="Chaveirim of Cherry Hill"/><meta property="og:locale" content="en_US"/><meta property="og:image" content="https://chaveirimcherryhill.com/3c0ad63e-38cb-4bd9-9b18-0336db17e47e.png"/><meta property="og:image:width" content="1200"/><meta property="og:image:height" content="630"/><meta property="og:image:alt" content="Chaveirim of Cherry Hill - Emergency Volunteer Services"/><meta property="og:type" content="website"/><meta name="twitter:card" content="summary_large_image"/><meta name="twitter:title" content="Chaveirim of Cherry Hill - 24/6 Emergency Services"/><meta name="twitter:description" content="Free emergency roadside assistance & community support in Cherry Hill, NJ. Available 24/6. Call (856) 436-7800"/><meta name="twitter:image" content="https://chaveirimcherryhill.com/3c0ad63e-38cb-4bd9-9b18-0336db17e47e.png"/><link rel="icon" href="/favicon.ico?favicon.ab72a2fa.ico" sizes="48x48" type="image/x-icon"/><link rel="icon" href="/3c0ad63e-38cb-4bd9-9b18-0336db17e47e.p
Open service 35.157.26.135:80 · chaveirimcherryhill.com
2026-01-13 00:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:51 GMT Location: https://chaveirimcherryhill.com/ Server: Netlify X-Nf-Request-Id: 01KETBCT7ZSR7MG3NSFXPYXDTW Content-Length: 47 Connection: close Redirecting to https://chaveirimcherryhill.com/
Open service 35.157.26.135:80 · mellytek.com
2026-01-13 00:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:46 GMT Location: https://mellytek.com/ Server: Netlify X-Nf-Request-Id: 01KETBCN6HSST5DF6S3ER75BBH Content-Length: 36 Connection: close Redirecting to https://mellytek.com/
Open service 35.157.26.135:443 · mellytek.com
2026-01-13 00:16
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 26821
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:16:38 GMT
Etag: "650a509e33fe31b92c831b7bb0721ea6-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBCD5KQ8B1W8G3CZ4GN3A2
Connection: close
Page title: Mellytek
<!doctype html>
<html lang="en">
<head>
<!-- Required Meta Tags -->
<meta charset="utf-8">
<meta name="viewport" content="width=device-width, initial-scale=1">
<!-- Document Title, Description, and Author -->
<title>Mellytek</title>
<meta name="description" content="Mellytek website">
<!-- Favicon and Touch Icons -->
<link rel="icon" type="image/png" sizes="512x512" href="./assets/favicon/mellytek-favicon-black.png">
<!-- Google Fonts Files -->
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Oswald:wght@200;300;400;500;600;700&family=Satisfy&display=swap" rel="stylesheet">
<link rel="stylesheet" href="https://cdn.jsdelivr.net/npm/bootstrap-icons@1.11.3/font/bootstrap-icons.min.css">
<!-- CSS Files -->
<link rel="stylesheet" href="./assets/css/wave-bsb.css">
<link rel="stylesheet" href="./assets/css/custom.css">
<style>
.background {
padding: 80px 0px;
background-image: url(./assets/img/slide-02.jpg);
background-position: center center;
background-repeat: no-repeat;
background-size: cover;
}
</style>
<!-- BSB Head -->
</head>
<body data-bs-spy="scroll" data-bs-target="#bsb-tpl-navbar" data-bs-smooth-scroll="true" tabindex="0">
<!-- Header -->
<header id="header" class="sticky-top bsb-tpl-header-sticky bsb-tpl-header-sticky-animationX">
<!-- Navbar 1 - Bootstrap Brain Component -->
<nav id="homeSection" class="navbar navbar-expand-lg bsb-tpl-bg-blue bsb-navbar bsb-navbar-hover bsb-navbar-caret bsb-tpl-navbar-sticky" data-bsb-sticky-target="#header">
<div class="container">
<a class='navbar-brand' href='/'>
<img src="./assets/logo/logo-no-background.png" class="logo" alt="Mellytek-Logo" style="width:160px; height: auto; padding-top: 5px;">
</a>
<button class="navbar-toggler border-0" type="button" data-bs-toggle="offcanvas" data-bs-target="#offcanvasNavbar" aria-controls="offcanvasNavbar">
<svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" fill="currentColor" class="bi bi-list" viewBox="0 0 16 16">
<path fill-rule="evenodd" d="M2.5 12a.5.5 0 0 1 .5-.5h10a.5.5 0 0 1 0 1H3a.5.5 0 0 1-.5-.5zm0-4a.5.5 0 0 1 .5-.5h10a.5.5 0 0 1 0 1H3a.5.5 0 0 1-.5-.5zm0-4a.5.5 0 0 1 .5-.5h10a.5.5 0 0 1 0 1H3a.5.5 0 0 1-.5-.5z" />
</svg>
</button>
<div class="offcanvas offcanvas-end" tabindex="-1" id="offcanvasNavbar" aria-labelledby="offcanvasNavbarLabel">
<div class="offcanvas-header">
<h5 class="offcanvas-title" id="offcanvasNavbarLabel">Menu</h5>
<button type="button" class="btn-close" data-bs-dismiss="offcanvas" aria-label="Close"></button>
</div>
<div class="offcanvas-body">
<ul id="bsb-tpl-navbar" class="navbar-nav justify-content-end flex-grow-1">
<li class="nav-item">
<a class="nav-link active" href="#homeSection" aria-current="page" data-bs-dismiss="offcanvas" data-bs-target="#offcanvasNavbar">Home</a>
</li>
<li class="nav-item">
<a class="nav-link" href="#servicesSection" data-bs-dismiss="offcanvas" data-bs-target="#offcanvasNavbar">Services</a>
</li>
<li class="nav-item">
<a class="nav-link" href="#contactSection" data-bs-dismiss="offcanvas" data-bs-target="#offcanvasNavbar">Contact</a>
</li>
</ul>
</div>
</div>
</div>
</nav>
</header>
<!-- Hero 2 - Bootstrap Brain Component -->
<section id="scrollspyHero" class="bsb-hero-2 bsb-tpl-bg-blue py-5 py-xl-8 py-xxl-10">
<div class="container overflow-hidden">
<div class="row gy-3 gy-lg-0 align-items-lg-center justify-content-lg-center">
<div class="col-12 order-1 order-lg-0 text-center auto-carousel">
<h1 class="display-3 fw-bolder mb-3">We <mark class="bsb-tpl-highlight bsb-tpl-highlight-blue"><s
Open service 35.157.26.135:80 · phoenixpublicadjustingfl.com
2026-01-13 00:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:43 GMT Location: https://phoenixpublicadjustingfl.com/ Server: Netlify X-Nf-Request-Id: 01KETBCJ5DPA0C9CN2YAPT7NP8 Content-Length: 52 Connection: close Redirecting to https://phoenixpublicadjustingfl.com/
Open service 35.157.26.135:443 · phoenixpublicadjustingfl.com
2026-01-13 00:16
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 5187
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:16:34 GMT
Etag: "572a43bf5146d5c141bc97cf41dd60c9-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBC9MH9ZMD1E77GQ3PYZCJ
Connection: close
Page title: Phoenix Public Adjusting | Florida Public Adjuster
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<title>Phoenix Public Adjusting | Florida Public Adjuster</title>
<meta name="description" content="Phoenix Public Adjusting — Public Adjuster serving Florida. Fire, water, hurricane, roof & mold claims. Free claim review: 904-994-5237.">
<link rel="stylesheet" href="styles.css" />
</head>
<body>
<!-- Top bar -->
<div class="topbar">
<div class="container wrap">
<div>Florida • Public Adjusting</div>
<a class="btn" href="tel:+19049945237">Call 904-994-5237</a>
</div>
</div>
<!-- Header -->
<header>
<div class="container wrap">
<a class="brand" href="#home">
<img src="assets/phoenix-logo.png" alt="Phoenix Public Adjusting logo">
<div>
<div class="name">Phoenix Public Adjusting</div>
<div class="small">Licensed Public Adjuster — License # P043216</div>
</div>
</a>
<nav>
<a href="#about">About</a>
<a href="#services">Services</a>
<a href="#process">Process</a>
<a href="#faqs">FAQs</a>
<a href="#contact">Contact</a>
</nav>
<a class="btn" href="#contact">Free Claim Review</a>
</div>
</header>
<!-- Hero -->
<section id="home" class="hero">
<div class="container inner">
<h1>Public Adjuster in Florida — Phoenix Public Adjusting</h1>
<p class="lead">We represent you—not the insurance company. Fire • Water • Hurricane • Roof • Mold.</p>
<div style="margin-top:20px;display:flex;gap:12px;flex-wrap:wrap">
<a class="btn" href="#contact">Start Free Review</a>
<a class="btn" href="tel:+19049945237">Call 904-994-5237</a>
</div>
<div style="margin-top:14px">
<span class="badge">Licensed Public Adjuster • License # P043216</span>
<span class="badge">Local • Florida</span>
<span class="badge">No Recovery, No Fee*</span>
</div>
</div>
</section>
<!-- About -->
<section id="about">
<div class="container">
<h2>About Phoenix Public Adjusting</h2>
<p class="lead">We advocate for your home insurance claim—so you can rise, rebuild, and recover.</p>
<div class="grid two" style="margin-top:18px">
<div class="card">
<h3 style="margin:0 0 8px">What We Bring</h3>
<ul class="lead" style="margin:0;padding-left:18px">
<li>Expertise in fire, water, hurricane, roof, and mold claims.</li>
<li>Detailed documentation & policy analysis to build airtight claims.</li>
<li>Skilled negotiation to secure maximum payouts.</li>
<li>Clear communication and advocacy at every step.</li>
</ul>
</div>
<div class="card">
<h3 style="margin:0 0 8px">Contact</h3>
<p class="lead">Phone: <a href="tel:+19049945237">904-994-5237</a><br>
Email: <a href="mailto:richpublicadjusting@gmail.com">richpublicadjusting@gmail.com</a></p>
</div>
</div>
</div>
</section>
<!-- Contact -->
<section id="contact">
<div class="container">
<h2>Start Your Free Review</h2>
<div class="grid two" style="margin-top:18px">
<form class="card" name="contact">
<label>Full name<input name="name" placeholder="Your name"></label>
<label>Phone<input name="phone" placeholder="(###) ###-####"></label>
<label>Email<input type="email" name="email" placeholder="you@example.com"></label>
<label>Claim type<select name="claim"><option>Water</option><option>Fire</option><option>Hurricane/Wind</option><option>Roof</option><option>Mold</option><option>Other</option></select></label>
<label>Tell me a bit<textarea rows="5" name="message" placeholder="What happened?"></textarea></label>
<div style="margin-top:12px;display:flex;gap:10px;flex-wrap:wrap">
<a class="btn" href="mailto:richpublicadjusting@gmail.com?subject=Free%20Claim%20Review">Emai
Open service 35.157.26.135:80 · kindcompanion.chat
2026-01-13 00:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:25 GMT Location: https://kindcompanion.chat/ Server: Netlify X-Nf-Request-Id: 01KETBC03A0XJTQ19Z69WFAE6P Content-Length: 42 Connection: close Redirecting to https://kindcompanion.chat/
Open service 35.157.26.135:443 · kindcompanion.chat
2026-01-13 00:16
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 11827
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:16:17 GMT
Etag: "51cdf7382e1ceaa7b77a3be56e8d0161-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBBR8GCFWHBCSB2VBRJJMB
Connection: close
Page title: KindCompanion — Calm, private AI conversation on WhatsApp
<!doctype html>
<html lang="en">
<head>
<title>KindCompanion — Calm, private AI conversation on WhatsApp</title>
<link rel="icon" type="image/png" href="assets/favicon.png">
<link rel="apple-touch-icon" href="assets/apple-touch-icon.png">
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1" />
<meta name="theme-color" content="#060612" />
<link rel="preconnect" href="https://fonts.googleapis.com">
<link rel="preconnect" href="https://fonts.gstatic.com" crossorigin>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@400;500;600;700&family=Playfair+Display:wght@500;600&display=swap" rel="stylesheet">
<style>
html,body{height:100%}
body{margin:0;color:rgba(255,255,255,.92);font-family:Inter,system-ui,-apple-system,Segoe UI,Roboto,Arial,sans-serif;overflow-x:hidden}
.bg{position:fixed;inset:0;z-index:-2;pointer-events:none}
#stars{position:absolute;inset:0;width:100%;height:100%}
.vignette{position:absolute;inset:-10%;background:radial-gradient(90% 70% at 50% 30%, transparent 35%, rgba(0,0,0,.60) 100%);z-index:1}
.grain{position:absolute;inset:0;opacity:.18;mix-blend-mode:overlay;z-index:2;background-image:url('data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" width="400" height="400"><filter id="n"><feTurbulence type="fractalNoise" baseFrequency=".8" numOctaves="3" stitchTiles="stitch"/></filter><rect width="400" height="400" filter="url(%23n)" opacity=".25"/></svg>')}
</style>
<link rel="stylesheet" href="styles.v1020260102224121.css">
<meta name="description" content="A steady, calm chat — right in WhatsApp. User-led. Non-clinical. Privacy-first. Plans change capacity, not behaviour." />
</head>
<body>
<div class="bg">
<canvas id="stars" aria-hidden="true"></canvas>
<div class="vignette" aria-hidden="true"></div>
<div class="grain" aria-hidden="true"></div>
</div>
<header class="topbar">
<a aria-label='KindCompanion home' class='brand' href='/'><img class="kcLogo" src="assets/kc-logo.png" alt="KindCompanion logo" /><span class="brand__text">KindCompanion</span>
</a>
<nav class="nav">
<a href='/pricing'>Offers</a>
<a href='/how'>How it works</a>
<a href='/stories'>Stories</a>
<a href='/privacy'>Privacy</a>
<a href='/terms'>Terms</a>
</nav>
<a class="btn btn--primary" href="https://wa.me/447353685036" target="_blank" rel="noopener">Start on WhatsApp</a>
</header>
<main class="wrap">
<section class="hero">
<div class="hero__copy">
<p class="kicker">User-led • Private by design • Adults 18+</p>
<h1>A steady, calm chat — right in WhatsApp.</h1>
<p class="lead">A calm place to think out loud. Short, steady replies. You set the pace. KindCompanion responds when you message.</p>
<ul class="bullets" role="list">
<li><span class="dot" aria-hidden="true"></span>Private by design. No ads or profiling.</li>
<li><span class="dot" aria-hidden="true"></span>Always there when you want to talk (best‑effort).</li>
<li><span class="dot" aria-hidden="true"></span>Plans change capacity, not tone or behaviour.</li>
</ul>
<div class="ctaRow">
<a class="btn btn--primary" href="https://wa.me/447353685036" target="_blank" rel="noopener">Start on WhatsApp</a>
<a class='btn btn--soft' href='/pricing'>See plans</a>
</div>
<p class="fine">Non-clinical. Not medical advice. Not emergency care.</p>
</div>
<div class="hero__card">
<div class="card">
<h2>Built to feel steady</h2>
<div class="card__grid">
<div class="mini"><p class="mini__title">Steadier thinking</p><p class="mini__text">Short replies that help you settle and think clearly.</p></div>
<div class="mini"><p class="mini__title">Clear boundaries</p><p class="mini__text">You lead. It replies when you message.</p></div>
<div class="mini"><p class="mini__title">Privacy-first</p><p class="mini__text">Private by design. No ads or profiling. We don’t store conversations by defa
Open service 35.157.26.135:443 · www.luxmines.io
2026-01-13 00:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:06 GMT Location: https://luxmines.io/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBBDR8CH2RJD0TB4R3KHV7 Content-Length: 35 Connection: close Redirecting to https://luxmines.io/
Open service 35.157.26.135:80 · www.luxmines.io
2026-01-13 00:16
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:15 GMT Location: https://www.luxmines.io/ Server: Netlify X-Nf-Request-Id: 01KETBBP86MSYEAXD5XBAHV939 Content-Length: 39 Connection: close Redirecting to https://www.luxmines.io/
Open service 35.157.26.135:80 · ibusinessloan.com.sg
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:09 GMT Location: https://ibusinessloan.com.sg/ Server: Netlify X-Nf-Request-Id: 01KETBBH4ZH9CH18R4K3M6G3AQ Content-Length: 44 Connection: close Redirecting to https://ibusinessloan.com.sg/
Open service 35.157.26.135:443 · ibusinessloan.com.sg
2026-01-13 00:15
HTTP/1.1 200 OK
Accept-Ranges: bytes
Access-Control-Allow-Headers: Content-Type, Authorization
Access-Control-Allow-Methods: GET, POST, PUT, DELETE, OPTIONS
Access-Control-Allow-Origin: *
Age: 0
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; fwd=miss
Content-Length: 41539
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:16:01 GMT
Etag: "598984f1d4d9ee7f314a624ac96569fa-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETBB8YGVZGYGVDAPVMTZTT3
X-Robots-Tag: index, follow
Connection: close
Page title: Compare Business Loans Singapore | Best Rates from 15+ Lenders | iBusinessLoan | iBusinessLoan.com.sg
<!DOCTYPE html><html lang="en"> <head><!-- Google tag (gtag.js) - Only load on production domain --><script>
// Only load Google Analytics on production domain (not netlify.app)
if (!window.location.hostname.includes('netlify.app')) {
(function() {
var script = document.createElement('script');
script.async = true;
script.src = 'https://www.googletagmanager.com/gtag/js?id=G-28P2530509';
document.head.appendChild(script);
window.dataLayer = window.dataLayer || [];
function gtag(){dataLayer.push(arguments);}
gtag('js', new Date());
gtag('config', 'G-28P2530509');
// Google Ads tag
var script2 = document.createElement('script');
script2.async = true;
script2.src = 'https://www.googletagmanager.com/gtag/js?id=AW-17539680877';
document.head.appendChild(script2);
gtag('config', 'AW-17539680877');
})();
}
</script><meta charset="UTF-8"><meta name="viewport" content="width=device-width"><meta name="robots" content="index, follow"><meta name="googlebot" content="index, follow"><!-- Primary Meta Tags --><title>Compare Business Loans Singapore | Best Rates from 15+ Lenders | iBusinessLoan | iBusinessLoan.com.sg</title><meta name="title" content="Compare Business Loans Singapore | Best Rates from 15+ Lenders | iBusinessLoan"><meta name="description" content="Compare business loans from DBS, OCBC, UOB, Bizcap & 15+ lenders in Singapore. Get funded in 24 hours with competitive rates. Free comparison service."><!-- Canonical URL --><link rel="canonical" href="https://ibusinessloan.com.sg/"><!-- Open Graph / Facebook --><meta property="og:type" content="website"><meta property="og:url" content="https://ibusinessloan.com.sg/"><meta property="og:title" content="Compare Business Loans Singapore | Best Rates from 15+ Lenders | iBusinessLoan"><meta property="og:description" content="Compare business loans from DBS, OCBC, UOB, Bizcap & 15+ lenders in Singapore. Get funded in 24 hours with competitive rates. Free comparison service."><meta property="og:image" content="https://ibusinessloan.com.sg/og-image.png"><meta property="og:site_name" content="iBusinessLoan.com.sg"><!-- Twitter --><meta property="twitter:card" content="summary_large_image"><meta property="twitter:url" content="https://ibusinessloan.com.sg/"><meta property="twitter:title" content="Compare Business Loans Singapore | Best Rates from 15+ Lenders | iBusinessLoan"><meta property="twitter:description" content="Compare business loans from DBS, OCBC, UOB, Bizcap & 15+ lenders in Singapore. Get funded in 24 hours with competitive rates. Free comparison service."><meta property="twitter:image" content="https://ibusinessloan.com.sg/og-image.png"><!-- Favicons --><link rel="icon" type="image/svg+xml" href="/favicon.svg"><link rel="apple-touch-icon" sizes="180x180" href="/apple-touch-icon.png"><link rel="icon" type="image/png" sizes="32x32" href="/favicon-32x32.png"><link rel="icon" type="image/png" sizes="16x16" href="/favicon-16x16.png"><link rel="manifest" href="/site.webmanifest"><!-- Theme Color --><meta name="theme-color" content="#0052CC"><!-- Schema.org Markup --><script type="application/ld+json">{"@context":"https://schema.org","@type":"Organization","name":"iBusinessLoan Singapore","url":"https://ibusinessloan.com.sg","logo":"https://ibusinessloan.com.sg/logo.png","description":"Singapore's leading business loan comparison platform. Compare loans from top lenders and find the best financing solution for your business.","address":{"@type":"PostalAddress","addressCountry":"SG"}}</script><script type="application/ld+json">{"@context":"https://schema.org","@type":"WebSite","name":"iBusinessLoan Singapore","url":"https://ibusinessloan.com.sg","potentialAction":{"@type":"SearchAction","target":"https://ibusinessloan.com.sg/search?q={search_term_string}","query-input":"required name=search_term_string"}}</script><script type="application/ld+json">{"@context":"https://schema.org","@type":"Bread
Open service 35.157.26.135:443 · www.projetodestrave.com
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:53 GMT Location: https://projetodestrave.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBB0Z1D9N895M01CBEWN2F Content-Length: 43 Connection: close Redirecting to https://projetodestrave.com/
Open service 35.157.26.135:80 · www.projetodestrave.com
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:16:02 GMT Location: https://www.projetodestrave.com/ Server: Netlify X-Nf-Request-Id: 01KETBB9HET5Q413QSBYE7JH8C Content-Length: 47 Connection: close Redirecting to https://www.projetodestrave.com/
Open service 35.157.26.135:443 · www.quikbulk.com
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:43 GMT Location: https://quikbulk.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETBAPXQ7TTRTRT7DEAH6KQB Content-Length: 36 Connection: close Redirecting to https://quikbulk.com/
Open service 35.157.26.135:80 · www.quikbulk.com
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:49 GMT Location: https://www.quikbulk.com/ Server: Netlify X-Nf-Request-Id: 01KETBAXMQA3MNH0BKYWFW1ZF2 Content-Length: 40 Connection: close Redirecting to https://www.quikbulk.com/
Open service 35.157.26.135:443 · primeheaven.ca
2026-01-13 00:15
HTTP/1.1 200 OK Age: 357122 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 74594 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:37 GMT Etag: "14cwbe4guy21lk1" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: rsc,next-router-state-tree,next-router-prefetch,next-router-segment-prefetch,Accept-Encoding X-Content-Type-Options: nosniff X-Nextjs-Date: Fri, 09 Jan 2026 10:04:00 GMT X-Nextjs-Prerender: 1, 1 X-Nextjs-Stale-Time: 300 X-Nf-Request-Id: 01KETBAH20AFGS61NAE2JHX331 X-Powered-By: Next.js Connection: close Page title: PrimeHeaven - Shop smarter <!DOCTYPE html><!--FWzxVDuB0FSEJBaSEnzCP--><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/1b99372b3eaef0c8-s.p.758e15a8.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" as="image" href="/assets/primeheaven.png"/><link rel="stylesheet" href="/_next/static/chunks/a9fc835b13e0d873.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/f1b4d49aa9e249c5.js"/><script src="/_next/static/chunks/cd3c2f6e31af08a6.js" async=""></script><script src="/_next/static/chunks/30ea11065999f7ac.js" async=""></script><script src="/_next/static/chunks/f41ffbd5f2c215be.js" async=""></script><script src="/_next/static/chunks/236f7e5abd6f09ff.js" async=""></script><script src="/_next/static/chunks/turbopack-3b9df9be386f5d2f.js" async=""></script><script src="/_next/static/chunks/6f70d24ee3344bbb.js" async=""></script><script src="/_next/static/chunks/99e0389cce5c9581.js" async=""></script><script src="/_next/static/chunks/ff1a16fafef87110.js" async=""></script><script src="/_next/static/chunks/b20fb0df60270162.js" async=""></script><script src="/_next/static/chunks/5e9122d5f2981fa0.js" async=""></script><script src="/_next/static/chunks/d8545109ad592263.js" async=""></script><meta name="next-size-adjust" content=""/><title>PrimeHeaven - Shop smarter</title><meta name="description" content="PrimeHeaven - Shop smarter"/><link rel="icon" href="/favicon.ico?favicon.d1b32c95.ico" sizes="48x48" type="image/x-icon"/><script src="/_next/static/chunks/a6dad97d9634a72d.js" noModule=""></script></head><body class="outfit_735164fc-module__5y5x_a__className antialiased"><div hidden=""><!--$--><!--/$--></div><div data-rht-toaster="" style="position:fixed;z-index:9999;top:16px;left:16px;right:16px;bottom:16px;pointer-events:none"></div><div class="w-full px-6 py-1 font-medium text-sm text-white text-center bg-gradient-to-r from-violet-500 via-[#9938CA] to-[#E0724A]"><div class="flex items-center justify-between max-w-7xl mx-auto"><p>Get 20% OFF on Your First Order!</p><div class="flex items-center space-x-6"><button type="button" class="font-normal text-gray-800 bg-white px-7 py-2 rounded-full max-sm:hidden">Claim Offer</button><button type="button" class="font-normal text-gray-800 py-2 rounded-full"><svg width="14" height="14" viewBox="0 0 14 14" fill="none" xmlns="http://www.w3.org/2000/svg"><rect y="12.532" width="17.498" height="2.1" rx="1.05" transform="rotate(-45.74 0 12.532)" fill="#fff"></rect><rect x="12.533" y="13.915" width="17.498" height="2.1" rx="1.05" transform="rotate(-135.74 12.533 13.915)" fill="#fff"></rect></svg></button></div></div></div><nav class="relative bg-white"><div class="mx-6"><div class="flex items-center justify-between max-w-7xl mx-auto py-4 transition-all"><a class="flex items-center" href="/"><img alt="Prime Heaven Logo" width="140" height="45" decoding="async" data-nimg="1" class="object-contain" style="color:transparent" src="/assets/primeheaven.png"/></a><div class="hidden sm:flex items-center gap-4 lg:gap-8 text-slate-600"><a href="/">Home</a><a href="/shop">Shop</a><a href="/about">About</a><a href="/contact">Contact</a><form class="hidden xl:flex items-center w-xs text-sm gap-2 bg-slate-100 px-4 py-3 rounded-full"><svg xmlns="http://www.w3.org/2000/svg" width="18" height="18" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="lucide lucide-search text-slate-600" aria-hidden="true"><path d="m21 21-4.34-4.34"></path><circle cx="11" cy="11" r="8"></circle></svg><input class="w-full bg-transparent outline-none placeholder-slate-600" type="text" placeholder="Search products" required="" value=""/></form><a class="relative flex items-center gap-2 text-slate-600" href="/cart"><svg xmlns="http://www.w3.org/2000/svg" width="18" height="18" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="lucide l
Open service 35.157.26.135:80 · primeheaven.ca
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:45 GMT Location: https://primeheaven.ca/ Server: Netlify X-Nf-Request-Id: 01KETBAS5XX473MJ37C95CJF6B Content-Length: 38 Connection: close Redirecting to https://primeheaven.ca/
Open service 35.157.26.135:443 · luxmines.io
2026-01-13 00:15
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 638 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:15:14 GMT Etag: "9e5e0fffbb93bf47138de2fbc73da94f-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB9VD9Y9S2ER9YNHMC3M1Y Connection: close Page title: Luxmines - ReactJS <!doctype html><html lang="en"><head><meta charset="utf-8"/><link rel="icon" href="images/favicon.png"/><meta name="viewport" content="width=device-width,initial-scale=1"/><meta name="theme-color" content="#000000"/><meta name="description" content="Luxmines - ReactJS"/><link rel="apple-touch-icon" href="/logo192.png"/><link rel="manifest" href="/manifest.json"/><title>Luxmines - ReactJS</title><script defer="defer" src="/static/js/main.63ec7163.js"></script><link href="/static/css/main.633511c8.css" rel="stylesheet"></head><body><noscript>You need to enable JavaScript to run this app.</noscript><div id="root"></div></body></html>
Open service 35.157.26.135:80 · luxmines.io
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:22 GMT Location: https://luxmines.io/ Server: Netlify X-Nf-Request-Id: 01KETBA2N13R46332CM2M4CJ68 Content-Length: 35 Connection: close Redirecting to https://luxmines.io/
Open service 35.157.26.135:443 · www.aufdieplakate.com
2026-01-13 00:15
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 37432
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:15:08 GMT
Etag: "3ea07c542655753f877adbc006917831-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB9MY4P2XB90HBA177YF0B
Connection: close
Page title: Auf die Plakate | Premium Außenwerbung in Braunschweig
<!DOCTYPE html><html lang="de" class="scroll-smooth" data-astro-cid-sckkx6r4> <head><meta charset="UTF-8"><meta name="viewport" content="width=device-width, initial-scale=1.0"><link rel="icon" type="image/svg+xml" href="/favicon.svg"><meta name="generator" content="Astro v5.7.11"><meta name="description" content="Hochwertige Plakatwerbung an exklusiven Standorten in Braunschweig. Erreichen Sie Ihre Zielgruppe effektiv mit unseren strategisch platzierten Werbeflächen."><title>Auf die Plakate | Premium Außenwerbung in Braunschweig</title><link rel="stylesheet" href="/_astro/agb.B5-1qoJe.css">
<style>.details[data-astro-cid-al2ca2vr]{--_duration: .2s;cursor:pointer;border-radius:.5rem;margin-bottom:1rem;padding:12px;>summary{>svg{transition:rotate .3s ease}}interpolate-size:allow-keywords;&::details-content{display:grid;border-block-start:none;opacity:0;block-size:0;overflow-y:clip;transition:content-visibility var(--_duration) allow-discrete,opacity var(--_duration),block-size var(--_duration),border-radius var(--_duration)}}.details[data-astro-cid-al2ca2vr]:hover{background-color:#374151}.details[data-astro-cid-al2ca2vr][open]{background-color:#374151;>summary{>svg{rotate:.25turn}}&::details-content{border-start-end-radius:0px;border-start-start-radius:0px;opacity:1;block-size:auto}}
.stage[data-astro-cid-ahidmiaj]{display:grid}.stage-text[data-astro-cid-ahidmiaj]{grid-column:1;grid-row:1;z-index:1000;align-self:end}.cbg[data-astro-cid-ahidmiaj]{background:linear-gradient(180deg,#f9f7f5 0%,#f9f7f5 65%,var(--color-gray-900) 65%,var(--color-gray-900) 100%)}.glass3d[data-astro-cid-ahidmiaj]{--filter-glass3d: blur(14px) brightness(.85) saturate(2.5);--color-glass3d: hsl(189 80% 10% / .2);--noise-glass3d: url(https://www.transparenttextures.com/patterns/egg-shell.png);position:relative;z-index:1004;box-shadow:0 0 .75px #141a1f33,.7px .8px 1.2px -.4px #141a1f1a,1.3px 1.5px 2.2px -.8px #141a1f1a,2.3px 2.6px 3.9px -1.2px #141a1f1a,3.9px 4.4px 6.6px -1.7px #141a1f1a,6.5px 7.2px 10.9px -2.1px #141a1f1a,8px 9px 14px -2.5px #141a1f33}.glass3d[data-astro-cid-ahidmiaj]:before{content:"";position:absolute;inset:0;pointer-events:none;border-radius:inherit;overflow:hidden;z-index:1003;-webkit-backdrop-filter:var(--filter-glass3d);backdrop-filter:var(--filter-glass3d);background-color:var(--color-glass3d);background-image:var(--noise-glass3d);background-size:100px;background-repeat:repeat}.glass3d[data-astro-cid-ahidmiaj]:after{content:"";position:absolute;inset:0;pointer-events:none;border-radius:inherit;overflow:hidden;z-index:1005;box-shadow:inset 2px 2px 1px -3px #e0e6ebcc,inset 4px 4px 2px -6px #e0e6eb4d,inset 1.5px 1.5px 1.5px -.75px #e0e6eb26,inset 1.5px 1.5px .25px #e0e6eb08,inset 0 0 .25px .5px #e0e6eb08}.glass3d[data-astro-cid-ahidmiaj]>[data-astro-cid-ahidmiaj]{position:relative;z-index:1006}.imagegrid[data-astro-cid-ahidmiaj]{display:grid;grid-column:1;grid-row:1}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj]{grid-column:1;grid-row:1;z-index:1000;min-height:100%;transition:all 1s ease-in-out}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="1"]{z-index:999;opacity:1}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="2"]{z-index:998;opacity:0}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="3"]{z-index:997;opacity:0}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="4"]{z-index:996;opacity:0}.scroller-container[data-astro-cid-fbnxtyi4]{position:relative;overflow:hidden}.image-scroller[data-astro-cid-fbnxtyi4]{display:flex;overflow-x:scroll;scrollbar-width:none;-ms-overflow-style:none;scroll-behavior:smooth;scroll-snap-type:x mandatory;justify-content:space-between;gap:40px}.image-scroller[data-astro-cid-fbnxtyi4]::-webkit-scrollbar{display:none}.image-scroller[data-astro-cid-fbnxtyi4]:hover{animation-play-state:paused}.image-scroller[data-astro-cid-fbnxtyi4] img[data-astro-cid-fbnxtyi4],.image-scroller[data-astro-cid-fbnxtyi4] div[data-astro-cid-fbnxtyi4]{width:300px;height:300px;object-fit:c
Open service 35.157.26.135:80 · jasteck.lol
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:15 GMT Location: https://jasteck.lol/ Server: Netlify X-Nf-Request-Id: 01KETB9W5TVE9VMTMJMBMEG5BT Content-Length: 35 Connection: close Redirecting to https://jasteck.lol/
Open service 35.157.26.135:443 · jasteck.lol
2026-01-13 00:15
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 30163
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:15:07 GMT
Etag: "16b2c3ad22f0960bc3d84b7cb81b64ea-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB9MFAMTDE6N69VWA9TM74
Connection: close
Page title: Jasteck Profile
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Jasteck Profile</title>
<style>
* {
margin: 0;
padding: 0;
box-sizing: border-box;
font-family: 'Courier New', monospace;
}
.custom-cursor {
position: fixed;
width: 40px;
height: 40px;
background: url('assets/custom_cursor.png') no-repeat center center;
background-size: contain;
pointer-events: none;
z-index: 9999;
transform: translate(-50%, -50%);
}
body:not(.touch-device) {
cursor: none;
}
body {
background-color: #000;
color: #fff;
overflow: hidden;
}
.container {
width: 100%;
height: 100vh;
position: relative;
}
#background {
position: fixed;
top: 0;
left: 0;
width: 100%;
height: 100%;
object-fit: cover;
z-index: 1;
pointer-events: none;
}
.glitch-overlay {
position: fixed;
top: 0;
left: 0;
width: 100%;
height: 100%;
pointer-events: none;
z-index: 2;
opacity: 0;
transition: opacity 0.5s;
}
#hacker-overlay, #snow-overlay {
position: fixed;
top: 0;
left: 0;
width: 100%;
height: 100%;
pointer-events: none;
z-index: 3;
}
.hidden {
display: none !important;
}
.controls {
position: fixed;
bottom: calc(50% - 240px - 10px);
left: 50%;
transform: translateX(-50%);
display: flex;
gap: 10px;
z-index: 20;
background: rgba(0, 0, 0, 0.7);
padding: 5px 10px;
border-radius: 20px;
backdrop-filter: blur(5px);
}
.theme-button {
width: 30px;
height: 30px;
border-radius: 50%;
border: 2px solid rgba(255, 255, 255, 0.3);
background-color: rgba(0, 0, 0, 0.5);
cursor: pointer;
display: flex;
align-items: center;
justify-content: center;
transition: all 0.3s;
font-size: 14px;
font-weight: bold;
}
.theme-button:hover {
transform: scale(1.1);
border-color: rgba(255, 255, 255, 0.8);
}
.volume-control {
display: flex;
align-items: center;
gap: 8px;
}
.volume-icon {
width: 20px;
height: 20px;
cursor: pointer;
display: flex;
color: white;
}
.slider {
-webkit-appearance: none;
appearance: none;
width: 80px;
height: 5px;
border-radius: 5px;
background: rgba(255, 255, 255, 0.3);
outline: none;
}
.slider::-webkit-slider-thumb {
-webkit-appearance: none;
appearance: none;
width: 12px;
height: 12px;
border-radius: 50%;
background: white;
cursor: pointer;
}
.transparency-control {
display: flex;
align-items: center;
gap: 8px;
}
.transparency-icon {
width: 20px;
height: 20px;
color: white;
}
.top-controls {
position: fixed;
bottom: calc(50% - 240px - 60px);
left: 50%;
transform: translateX(-50%);
display: flex;
align-items: cente
Open service 35.157.26.135:80 · www.aufdieplakate.com
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:16 GMT Location: https://www.aufdieplakate.com/ Server: Netlify X-Nf-Request-Id: 01KETB9WXWMKHD5NY2KV9B0HF2 Content-Length: 45 Connection: close Redirecting to https://www.aufdieplakate.com/
Open service 35.157.26.135:443 · www.aufdieplakate.de
2026-01-13 00:15
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 0
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; fwd=miss
Content-Length: 37432
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:15:08 GMT
Etag: "3ea07c542655753f877adbc006917831-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB9MXR2HWDE9DNZZ1VM7NK
Connection: close
Page title: Auf die Plakate | Premium Außenwerbung in Braunschweig
<!DOCTYPE html><html lang="de" class="scroll-smooth" data-astro-cid-sckkx6r4> <head><meta charset="UTF-8"><meta name="viewport" content="width=device-width, initial-scale=1.0"><link rel="icon" type="image/svg+xml" href="/favicon.svg"><meta name="generator" content="Astro v5.7.11"><meta name="description" content="Hochwertige Plakatwerbung an exklusiven Standorten in Braunschweig. Erreichen Sie Ihre Zielgruppe effektiv mit unseren strategisch platzierten Werbeflächen."><title>Auf die Plakate | Premium Außenwerbung in Braunschweig</title><link rel="stylesheet" href="/_astro/agb.B5-1qoJe.css">
<style>.details[data-astro-cid-al2ca2vr]{--_duration: .2s;cursor:pointer;border-radius:.5rem;margin-bottom:1rem;padding:12px;>summary{>svg{transition:rotate .3s ease}}interpolate-size:allow-keywords;&::details-content{display:grid;border-block-start:none;opacity:0;block-size:0;overflow-y:clip;transition:content-visibility var(--_duration) allow-discrete,opacity var(--_duration),block-size var(--_duration),border-radius var(--_duration)}}.details[data-astro-cid-al2ca2vr]:hover{background-color:#374151}.details[data-astro-cid-al2ca2vr][open]{background-color:#374151;>summary{>svg{rotate:.25turn}}&::details-content{border-start-end-radius:0px;border-start-start-radius:0px;opacity:1;block-size:auto}}
.stage[data-astro-cid-ahidmiaj]{display:grid}.stage-text[data-astro-cid-ahidmiaj]{grid-column:1;grid-row:1;z-index:1000;align-self:end}.cbg[data-astro-cid-ahidmiaj]{background:linear-gradient(180deg,#f9f7f5 0%,#f9f7f5 65%,var(--color-gray-900) 65%,var(--color-gray-900) 100%)}.glass3d[data-astro-cid-ahidmiaj]{--filter-glass3d: blur(14px) brightness(.85) saturate(2.5);--color-glass3d: hsl(189 80% 10% / .2);--noise-glass3d: url(https://www.transparenttextures.com/patterns/egg-shell.png);position:relative;z-index:1004;box-shadow:0 0 .75px #141a1f33,.7px .8px 1.2px -.4px #141a1f1a,1.3px 1.5px 2.2px -.8px #141a1f1a,2.3px 2.6px 3.9px -1.2px #141a1f1a,3.9px 4.4px 6.6px -1.7px #141a1f1a,6.5px 7.2px 10.9px -2.1px #141a1f1a,8px 9px 14px -2.5px #141a1f33}.glass3d[data-astro-cid-ahidmiaj]:before{content:"";position:absolute;inset:0;pointer-events:none;border-radius:inherit;overflow:hidden;z-index:1003;-webkit-backdrop-filter:var(--filter-glass3d);backdrop-filter:var(--filter-glass3d);background-color:var(--color-glass3d);background-image:var(--noise-glass3d);background-size:100px;background-repeat:repeat}.glass3d[data-astro-cid-ahidmiaj]:after{content:"";position:absolute;inset:0;pointer-events:none;border-radius:inherit;overflow:hidden;z-index:1005;box-shadow:inset 2px 2px 1px -3px #e0e6ebcc,inset 4px 4px 2px -6px #e0e6eb4d,inset 1.5px 1.5px 1.5px -.75px #e0e6eb26,inset 1.5px 1.5px .25px #e0e6eb08,inset 0 0 .25px .5px #e0e6eb08}.glass3d[data-astro-cid-ahidmiaj]>[data-astro-cid-ahidmiaj]{position:relative;z-index:1006}.imagegrid[data-astro-cid-ahidmiaj]{display:grid;grid-column:1;grid-row:1}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj]{grid-column:1;grid-row:1;z-index:1000;min-height:100%;transition:all 1s ease-in-out}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="1"]{z-index:999;opacity:1}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="2"]{z-index:998;opacity:0}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="3"]{z-index:997;opacity:0}.imagegrid[data-astro-cid-ahidmiaj] img[data-astro-cid-ahidmiaj][data-position="4"]{z-index:996;opacity:0}.scroller-container[data-astro-cid-fbnxtyi4]{position:relative;overflow:hidden}.image-scroller[data-astro-cid-fbnxtyi4]{display:flex;overflow-x:scroll;scrollbar-width:none;-ms-overflow-style:none;scroll-behavior:smooth;scroll-snap-type:x mandatory;justify-content:space-between;gap:40px}.image-scroller[data-astro-cid-fbnxtyi4]::-webkit-scrollbar{display:none}.image-scroller[data-astro-cid-fbnxtyi4]:hover{animation-play-state:paused}.image-scroller[data-astro-cid-fbnxtyi4] img[data-astro-cid-fbnxtyi4],.image-scroller[data-astro-cid-fbnxtyi4] div[data-astro-cid-fbnxtyi4]{width:300px;height:300px;object-fit:c
Open service 35.157.26.135:80 · www.aufdieplakate.de
2026-01-13 00:15
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:16 GMT Location: https://www.aufdieplakate.de/ Server: Netlify X-Nf-Request-Id: 01KETB9WRBVEFJZ3ZCBVZZZBVP Content-Length: 44 Connection: close Redirecting to https://www.aufdieplakate.de/
Open service 35.157.26.135:443 · debtorinfo.com.au
2026-01-13 00:14
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 1730
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:14:53 GMT
Etag: "c00f39b7032c724d940e6740f45ec3fd-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB963FCHN8KK4PXTB33V0P
Connection: close
Page title: Get your cash flow and compliance issues sorted | Debtorinfo
<!doctype html>
<html lang="en">
<head>
<meta charset="utf-8">
<title>Get your cash flow and compliance issues sorted | Debtorinfo</title>
<meta property="og:site_name" content="Debtorinfo">
<meta property="og:title" content="Get your cash flow and compliance issues sorted | Debtorinfo">
<meta property="og:description"
content="Australias debt recovery experts. Get your cash flow and compliance issues sorted with debtorinfo's automated system.">
<meta property="og:url" content="https://www.debtorinfo.com/">
<base href="/">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="shortcut icon" href="/assets/favicon.png" type="image/png">
<link href="https://fonts.googleapis.com/css?family=IBM+Plex+Sans:400,500,600,700&display=swap" rel="stylesheet">
<!-- Global site tag (gtag.js) - Google Analytics -->
<script async src="https://www.googletagmanager.com/gtag/js?id=UA-81867418-3"></script>
<script>
window.dataLayer = window.dataLayer || [];
function gtag() { dataLayer.push(arguments); }
gtag('js', new Date());
gtag('config', 'UA-81867418-3');
</script>
</head>
<body>
<app-root></app-root>
<script src="runtime-es2015.js" type="module"></script><script src="runtime-es5.js" nomodule defer></script><script src="polyfills-es5.js" nomodule defer></script><script src="polyfills-es2015.js" type="module"></script><script src="styles-es2015.js" type="module"></script><script src="styles-es5.js" nomodule defer></script><script src="vendor-es2015.js" type="module"></script><script src="vendor-es5.js" nomodule defer></script><script src="main-es2015.js" type="module"></script><script src="main-es5.js" nomodule defer></script></body>
</html>
Open service 35.157.26.135:80 · debtorinfo.com.au
2026-01-13 00:14
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:15:00 GMT Location: https://debtorinfo.com.au/ Server: Netlify X-Nf-Request-Id: 01KETB9CXMKTKNV9R13Q0M33D3 Content-Length: 41 Connection: close Redirecting to https://debtorinfo.com.au/
Open service 35.157.26.135:80 · www.slfilmstudio.com
2026-01-13 00:14
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:14:47 GMT Location: https://www.slfilmstudio.com/ Server: Netlify X-Nf-Request-Id: 01KETB90X5QEMABEV6S4APSTTM Content-Length: 44 Connection: close Redirecting to https://www.slfilmstudio.com/
Open service 35.157.26.135:443 · www.slfilmstudio.com
2026-01-13 00:14
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 575
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:14:40 GMT
Etag: "36cfaffdeda051311139b49ab1df73f6-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB8SP7M8AHE8YHKT2ZZWYS
Connection: close
Page title: SL FILM STUDIO Website Development
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>SL FILM STUDIO Website Development</title>
<script type="module" crossorigin src="/assets/index-B9w3heHy.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-Be5oTnaV.css">
<script async src="https://bolt.new/badge.js?s=a7bdf96e-f6b3-40b5-a132-40e674c3392a"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · quotelogger.com
2026-01-13 00:14
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:14:36 GMT Location: https://quotelogger.com/ Server: Netlify X-Nf-Request-Id: 01KETB8NVDPKQHCG5PXMD0DXTV Content-Length: 39 Connection: close Redirecting to https://quotelogger.com/
Open service 35.157.26.135:443 · quotelogger.com
2026-01-13 00:14
HTTP/1.1 404 Not Found
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3449
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:14:28 GMT
Etag: 1768262920-ssl
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB8E1JM9EWE3RZ8WFN1ZCD
Connection: close
Page title: Page not found
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Page not found</title>
<style>
:root {
--colorRgbFacetsTeal600: 2 128 125;
--colorTealAction: var(--colorRgbFacetsTeal600);
--colorRgbFacetsNeutralLight200: 233 235 237;
--colorHr: var(--colorRgbFacetsNeutralLight200);
--colorRgbFacetsNeutralLight700: 53 58 62;
--colorGrayDarkest: var(--colorRgbFacetsNeutralLight700);
--colorGrayLighter: var(--colorRgbFacetsNeutralLight200);
--colorText: var(--colorGrayDarkest);
--effectShadowLightShallow: 0 1px 10px 0 rgb(53 58 62 / 6%),
0 2px 4px 0 rgb(53 58 62 / 8%);
--colorRgbFacetsNeutralDark900: 6 11 16;
}
body {
font-family: system-ui, -apple-system, BlinkMacSystemFont, "Segoe UI",
Roboto, Helvetica, Arial, sans-serif, "Apple Color Emoji",
"Segoe UI Emoji", "Segoe UI Symbol";
background: white;
overflow: hidden;
margin: 0;
padding: 0;
line-height: 1.5;
color: rgb(var(--colorText));
}
@media (prefers-color-scheme: dark) {
body {
background: rgb(var(--colorRgbFacetsNeutralDark900));
}
}
h1 {
margin: 0;
font-size: 1.375rem;
line-height: 1;
}
h1 + p {
margin-top: 8px;
}
.main {
position: relative;
display: flex;
flex-direction: column;
align-items: center;
justify-content: center;
height: 100vh;
width: 100vw;
}
.card {
position: relative;
width: 75%;
max-width: 364px;
padding: 24px;
background: white;
border-radius: 8px;
box-shadow: var(--effectShadowLightShallow);
border: 1px solid rgb(var(--colorGrayLighter));
}
a {
margin: 0;
font-weight: 600;
color: rgb(var(--colorTealAction));
text-decoration-skip-ink: all;
text-decoration-thickness: 1px;
text-underline-offset: 2px;
text-decoration-color: rgb(var(--colorTealAction) / 0.5);
transition: text-decoration-color 0.15s ease-in-out;
}
a:hover,
a:focus-visible {
text-decoration-color: rgb(var(--colorTealAction));
}
p:last-of-type {
margin-bottom: 0;
}
hr {
border: 0;
height: 1px;
background: rgb(var(--colorHr));
margin-top: 16px;
margin-bottom: 16px;
}
.your-site {
font-size: 0.875rem;
}
</style>
</head>
<body>
<div class="main">
<div class="card">
<h1>Page not found</h1>
<p>
Looks like you’ve followed a broken link or entered a URL that doesn’t
exist on this site.
</p>
<hr />
<p class="your-site">
If this is your site, and you weren’t expecting a 404 for this path,
please visit Netlify’s
<a
href="https://answers.netlify.com/t/support-guide-i-ve-deployed-my-site-but-i-still-see-page-not-found/125?utm_source=404page&utm_campaign=community_tracking"
>“page not found” support guide</a
>
for troubleshooting tips.
</p>
</div>
</div>
</body>
</html>
Open service 35.157.26.135:80 · chroniv.com
2026-01-13 00:14
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:14:33 GMT Location: https://chroniv.com/ Server: Netlify X-Nf-Request-Id: 01KETB8K5VSCSMEQTE09HE34CH Content-Length: 35 Connection: close Redirecting to https://chroniv.com/
Open service 35.157.26.135:443 · chroniv.com
2026-01-13 00:14
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 11602
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:14:25 GMT
Etag: "ddb96da58e2600786eb46b96ce5ad1bb-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB8BG299AWT8JH6JFP563F
Connection: close
Page title: Chroniv
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
<title>Chroniv</title>
<link href="https://fonts.googleapis.com/css2?family=Inter:wght@300;400;500;600;700&display=swap" rel="stylesheet">
<link rel="stylesheet" href="styles.css">
<!-- Stripe SDK -->
<script src="https://js.stripe.com/v3/"></script>
</head>
<body>
<!-- Hero Section -->
<section class="hero">
<div class="container">
<div class="hero-content">
<div class="logo-container">
<img src="logo2.png" alt="Chroniv Logo" class="logo-image">
</div>
<h1>Digital → Forever.</h1>
<p><i>"Social media gives you a voice, this cements it in history" Abraham Lincoln... probably</i></p>
<button class="cta-button" onclick="showUserAgreement()">Post Your Sentence</button>
</div>
</div>
</section>
<!-- Progress Section -->
<section class="progress-section">
<div class="container">
<div class="progress-container">
<div class="progress-text">Claiming Digital History</div>
<!-- Single Active Milestone Display -->
<div id="activeMilestone" class="progress-milestone active">
<div class="milestone-label" id="currentMilestoneLabel">🎯 First Milestone</div>
<div class="progress-bar">
<div class="progress-fill" id="currentProgressFill"></div>
</div>
<div class="progress-count">
<span id="currentCount">Loading...</span> / <span id="currentTarget">10,000</span> posts
</div>
<div class="milestone-description" id="currentDescription"></div>
</div>
<p style="margin-top: 30px; text-align: center;"><i>follow on Instagram and TikTok for a chance to win our giveaways (no purchase neccessary to be entered)</i></p>
</div>
</div>
</section>
<!-- User Agreement Modal -->
<div class="agreement-modal" id="agreementModal">
<div class="agreement-content">
<button class="agreement-close" onclick="closeUserAgreement()">×</button>
<div class="agreement-header">
<h2 class="agreement-title">User Agreement</h2>
<p class="agreement-subtitle">Please read and agree to our terms before posting</p>
</div>
<div class="agreement-text">
<h3>Terms of Service</h3>
<p>By posting your sentence to our digital wall, you agree to the following terms:</p>
<ul>
<li>Content is moderated and cooperative with regulations</li>
<li>No hate speech, harassment, or inappropriate content</li>
<li>Content must be suitable for all audiences</li>
<li>We reserve the right to moderate and remove content</li>
<li>Payments are non-refundable once content is posted</li>
<li>No refund includes in the event the site is shutdown due to regulation</li>
</ul>
<h3>Privacy & Data Usage</h3>
<p>Your name and sentence will be displayed publicly on our wall. We do not store personal payment information and use secure payment processors.</p>
<h3>Content Ownership</h3>
<p>You grant us the right to display and use permanently. Posted content cannot be edited or removed after payment.</p>
<p style="margin-top: 25px; font-style: italic; text-align: center; color: #a5b8d8;">
By clicking "I Agree," you acknowledge that you have read and agree to these terms.
</p>
</div>
<div class="agreement-buttons">
<button class="agreement-button decline-button" onclick="closeUserAgreement()">
Decline
</button>
<button class="agreement-button agree-button" onclick="acceptAgreementAndProceed()">
Open service 35.157.26.135:80 · framesizeapp.digitalplannervault.com
2026-01-13 00:14
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:14:31 GMT Location: https://framesizeapp.digitalplannervault.com/ Server: Netlify X-Nf-Request-Id: 01KETB8GZVV15CTDTPKYEEEJFZ Content-Length: 60 Connection: close Redirecting to https://framesizeapp.digitalplannervault.com/
Open service 35.157.26.135:443 · www.alinartgalery.shop
2026-01-13 00:14
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:14:21 GMT Location: https://alinartgalery.shop/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB87JVM9V2DRNFD2J5Z86T Content-Length: 42 Connection: close Redirecting to https://alinartgalery.shop/
Open service 35.157.26.135:443 · framesizeapp.digitalplannervault.com
2026-01-13 00:14
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 491
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:14:21 GMT
Etag: "855a7ddd741da83a522b45bca695a211-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB87QBGK85MRJ6YXTK9ZRA
Connection: close
Page title: Samsung Frame TV Image Processor Application
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Samsung Frame TV Image Processor Application</title>
<script type="module" crossorigin src="/assets/index-CtaACst2.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-LAJiPMfw.css">
</head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:80 · www.alinartgalery.shop
2026-01-13 00:14
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:14:29 GMT Location: https://www.alinartgalery.shop/ Server: Netlify X-Nf-Request-Id: 01KETB8FDFQXPQGZ6SN0G83GEA Content-Length: 46 Connection: close Redirecting to https://www.alinartgalery.shop/
Open service 35.157.26.135:443 · bridgepointai.consulting
2026-01-13 00:14
HTTP/1.1 404 Not Found
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 3449
Content-Type: text/html; charset=utf-8
Date: Tue, 13 Jan 2026 00:14:06 GMT
Etag: 1757900563-ssl
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB7RWWJRJVDFWRDFPZ6NN5
Connection: close
Page title: Page not found
<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="utf-8" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>Page not found</title>
<style>
:root {
--colorRgbFacetsTeal600: 2 128 125;
--colorTealAction: var(--colorRgbFacetsTeal600);
--colorRgbFacetsNeutralLight200: 233 235 237;
--colorHr: var(--colorRgbFacetsNeutralLight200);
--colorRgbFacetsNeutralLight700: 53 58 62;
--colorGrayDarkest: var(--colorRgbFacetsNeutralLight700);
--colorGrayLighter: var(--colorRgbFacetsNeutralLight200);
--colorText: var(--colorGrayDarkest);
--effectShadowLightShallow: 0 1px 10px 0 rgb(53 58 62 / 6%),
0 2px 4px 0 rgb(53 58 62 / 8%);
--colorRgbFacetsNeutralDark900: 6 11 16;
}
body {
font-family: system-ui, -apple-system, BlinkMacSystemFont, "Segoe UI",
Roboto, Helvetica, Arial, sans-serif, "Apple Color Emoji",
"Segoe UI Emoji", "Segoe UI Symbol";
background: white;
overflow: hidden;
margin: 0;
padding: 0;
line-height: 1.5;
color: rgb(var(--colorText));
}
@media (prefers-color-scheme: dark) {
body {
background: rgb(var(--colorRgbFacetsNeutralDark900));
}
}
h1 {
margin: 0;
font-size: 1.375rem;
line-height: 1;
}
h1 + p {
margin-top: 8px;
}
.main {
position: relative;
display: flex;
flex-direction: column;
align-items: center;
justify-content: center;
height: 100vh;
width: 100vw;
}
.card {
position: relative;
width: 75%;
max-width: 364px;
padding: 24px;
background: white;
border-radius: 8px;
box-shadow: var(--effectShadowLightShallow);
border: 1px solid rgb(var(--colorGrayLighter));
}
a {
margin: 0;
font-weight: 600;
color: rgb(var(--colorTealAction));
text-decoration-skip-ink: all;
text-decoration-thickness: 1px;
text-underline-offset: 2px;
text-decoration-color: rgb(var(--colorTealAction) / 0.5);
transition: text-decoration-color 0.15s ease-in-out;
}
a:hover,
a:focus-visible {
text-decoration-color: rgb(var(--colorTealAction));
}
p:last-of-type {
margin-bottom: 0;
}
hr {
border: 0;
height: 1px;
background: rgb(var(--colorHr));
margin-top: 16px;
margin-bottom: 16px;
}
.your-site {
font-size: 0.875rem;
}
</style>
</head>
<body>
<div class="main">
<div class="card">
<h1>Page not found</h1>
<p>
Looks like you’ve followed a broken link or entered a URL that doesn’t
exist on this site.
</p>
<hr />
<p class="your-site">
If this is your site, and you weren’t expecting a 404 for this path,
please visit Netlify’s
<a
href="https://answers.netlify.com/t/support-guide-i-ve-deployed-my-site-but-i-still-see-page-not-found/125?utm_source=404page&utm_campaign=community_tracking"
>“page not found” support guide</a
>
for troubleshooting tips.
</p>
</div>
</div>
</body>
</html>
Open service 35.157.26.135:443 · www.mrslideon.com
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:43 GMT Location: https://mrslideon.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB72G2MFBJYE82MM2KGKZ6 Content-Length: 37 Connection: close Redirecting to https://mrslideon.com/
Open service 35.157.26.135:80 · www.mrslideon.com
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:51 GMT Location: https://www.mrslideon.com/ Server: Netlify X-Nf-Request-Id: 01KETB79TC3AXM1GBG3TNGAZTS Content-Length: 41 Connection: close Redirecting to https://www.mrslideon.com/
Open service 35.157.26.135:80 · einvoice.invoizapro.com
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:52 GMT Location: https://einvoice.invoizapro.com/ Server: Netlify X-Nf-Request-Id: 01KETB7B16PX03DRDJWER21NY7 Content-Length: 47 Connection: close Redirecting to https://einvoice.invoizapro.com/
Open service 35.157.26.135:443 · einvoice.invoizapro.com
2026-01-13 00:13
HTTP/1.1 200 OK Age: 4167 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 26076 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:43 GMT Etag: "jckl5wttf7k3x" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: RSC,Next-Router-State-Tree,Next-Router-Prefetch,Next-Url,Accept-Encoding X-Content-Type-Options: nosniff X-Nextjs-Date: Tue, 13 Jan 2026 00:13:41 GMT X-Nf-Request-Id: 01KETB72GX539DHCJXT17NG6AX X-Powered-By: Next.js Connection: close Page title: InvoizaPro - an AI e-Invoicing Solution <!DOCTYPE html><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/bb3ef058b751a6ad-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/e4af272ccee01ff0-s.p.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="stylesheet" href="/_next/static/css/22091bd2a70f7d9b.css" crossorigin="" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/webpack-16a4de2a5fb468c6.js" crossorigin=""/><script src="/_next/static/chunks/fd9d1056-5661ff0cd0504de3.js" async="" crossorigin=""></script><script src="/_next/static/chunks/4938-90218461e86e59a2.js" async="" crossorigin=""></script><script src="/_next/static/chunks/main-app-7e7b55e7aa0fe3d2.js" async="" crossorigin=""></script><script src="/_next/static/chunks/1176-b9db854f7c07691d.js" async=""></script><script src="/_next/static/chunks/6935-d796d84a568291b2.js" async=""></script><script src="/_next/static/chunks/app/page-ea4124a4772ff67c.js" async=""></script><script src="/_next/static/chunks/app/layout-31a8dffb9ed8d03b.js" async=""></script><title>InvoizaPro - an AI e-Invoicing Solution</title><meta name="description" content="A comprehensive AI e-invoicing solution for businesses."/><link rel="icon" href="/favicon.ico" type="image/x-icon" sizes="16x16"/><meta name="next-size-adjust"/><script src="/_next/static/chunks/polyfills-c67a75d1b6f99dc8.js" crossorigin="" noModule=""></script></head><body class="__variable_f367f3 __variable_3c557b antialiased"><div class="min-h-screen bg-white"><nav class="bg-white shadow-sm border-b border-gray-200"><div class="max-w-7xl mx-auto px-4 sm:px-6 lg:px-8"><div class="flex justify-between items-center h-16"><div class="flex items-center"><div class="flex-shrink-0 flex items-center"><img alt="InvoizaPro Logo" loading="lazy" width="50" height="50" decoding="async" data-nimg="1" class="w-10 h-10" style="color:transparent" srcSet="/_next/image?url=%2Fimages%2Flogo.png&w=64&q=75 1x, /_next/image?url=%2Fimages%2Flogo.png&w=128&q=75 2x" src="/_next/image?url=%2Fimages%2Flogo.png&w=128&q=75"/><span class="ml-2 text-xl font-bold text-gray-900">InvoizaPro</span></div></div><div class="hidden md:block"><div class="ml-10 flex items-baseline space-x-4"><a href="#features" class="text-gray-600 hover:text-gray-900 px-3 py-2 rounded-md text-sm font-medium">Features</a><a href="#pricing" class="text-gray-600 hover:text-gray-900 px-3 py-2 rounded-md text-sm font-medium">Pricing</a><a href="#testimonials" class="text-gray-600 hover:text-gray-900 px-3 py-2 rounded-md text-sm font-medium">Testimonials</a><a class="text-gray-600 hover:text-gray-900 px-3 py-2 rounded-md text-sm font-medium" href="/auth/login">Sign In</a><a class="bg-blue-600 text-white px-4 py-2 rounded-md text-sm font-medium hover:bg-blue-700" href="/auth/register">Get Started</a></div></div><div class="md:hidden"><button class="inline-flex items-center justify-center p-2 rounded-md text-gray-400 hover:text-gray-500 hover:bg-gray-100"><svg xmlns="http://www.w3.org/2000/svg" width="24" height="24" viewBox="0 0 24 24" fill="none" stroke="currentColor" stroke-width="2" stroke-linecap="round" stroke-linejoin="round" class="lucide lucide-menu w-6 h-6"><line x1="4" x2="20" y1="12" y2="12"></line><line x1="4" x2="20" y1="6" y2="6"></line><line x1="4" x2="20" y1="18" y2="18"></line></svg></button></div></div></div></nav><section class="bg-gradient-to-br from-blue-50 to-indigo-100 py-20"><div class="max-w-7xl mx-auto px-4 sm:px-6 lg:px-8"><div class="text-center"><h1 class="text-4xl md:text-6xl font-bold text-gray-900 mb-6">Automate Your<span class="text-blue-600"> Invoice Process</span></h1><p class="text-xl text-gray-600 mb-8 max-w-3xl mx-auto">Streamline your business with our comprehensive AI e-invoicing solution. Create, send, and manage invoices effortlessly while gaining valuable insights into your business performance.</p><div class="flex flex-col sm:flex-row gap-4 justi
Open service 35.157.26.135:443 · osalmaoemuitovalorizado.pt
2026-01-13 00:13
HTTP/1.1 200 OK Accept-Ranges: bytes Age: 2 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 582 Content-Type: text/html; charset=UTF-8 Date: Tue, 13 Jan 2026 00:13:43 GMT Etag: "ed6ba42fb772480c1039ad276fe173b1-ssl" Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB72DHSFE3MQ1RCG97N3E0 Connection: close Page title: Dodô <!doctype html><html lang="en"><head><meta charset="UTF-8"/><meta name="viewport" content="width=device-width,initial-scale=1"/><meta http-equiv="X-UA-Compatible" content="ie=edge"/><title>Dodô</title><link rel="icon" href="/icon.png"/><link rel="preconnect" href="https://res.cloudinary.com" crossorigin/><link rel="dns-prefetch" href="https://res.cloudinary.com"/><script defer="defer" src="/static/js/main.06860946.js"></script><link href="/static/css/main.608199bf.css" rel="stylesheet"></head><body><div id="root"></div><script src="/static/js/main.js"></script></body></html>
Open service 35.157.26.135:80 · www.osalmaoemuitovalorizado.pt
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:50 GMT Location: https://www.osalmaoemuitovalorizado.pt/ Server: Netlify X-Nf-Request-Id: 01KETB79BK8MHXWKGEN0HV0WEK Content-Length: 54 Connection: close Redirecting to https://www.osalmaoemuitovalorizado.pt/
Open service 35.157.26.135:80 · osalmaoemuitovalorizado.pt
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:50 GMT Location: https://osalmaoemuitovalorizado.pt/ Server: Netlify X-Nf-Request-Id: 01KETB795WPQVMFKGH315X3ZR4 Content-Length: 50 Connection: close Redirecting to https://osalmaoemuitovalorizado.pt/
Open service 35.157.26.135:443 · www.osalmaoemuitovalorizado.pt
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:43 GMT Location: https://osalmaoemuitovalorizado.pt/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB71S10N291VG21AS7CZFP Content-Length: 50 Connection: close Redirecting to https://osalmaoemuitovalorizado.pt/
Open service 35.157.26.135:443 · flacce.eu.org
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:43 GMT Location: https://www.flacce.eu.org/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB71V2GDMQDR97K1F3QAPJ Content-Length: 41 Connection: close Redirecting to https://www.flacce.eu.org/
Open service 35.157.26.135:80 · flacce.eu.org
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:51 GMT Location: https://flacce.eu.org/ Server: Netlify X-Nf-Request-Id: 01KETB79J6KAT6CQSN4JNWK3BZ Content-Length: 37 Connection: close Redirecting to https://flacce.eu.org/
Open service 35.157.26.135:443 · www.flacce.eu.org
2026-01-13 00:13
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 2
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 16928
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:13:42 GMT
Etag: "3ef4e53ed705c8e77218838c7cd3a873-ssl"
Referrer-Policy: strict-origin-when-cross-origin
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-Nf-Request-Id: 01KETB71EBA9BZYE2G4CVR14Y2
X-Xss-Protection: 1; mode=block
Connection: close
Page title: 「 Flacce 」
<!doctype html><html lang=zh-Hans dir=ltr class=scroll-smooth data-default-appearance=dark data-auto-appearance=true><head><meta name=generator content="Hugo 0.150.0"><meta charset=utf-8><meta http-equiv=content-language content="zh-Hans"><meta name=viewport content="width=device-width,initial-scale=1"><meta http-equiv=X-UA-Compatible content="ie=edge"><meta name=theme-color><title>「 Flacce 」</title><meta name=title content="「 Flacce 」"><meta name=description content="「 长夜灯转寐,他日何时归 」"><link rel=canonical href=https://www.cvv.asia/><link rel=alternate type=application/rss+xml href=/index.xml title="「 Flacce 」"><link rel=alternate type=application/json href=/index.json title="「 Flacce 」"><link type=text/css rel=stylesheet href=/css/main.bundle.min.0621bbf615b1833cccd41379f4dee0756fbb87665a49016b397c079b8584c1c1fe62d5063b2f282aebe3508d3173ae24ffe96a62ad22d10b5029380bacff9e9d.css integrity="sha512-BiG79hWxgzzM1BN59N7gdW+7h2ZaSQFrOXwHm4WEwcH+YtUGOy8oKuvjUI0xc64k/+lqYq0i0QtQKTgLrP+enQ=="><script type=text/javascript src=/js/appearance.min.e5dad294792eb17cab5f9e78ad3ed978960cbb9501530543bc2c6499c4926eecea973224ed5e519888bebb2cfb2d96bdf1b1c688f5d4fb5e62bc689f32fedec4.js integrity="sha512-5drSlHkusXyrX554rT7ZeJYMu5UBUwVDvCxkmcSSbuzqlzIk7V5RmIi+uyz7LZa98bHGiPXU+15ivGifMv7exA=="></script><script defer type=text/javascript id=script-bundle src=/js/main.bundle.min.6dd027da84ed605a7d30fc29766d12b001b9194125833e3ece909e4180de2b22cce999860388eb66b49811d1e47049ce8f0c0eacef8253be9e1653200a7dfc62.js integrity="sha512-bdAn2oTtYFp9MPwpdm0SsAG5GUElgz4+zpCeQYDeKyLM6ZmGA4jrZrSYEdHkcEnOjwwOrO+CU76eFlMgCn38Yg==" data-copy data-copied></script><script src=/lib/zoom/zoom.min.umd.a527109b68c082a70f3697716dd72a9d5aa8b545cf800cecbbc7399f2ca6f6e0ce3e431f2062b48bbfa47c9ea42822714060bef309be073f49b9c0e30d318d7b.js integrity="sha512-pScQm2jAgqcPNpdxbdcqnVqotUXPgAzsu8c5nyym9uDOPkMfIGK0i7+kfJ6kKCJxQGC+8wm+Bz9JucDjDTGNew=="></script><link rel=apple-touch-icon sizes=180x180 href=/apple-touch-icon.png><link rel=icon type=image/png sizes=32x32 href=/favicon-32x32.png><link rel=icon type=image/png sizes=16x16 href=/favicon-16x16.png><link rel=manifest href=/site.webmanifest><meta property="og:url" content="https://www.cvv.asia/"><meta property="og:site_name" content="「 Flacce 」"><meta property="og:title" content="「 Flacce 」"><meta property="og:description" content="「 长夜灯转寐,他日何时归 」"><meta property="og:locale" content="zh_Hans"><meta property="og:type" content="website"><meta name=twitter:card content="summary"><meta name=twitter:title content="「 Flacce 」"><meta name=twitter:description content="「 长夜灯转寐,他日何时归 」"><script type=application/ld+json>{"@context":"https://schema.org","@type":"WebSite","@id":"https:\/\/www.cvv.asia\/","name":"「 Flacce 」","description":"「 长夜灯转寐,他日何时归 」","inLanguage":"zh-Hans","url":"https:\/\/www.cvv.asia\/","publisher":{"@type":"Person","name":""}}</script><script src=/lib/jquery/jquery.slim.min.b0dca576e87d7eaa5850ae4e61759c065786cdb6489d68fcc82240539eebd5da522bdb4fda085ffd245808c8fe2acb2516408eb774ef26b5f6015fc6737c0ea8.js integrity="sha512-sNylduh9fqpYUK5OYXWcBleGzbZInWj8yCJAU57r1dpSK9tP2ghf/SRYCMj+KsslFkCOt3TvJrX2AV/Gc3wOqA=="></script></head><body class="flex flex-col h-screen px-6 m-auto text-lg leading-7 max-w-7xl bg-neutral text-neutral-900 dark:bg-neutral-800 dark:text-neutral sm:px-14 md:px-24 lg:px-32 scrollbar-thin scrollbar-track-neutral-200 scrollbar-thumb-neutral-400 dark:scrollbar-track-neutral-800 dark:scrollbar-thumb-neutral-600"><div id=the-top class="absolute flex self-center"><a class="px-3 py-1 text-sm -translate-y-8 rounded-b-lg bg-primary-200 focus:translate-y-0 dark:bg-neutral-600" href=#main-content><span class="font-bold text-primary-600 ltr:pr-2 rtl:pl-2 dark:text-primary-400">↓</span></a></div><div class="main-menu flex items-center justify-between px-4 py-6 sm:px-6 md:justify-start gap-x-3 pt-[2px] pr-0 pb-[3px] pl-0"><div><a href=/ class=flex><span class=sr-only>「 Fla
Open service 35.157.26.135:443 · www.healthypupmatch.com
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:42 GMT Location: https://healthypupmatch.com/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB719H6Z3JPGH856W1FW89 Content-Length: 43 Connection: close Redirecting to https://healthypupmatch.com/
Open service 35.157.26.135:80 · www.flacce.eu.org
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:50 GMT Location: https://www.flacce.eu.org/ Server: Netlify X-Nf-Request-Id: 01KETB78QV33BSH1G3VB773RAH Content-Length: 41 Connection: close Redirecting to https://www.flacce.eu.org/
Open service 35.157.26.135:80 · www.healthypupmatch.com
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:50 GMT Location: https://www.healthypupmatch.com/ Server: Netlify X-Nf-Request-Id: 01KETB78PWVFT5STP82TP6ZGCB Content-Length: 47 Connection: close Redirecting to https://www.healthypupmatch.com/
Open service 35.157.26.135:80 · www.whisprfit.ai
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:39 GMT Location: https://www.whisprfit.ai/ Server: Netlify X-Nf-Request-Id: 01KETB6Y18KTVMV36K7Q0FKAH1 Content-Length: 40 Connection: close Redirecting to https://www.whisprfit.ai/
Open service 35.157.26.135:443 · www.whisprfit.ai
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:31 GMT Location: https://whisprfit.ai/ Server: Netlify Strict-Transport-Security: max-age=31536000 X-Nf-Request-Id: 01KETB6P4TJCY9K5W9VZRT0K00 Content-Length: 36 Connection: close Redirecting to https://whisprfit.ai/
Open service 35.157.26.135:80 · boapp.resusty.com
2026-01-13 00:13
HTTP/1.1 301 Moved Permanently Content-Type: text/plain; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:40 GMT Location: https://boapp.resusty.com/ Server: Netlify X-Nf-Request-Id: 01KETB6Z20X14NY8V5H7ZJFEQA Content-Length: 41 Connection: close Redirecting to https://boapp.resusty.com/
Open service 35.157.26.135:443 · boapp.resusty.com
2026-01-13 00:13
HTTP/1.1 200 OK
Accept-Ranges: bytes
Age: 3
Cache-Control: public,max-age=0,must-revalidate
Cache-Status: "Netlify Edge"; hit
Content-Length: 623
Content-Type: text/html; charset=UTF-8
Date: Tue, 13 Jan 2026 00:13:31 GMT
Etag: "0bd26f7bb16c8f5832eccd2e65a5fa03-ssl"
Server: Netlify
Strict-Transport-Security: max-age=31536000
X-Nf-Request-Id: 01KETB6PATB25DBA7XS7JKSQ04
Connection: close
Page title: 業務アプリポータル
<!doctype html>
<html lang="en">
<head>
<meta charset="UTF-8" />
<meta name="robots" content="noindex, nofollow" />
<link rel="icon" type="image/svg+xml" href="/vite.svg" />
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
<title>業務アプリポータル</title>
<script type="module" crossorigin src="/assets/index-CGvSgzzL.js"></script>
<link rel="stylesheet" crossorigin href="/assets/index-PdX6mYQi.css">
<script async src="https://bolt.new/badge.js?s=2319ae60-e0ac-4342-9994-d12a5c6a6c27"></script></head>
<body>
<div id="root"></div>
</body>
</html>
Open service 35.157.26.135:443 · paganelletips.online
2026-01-13 00:13
HTTP/1.1 200 OK Age: 5140209 Cache-Control: public,max-age=0,must-revalidate Cache-Status: "Netlify Edge"; hit Content-Length: 26689 Content-Type: text/html; charset=utf-8 Date: Tue, 13 Jan 2026 00:13:31 GMT Etag: "t81isig2w2kla" Netlify-Vary: query=__nextDataReq|_rsc,header=x-nextjs-data|x-next-debug-logging|next-router-prefetch|next-router-segment-prefetch|next-router-state-tree|next-url|rsc|accept-encoding,cookie=__prerender_bypass|__next_preview_data Server: Netlify Strict-Transport-Security: max-age=31536000 Vary: rsc,next-router-state-tree,next-router-prefetch,next-router-segment-prefetch,Accept-Encoding X-Content-Type-Options: nosniff X-Nextjs-Date: Mon, 15 Dec 2025 05:10:56 GMT X-Nextjs-Prerender: 1, 1 X-Nextjs-Stale-Time: 300 X-Nf-Request-Id: 01KETB6PB174J8FKDHBRRE5D89 X-Powered-By: Next.js Connection: close Page title: PaganelleTips - Links Sociais <!DOCTYPE html><!--Q9KEyfIGSkFoL3MGX6sMU--><html lang="en"><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1"/><link rel="preload" href="/_next/static/media/797e433ab948586e-s.p.dbea232f.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" href="/_next/static/media/caa3a2e1cccd8315-s.p.853070df.woff2" as="font" crossorigin="" type="font/woff2"/><link rel="preload" as="image" href="/images/design-mode/photo_2025-11-11_11-41-50.jpg"/><link rel="stylesheet" href="/_next/static/chunks/8a80e7184ad3a13f.css" data-precedence="next"/><link rel="stylesheet" href="/_next/static/chunks/54ab2e3d82b7e553.css" data-precedence="next"/><link rel="preload" as="script" fetchPriority="low" href="/_next/static/chunks/63a85c0b6f63f9b9.js"/><script src="/_next/static/chunks/6d41d3687ee8cd10.js" async=""></script><script src="/_next/static/chunks/5e74b248b6dc0441.js" async=""></script><script src="/_next/static/chunks/b77f9c0ff60d6c8f.js" async=""></script><script src="/_next/static/chunks/turbopack-47c76e1796f94232.js" async=""></script><script src="/_next/static/chunks/5d5e03acf2f3037a.js" async=""></script><script src="/_next/static/chunks/1e109efa3fe1594f.js" async=""></script><script src="/_next/static/chunks/1b9167bd2b3f7ef1.js" async=""></script><script src="/_next/static/chunks/27a3fdeb32b1375f.js" async=""></script><meta name="next-size-adjust" content=""/><title>PaganelleTips - Links Sociais</title><meta name="description" content="Siga PaganelleTips no Instagram, Telegram e X (Twitter)"/><link rel="manifest" href="/manifest.json"/><meta name="generator" content="v0.app"/><meta name="mobile-web-app-capable" content="yes"/><meta name="apple-mobile-web-app-title" content="PaganelleTips"/><meta name="apple-mobile-web-app-status-bar-style" content="black-translucent"/><link rel="icon" href="/pwa-icon.jpg"/><link rel="apple-touch-icon" href="/pwa-icon.jpg"/><script src="/_next/static/chunks/a6dad97d9634a72d.js" noModule=""></script></head><body class="font-sans antialiased"><div hidden=""><!--$--><!--/$--></div><div class="relative min-h-screen overflow-hidden bg-black"><div class="absolute inset-0 z-0"><canvas class="absolute inset-0 h-full w-full"></canvas><div class="absolute inset-0 bg-gradient-to-b from-black/60 via-black/40 to-black/60"></div></div><div class="relative z-10 flex min-h-screen flex-col items-center justify-center px-4 py-8 sm:py-12"><div class="mb-8 sm:mb-12 flex flex-col items-center gap-6 sm:gap-8"><div class="relative h-32 w-32 sm:h-40 sm:w-40 rounded-full overflow-hidden ring-4 ring-green-500/50 shadow-[0_0_40px_rgba(16,185,129,0.6)]"><img alt="Profile" decoding="async" data-nimg="fill" class="object-cover" style="position:absolute;height:100%;width:100%;left:0;top:0;right:0;bottom:0;color:transparent" src="/images/design-mode/photo_2025-11-11_11-41-50.jpg"/></div><div class="text-center max-w-4xl"><h1 class="text-2xl sm:text-3xl md:text-5xl lg:text-6xl font-bold leading-tight"><span class="block bg-gradient-to-r from-green-400 via-emerald-400 to-green-500 bg-clip-text text-transparent animate-shimmer text-shadow-glow">Entre no meu Telegram e veja todas as entradas que eu faço em tempo real.</span></h1></div></div><div class="flex w-full max-w-4xl flex-col gap-4 sm:gap-8"><a href="https://www.instagram.com/paganelleraul/" target="_blank" rel="noopener noreferrer" class="group relative overflow-hidden rounded-2xl p-[3px] transition-all duration-700 hover:scale-105 hover:shadow-[0_0_60px_rgba(251,146,60,0.6)] sm:rounded-3xl opacity-0 -translate-x-full pointer-events-none" style="transition-delay:0ms"><div class="absolute inset-0 rounded-2xl bg-gradient-to-r from-amber-500 via-orange-500 to-pink-500 opacity-70 transition-opacity duration-500 group-hover:opacity-100 sm:rounded-3xl animate-gradient-x"></div><div class="absolute inset-0 rounded-2xl bg-gradient-to-l from-pink-500 via-rose-500 to-amber-500 opacity-0 transition-opacity duration-500 group-hover:opacity-70 sm:rounded-3xl animate-gradient-x-reverse"></div><div class="relative overflow-hidden rou
data.ecoscopium.eu 14 www.styrkja.is 12 ayhan.phd 11 rettuordin.styrkja.is 11 natturuvernd.styrkja.is 10 sjuktspjall.styrkja.is 10 app.usemorrow.com 9 karthikroy.com 8 www.paceintl.com 6 www.clubwicked.nl 5 www.asun9.com 5 studio.aurorapay.me 4 netlify.trooper.be 4 theconnection.space 4 aptsun.co.kr 4 trooper.nl 4 webshop.trooper.be 4 crowdselling.eu 4 ultherapy-prime.co 3 estanny.org 3 augmentcrafter.org 3 unitedpressureprosfl.com 3 mieland.com 3 cosipometro.com.br 3 aptstar.co.kr 3 www.aikenist.com 3 tag.banocean.com 2 georgevourkas.com 2 development.kanzleipilot.de 2 23tattoostudio.com 2 reetamm.com 2 lizzy.consulting 2 uk.app.dev.earlypayxdev.com 2 ghazouly.site 2 ashar-kavish.online 2 getbestinshow.com 2 deschdev.com 2 wongchengpsychology.com 2 app.sensorfield.com 2 gchkongcheng.xyz 2 www.movenpickamman.com 2 bhavyhomes.tech 2 lindaocherik.se 2 staging.kanzleipilot.de 2 yuri.is 2 www.lokeshvats.com 2 cms.ecotwinproject.eu 2 dentalverse.co 2 wedigistudio.com 2 www.fizz.ee 2 menu-digjitale.com 2 questa-global.com 2 dev-auth.viildz.com 2 hellochicken.iqrarabic.com 2 perspectivepaint.com 2 vodoinstalater-ontop.rs 2 www.zu.garden 2 synsara2k25.live 2 traced.fun 2 thefamilytree.in 2 teknotrail.com 2 api.middleman.africa 2 dnurl.co 2 flightlog.nicolasbressoud.ch 2 live.dnurl.co 2 sneatetech.com 2 avantgrande.ng 1 katerina.today 1 productstack.co.in 1 mmcri.online 1 bzanalyzer.lyarinet.com 1 varshaelectronics.com 1 bluesummitmedia.co.uk 1 yourruststore.com 1 sabrinnecalone.com.br 1 mahavirmsme.com 1 suzeimmo.com 1 www.tamilvananindustries.com 1 sanshafastener.com 1 akhuwatnetworks.site 1 www.udhaari.in 1 green-fix.uk 1 www.spinalsanctuary.com 1 codynex.com 1 laundrowellgarland.com 1 www.qujingdaozhong.com 1 americanalliancetech.com 1 coolclads.com 1 vpnflazer.com 1 workystock.com 1 wuwensheng.top 1 thegreycanvas.co 1 advaitaexport.com 1 moderndecoplus.com 1 echosenses.com 1 rahul.xtreamdevs.in 1 andrewpang.dev 1 pladurypintura.es 1 gikfreelancers.com 1 rides777.com 1 mathmulti.zixlestudios.com 1 lechefvandato.com 1 flipscope.app 1 freeaicharity.org 1 shibastellar.xyz 1 hypedshoe.xyz 1 turistikus.com 1 sadhakfoundation.org 1 admin.jordancyberclub.com 1 lv110.dpdns.org 1 plaziitasite.com 1 oasisspacreations.org 1 briefnews.app 1 fappr.app 1 www.fasalgpt.biz 1 apiarioozoraide.com 1 ostravsky.guru 1 dev.certraptor.com 1 gotovaranasi.com 1 shantech.online 1 pujaparikrama.online 1 www-santaander-condimais.site 1 numberonebot.com 1 sparktrading.co.ke 1 blacksunfiction.com 1 maison-martine.com 1 thevanityunit.com 1 rohitartandcraft.in 1 carpetatributariasavan.services 1 vylandscaping.com 1 www.danzandoconelfuego.com 1 siteshow.in 1 mytasa.org 1 instacampaign.xyz 1 comp4537-lab0.pouyannorouzi.com 1 austonmatthewsfund.com 1 tikoneglobal.com 1 theapnaajob.in 1 urbanmountainride.com 1 alessiotecleme.com 1 btbi.cc 1 emirates-sabre.com 1 rocketnatic.com 1 docecor.com.br 1 before-disaster.juicesapps.xyz 1 balpokharel.com.np 1 digital-sabre.com 1 wrtpros.com 1 aiofbb.minproducer.com 1 erakkomaja.com 1 asaphdesign.com 1 adithyaiasacademy.org 1 stackon.com.au 1 adbureau.xyz 1 justinisaiahmadison-portfolio.com 1 amirawebstyles.online 1 vittsjobeer.club 1 dimas-dev.com 1 vodoinstalater-beograda.rs 1 simplydevign.com 1 rublevka-game.ru 1 website.gameflux.nl 1 dexinexhibition.com 1 sssoftwareservices.in 1 sabo-sports.com 1 hanantrading.com 1 orhideaqadraku.xyz 1 archilabs.ai 1 pdfsplitter.app 1 lojatikvah.com.br 1 commandcentersabre.com 1 lessengine.se 1 premierboatdetailingfl.com 1 y.gsv2.com 1 jabbestembo.com 1 uat.makemystuff.com.au 1 margindepartment.co 1 fram3it.com 1 paletteandfit.site 1 cogotv.nconnections.com 1 aldwrablaban.iqrarabic.com 1 lakrorane1.com 1 sociopotents.in 1 dandycookies.com 1 meaganpalmer.com 1 test.yxs.ch 1 kodratech.com 1 femmefatalepoledancingstudio.com 1 di.blaban.iqrarabic.com 1 ebisuexports.com 1 xitytour.com 1 octuriontech.com 1 creandosolucionesglobales.com.ar 1 fusioninterpreter.com 1 app.titan-office.com 1 artarun.in 1 theentrepreneurjunction.com 1 curelaserclinic.com 1 albertzeqiri.com 1 enestiryaki.me 1 lushbyzain.com 1 greateasterntrading.in 1 srivick.com 1 thebhaispecial.com 1 mcdigitalservices.pro 1 golfroundtracker.com 1 mtechnopower.online 1 iklimababangida.com 1 ibmananciais.com.br 1 ronitgandhi.com 1 yanifa.com 1 dotcollectionglobal.com 1 malajap.com 1 myathsunaiwin.com 1 haloazdj.xyz 1 www.halfsyshop.com 1 www.lawnandstone.co.uk 1 blcapitalltd.com 1 comunidademigratoria.com 1 fixwalletissues.com 1 almaobrador.art 1 multigamestore.store 1 admin.meinbau.net 1 dprcpn.com 1 menheophoto.com 1 thinkimpact.cosmium.app 1 visort.ca 1 inteeccsg.com 1 urbanauraadz.com 1 kodeexp.com 1 vodoinstalaterski-servis.rs 1 3dfied.in 1 archomesoluciones.com 1 digitalsabreterminal.com 1 c-aye-tan-o.shop 1 tajagame.geonwoo.co.kr 1 www.smartspare.parts 1 ngwaketsiliftingengineeringcivilmining.co.za 1 examsidemann.org 1 aoawpx.xyz 1 desty.site 1 podium.myfihub.com 1 cesantana.pt 1 hr02cabs.in 1 dansakifertiliser.com 1 flowapp.digital 1 ocalagutter.com 1 srinivasgundam.com 1 shop.garpuhnet.com 1 urbanvoyage.in 1 knockly.co.uk 1 mobileups.org 1 vigiatech.cl 1 lesantiquaireslorrains.com 1 connect.appulse.net 1 www.phoenixofresilience.org 1 nortaxnoronha.com.br 1 bhaukaalstudios.com 1 dbs.anypro.ai 1 rollbackbjj.com 1 www.jobsureqa.site 1 www.imageoftext.com 1 psv2residence.site 1 2scarsdetails.site 1 www.kapitol.cz 1 www.pertenza.com.br 1 www.zoromobility.com 1 udaydokras.com 1 pvsceducationaccess.com 1 ticketbox-meet-and-greet-can-yaman-italyevent.com 1 prompt.gerozayas.com 1 pugga.site 1 dreamhomesdevelopers.co.uk 1 breezblox.com 1 lexadvog.com.br 1 www.marketpos.uz 1 snackwords.ppmaiedu.cn 1 richguy.fun 1 kaplanlarholding.com 1 ridosoft.majd.cloud 1 velvetpumpkinportraits.com 1 nswbegoniasociety.com 1 kktmatrimony.com 1 redolanse.com 1 urocaremysore.com 1 psimanuelandrade.com.br 1 orzesze.eu 1 adilsayeed.info 1 techinnovation.solutions 1 k-osei.com 1 www.orgaflux.dz 1 www.iradlimousine.com 1 vastuvitaa.com 1 myconciergetv.nconnections.com 1 yang.mddcloud.cn 1 unser.kanzlei-pilot.de 1 www.kasonacreative.com 1 cearaautocenter.com.br 1 ibreformada.org.br 1 fakeuploads.de 1 ssh.clarityengine.xyz 1 faiths-campers.com 1 cliqfitapp.com 1 kcsvisaslots.com 1 www.kodea.it 1 a.westernfordhcm.com.vn 1 shop.apiwit.me 1 cms.eonmed.in 1 torchsense.torchflow.io 1 callproactive.com 1 www.trmzsound.com 1 hillranchestates.com 1 codenamepeterk.com 1 stagingv35-apidoc.testrtc.com 1 oasis.vioudigital.com 1 www.bilpit.dk 1 staging1-apidoc.testrtc.com 1 kendrick.paris 1 notifyspark.com 1 demo.dnurl.co 1 nodeapi.nihalshameem.com 1 shop.payboxtimers.com 1 apidoc.dev.testrtc.com 1 doracore.com 1 www.pugh.pw 1 mohammad-mubaslat.com 1 awdb.theblip.org 1 www.sigstore.dev 1 apidocs.boostsystem.no 1 docs.unotech.io 1 sip.sidesafety.io 1 statistics.domaindumper.com 1 app.estimatic.com 1 blaban.iqrarabic.com 1 pk-sbc.io 1 entrepath.net 1 luminix.cloud 1 docs-mainbersama.azharlihan.com 1 dia4prasempre.com.br 1 cm-app.co.uk 1 vendor-api-swagger.therealreal.com 1 blpy.attilafarago.hu 1 www.finatlassigorta.com.tr 1 redveilgames.com 1 mscontractorsandbuilders.com 1 themoldslayers.com 1 www.gotomarketsolutions.co.ke 1 raydesigntechnologies.com 1 aquaworld.co.ke 1 thabata.work 1 matchmed.org 1 jaunt.app 1 cytotecs.com 1 bibeshbasnet.com.np 1 netlify.chanjet.me 1 larguxa.com 1 hilight.pro 1 ragit.ch 1 mta-sts.datahelix.bio 1 buzzoverflow.com 1 redhilleducationgroup.com 1 estately.com.ng 1 franqup.com.br 1 dfsobreira.pt 1 app.beampipe.io 1 houdinigraphql.com 1 arthurgutierrez.com.br 1 nadel.cloud 1 rojiprai.com.np 1 bb.orchard.ltd 1 stepstudio-ks.com 1 ispecs.com.ng 1 cnpred.com 1 dylanslight.net 1 interpointcompressor.com 1 scm4all.com 1 virajptl.com 1 sandalnomics.lol 1 junglegroves.com 1 donnovan.online 1 monchasseurdepierre.fr 1 www.thechaigudi.com 1 eliteinversiones.co 1 portfolio.masriq.tech 1 scope4.dev 1 taskstornado.tech 1 mindrootlabs.com 1 3d.woodprojects-diy.com 1 hotelvishal.in 1 conneural.com 1 5stardumps.com 1 arkanalytical.in 1 fromtheretohere.unitedtalent.com 1 poemsbycourtney.co.za 1 basebrunos.xyz 1 termo.mrsdeveloper.pro.br 1 jeffswear.havlink.com 1 ashar-kavish.info 1 caleblaurent.dev 1 www.ascentiqtechno.com 1 mvrlogistics.in 1 paksons-enterprises-ltd.store 1 kcal-ai.app 1 selinagurung.com.np 1 akif.pw 1 avitravels.com 1 dreamcoffeepr.com 1 denmith.com 1 amazonwoods.in 1 mazentalsam.com 1 sglobal.spr-ksa.com 1 student-bridge.com 1 thewalkercollective.co.uk 1 sampling-with-hard-constraints.site 1 falcon-heart.com 1 cursosmp.com 1 mowtivationlawncare.com 1 gescreativestudio.com 1 academicweb.in 1 hibahshah.xyz 1 bionexaglobal.com 1 zipcode.commente.me 1 notaphonologist.com 1 ptshivpuripriest.com 1 placobek.com 1 astrokrishnna.co.in 1 panchhee.in 1 marketplace.jigen.io 1 www.sopresi.fr 1 apanda.dev 1 truezentechnologies.com 1 safapublicschool.in 1 www.cincatequila.com 1 techsistema.com.br 1 aquasafeguards.com 1 midnightoil.online 1 claritio.com.br 1 byfiruza.cloud 1 thinkdesign.org.in 1 csg.com.ar 1 cuadrosdeluz.com.ar 1 kalipdftools.com 1 telesoko.store 1 farmersmarketla.com 1 calculatehome.com 1 pepeponke.xyz 1 www.lukemoody.ai 1 www.qubithr.io 1 www.cost5d.com 1 vaultoapp.com 1 dennistretyakov.com 1 jmlha.com 1 goodvibesonly.software 1 bellyfullwellness.com 1 esprevia.com 1 www.leadspeed.ai 1 canary.inprodwetest.com 1 www.chillioilclub.com 1 controlprenataltijuana.com 1 avocatclaudiaonica.ro 1 renansapia.adv.br 1 moshtube.com 1 www.dvrsonorg.org 1 theaurigen.com 1 www.theaurigen.com 1 www.vabahongkong.ee 1 vabahongkong.ee 1 monarktek.io 1 www.meinepacks-live.de 1 autowfleet.com 1 www.monarktek.io 1 www.unes.work 1 www.nfda.org.ng 1 www.turbulence-smp.com 1 godsyouthmovement.org 1 www.foodvery.com.do 0 nekodraconis.com 1 audit.waterfronthospital.co.uk 1 sentiminds-insight.dartisan.tech 1 zanardiniengenharia.com.br 1 www.sheffieldtrades.co.uk 1 sheffieldtrades.co.uk 1 davidandthearchitect.com 1 wms.nissin-ion.co.kr 1 app.markbase.xyz 1 paganelletips.online 0 boapp.resusty.com 1 www.whisprfit.ai 1 www.healthypupmatch.com 1 www.flacce.eu.org 1 flacce.eu.org 1 www.osalmaoemuitovalorizado.pt 1 osalmaoemuitovalorizado.pt 1 einvoice.invoizapro.com 1 www.mrslideon.com 1 bridgepointai.consulting 0 www.alinartgalery.shop 1 srecanrodjendanrebice.live 1 framesizeapp.digitalplannervault.com 1 chroniv.com 1 404cne.com.ar 1 quotelogger.com 1 www.slfilmstudio.com 1 debtorinfo.com.au 1 www.aufdieplakate.de 1 jasteck.lol 1 www.aufdieplakate.com 1 www.radlinguist.com 1 luxmines.io 1 www.404cne.com.ar 1 primeheaven.ca 1 www.quikbulk.com 1 www.projetodestrave.com 1 ibusinessloan.com.sg 1 www.luxmines.io 1 kindcompanion.chat 1 phoenixpublicadjustingfl.com 1 app.catination.com 0 mellytek.com 1 chaveirimcherryhill.com 1 www.beforeafterpic.com 1 compose.diamonds 0 trumanheberle.com 1 www.compose.diamonds 1 abstractphotorealism.com 1 keckcontractingkc.com 1 www.hytalefans.com 1 www.balihaisystem.online 1 www.mellytek.com 1 www.whisply.co 1 whisply.co 1 www.wwcompliance.com 1 www.ositosbendecidos.com 1 ositosbendecidos.com 1 lolboxno1.com 1 betitutors.com 1 tamiltyping.musivalingam.com 1 pocket.tinyatdragon.com 1 www.novexconsulting.com 1 www.allmadheretherapy.com 1 www.badhaiplay.com 1 sparkgames.live 1 www.caafimaadai.com 1 www.pshar.ma 1 afroshopberlin.com 1 www.verso.gg 1 purityprocleaning.com 1 www.proofofdestruction.com 1 koblia.com 1 experienciatricheta.com.ar 1 experienciatricheta.com 1 tracuuhanhchinh.vn 1 www.swiftcaploans.com 1 lxdroddyfallacies.com 1 aspire.carecycle.ai 1 ice.sa 1 raimundoconsultant.services 1 peterskousen.dk 1 findme.gg 1 www.jjmahone.com 1 www.fringe.travel 1 auditvault.quantamind.co 1 gradac.ba 1 www.shanthionlinegold.com 1 wow.inprodwetest.com 1 image.mlprint.com.au 1 www.washpointpartners.com 1 www.jade19.com 1 www.builddigital.com.au 1 www.razzorbackprintsanddesign.com 1 scanbrand.co 1 alpha.inprodwetest.com 1 www.laserwareaero.com 1 www.optiloyalty.com 1 optiloyalty.com 1 gentlesaintbernardpuppies.com 1 www.tensortribe.in 1 www.nexgenlabs.site 1 pumpashelter.org 1 www.halisaha.art 1 loganindustry.com 1 quiz-ai.progreslab.net 1 www.loganindustry.com 1 bnoma.com 0 directorioia.com.ar 1 panetonesecia.site 1 www.leadspeed.site 1 bestcryptoswap.com 1 psychicgabby.com 1 chrisworthgroup.com 1 www.waxwondersindia.com 1 waxwondersindia.com 1 www.velixantechnologies.com 1 velixantechnologies.com 1 safteynet.app 1 tinyhouselistings.com 0 tesladogepro.com 1 setifyu.com 1 voiture-hs.fr 1 flowcafe.gr 1 zeoxzhang.com 1 smartacademyia.org 1 arthurmurraysalem.com 1 georginayeboah.com 1 www.kovacusuireiki.com.tr 1 moul.io 1 norgardenespaciosverdes.app 1 lvkcc24.org 1 www.syncsquads.com 1 evergreenflooring1.com 1 www.connect-source.com 1 moontuner.xyz 1 www.proveo.shop 1 www.krlabs.co.uk 1 arcfinder.co.uk 1 valerie.blacktideagency.com 1 flowsuu.busrasuhaydar.com 1 cwai.vu22dx.com 1 www.brookssolutions.xyz 1 temanbatin.com 1 brainerly.com 1 greenarsenal.net 1 www.gklean.com 1 www.govistara.com 1 govistara.com 1 www.codesmart.in 1 www.dralisonreiter.com.br 1 patelkiran.dev 1 www.patelkiran.dev 1 godsyouthmovment.org 1 meowcoffee.com.tw 1 ichingnext.com 1 thecivicprism.org 1 chillioilclub.com 1 anonella.xyz 1 nodefleet.org 1 uzs.info 1 maciekpalmowski.dev 1 bodyslimisrael.co.il 1 animathio.com 1 blockchain-sage.com 1 eliasanalytics.com 1 www.nayeon.site 1 steal.so 1 swapethereum.com 1 justbonkit.lol 1 densyte.org 1 www.mandiahasthina.live 1 www.fusion.skin 1 www.thelitfinance.com 1 www.dodra.racing 0 dodra.racing 1 www.marinagasservice.com 1 marinagasservice.com 1 democracents.org 1 zahlfix.com 1 meowsthetime.shop 1 openmapsafaris.co.ke 1 www.felipesoto.cl 1 creastic.byronic.art 1 www.wirabot.xyz 1 www.jejuoreum.kr 1 expertlockandkey.com 1 bultimore.com 1 www.firstx.ai 1 ateliernava.com 1 www.baggythetrencher.app 1 www.popupmarketeers.co.za 1 infinitesupport.com.au 1 mapasmentalesbiblia.com 1 calvohq.com 1 www.studyaipro.com 1 www.semmanuel.com 1 prospairityconsulting.com 1 everythingexists.online 1 www.netviewtv.com 1 secretdereines.com 1 rhdigitalinc.com 1 benti-tech.com 1 www.inspiradatanusa.com 1 www.randallfx.com 1 www.bunkersync.com 1 www.sailmate.info 1 www.sailmate.fi 1 www.prissnap.no 1 www.forexharmony.com 1 www.sailmate.io 1 www.sailmate.org 1 www.nautics.fi 1 www.sailmate.it 1 m.sailmate.fi 1 www.sailmate.ru 1 www.sailmate.se 1 itsalexandras.com 1 www.go3pl.net 1 www.beyond-structure.com 1 livestage.hempin.org 1 ottautomotive.com 1 app.automatecontent.io 1 www.tshbestfood.com 1 brg.justinmichaelcahoon.com 1 sso-dev.kitesoft.xyz 1 www.hongkongmagician.com 1 www.goinwith.me 1 mrturbino.app 1 www.covaraai.com 1 synchro.eng.br 1 www.synchro.eng.br 1 www.anthonyle.cv 1 www.qiuyucode.com 1 blog.qiuyucode.com 1 estimator.reviverenovations.com 1 www.caymen.ky 1 unicup.fantasytier.com 1 mestream.io 1 www.stratadapt.agency 1 www.bizlicenseresearch.com 1 airvanasystems.org 1 randomwritesrandomlights.com 1 asaphousecleaning.com 1 www.dantedev.site 1 xelscapital.com 1 safety-net.systems 1 grzywacztech.pl 1 pmors2020.info 1 www.techstesoft.com 1 www.cruisinalong.com 1 cruisinalong.com 1 olhovivo.site 1 www.wasabhi.dev 1 stechgp.com 1 everythingstudios.ai 1 www.kaletuvaturizm.com 1 gifto.online 1 glacialtravels.com 1 www.vitrekpharma.in 1 vitrekpharma.in 1 www.glacialtravels.com 1 buroku.nevercry.top 1 homeguardian.vedawellapp.com 1 carsonacademy.org 1 www.novatransmutes.com 1 www.gloryeventsbusiness.ca 1 gloryeventsbusiness.ca 1 sitemaps.mydripnurse.com 1 likvidacevozidel.info 1 www.wetechcareenterprises.com 1 www.truecarevirtualsolutions.com 1 randy.ch 1 www.exback-healererwin.ca 1