Host 162.241.252.95
United States
Software information
Apache
tcp/443 tcp/80
nginx 1.21.6
tcp/443 tcp/80
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: wildacornapothecary.thebrandstand.co
Port: 443
URL: https://wildacornapothecary.thebrandstand.coFirst seen 2022-12-27 21:50
Last seen 2024-07-06 13:12
Open for 556 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-06 13:12
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: 4irmicrogrid.whcapitalleasing.com
Port: 443
URL: https://4irmicrogrid.whcapitalleasing.comFirst seen 2022-12-28 22:10
Last seen 2024-07-06 13:09
Open for 555 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-06 13:09
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-10-01 20:59
Last seen 2024-07-06 12:48
Open for 643 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522295112a7[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://maxlongint@bitbucket.org/maxlongint/estonishingevenings.git fetch = +refs/heads/*:refs/remotes/origin/* [user] email = maxlongint1010@gmail.com name = asdfghjkl [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-07-06 12:48369 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-01 21:58
Last seen 2024-07-06 12:46
Open for 582 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-07-06 12:46
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: brightbalkanmorning.charleskeil.org
Port: 443
URL: https://brightbalkanmorning.charleskeil.orgFirst seen 2022-10-24 21:31
Last seen 2024-07-06 12:24
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f15e2e1ed78e55686c932c529Found 6 files trough .DS_Store spidering: /_notes /cgi-bin /images /images/_notes /logs /logs/_notes
Found on 2024-07-06 12:24 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfce4d72915db5b4697926a8370547684daFound 4 files trough .DS_Store spidering: /_notes /cgi-bin /images /logs
Found on 2022-10-24 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: anderson4bellingham.taradactyldesign.com
Port: 443
URL: https://anderson4bellingham.taradactyldesign.comFirst seen 2023-02-28 07:43
Last seen 2024-07-06 12:06
Open for 494 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-06 12:06
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-24 21:52
Last seen 2024-07-06 11:41
Open for 559 days-
Severity: high
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1b0ccce1a956d22441704fbadc6121baeFound 34 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails /wpThumbnails/_notes
Found on 2024-07-06 11:41 -
Severity: high
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea960a7ff022d03656c1610334557161befFound 23 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-07-02 08:30 -
Severity: high
Fingerprint: 5f32cf5d6962f09cab28146bab28146b96d1aad8c6bbe54678a0e5d730e8b13bFound 21 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-30 08:53 -
Severity: high
Fingerprint: 5f32cf5d6962f09c3838040e3838040e4c9b42574b72671de72bc24ec4990b94Found 20 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-26 13:22 -
Severity: high
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02eba9147bb01863e9388ff3f20077866bFound 24 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-18 18:40 -
Severity: high
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6f459ce2f5e6f2f7569a7a79685515aa4Found 28 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-12 07:35 -
Severity: high
Fingerprint: 5f32cf5d6962f09cdafa5447dafa5447b8ba7764d4a5799a3a4274638d191759Found 18 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-05-12 22:50 -
Severity: high
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aa46723af3ea5e3d81fbc2645a584b7739Found 33 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails
Found on 2023-08-31 15:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.musicgrooves-org.charleskeil.org
Port: 443
URL: https://www.musicgrooves-org.charleskeil.orgFirst seen 2022-10-24 21:31
Last seen 2024-07-06 11:41
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbebb9ada1f12a53427246f790703d93044Found 15 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /MusicGrooves/_notes /MusicGrooves/images /photos
Found on 2024-07-06 11:41 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0173f50919af06df924b9fca5fbc1d62eFound 13 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /photos
Found on 2024-06-08 10:29 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f87723477e4eb59bd71435d26adabaf30c556Found 11 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /docs /images /MusicGrooves /photos
Found on 2023-08-28 21:22 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fdfa3e56815364c4c87dd9e86d7f277a0Found 10 files trough .DS_Store spidering: /_notes /admin /articles /cgi-bin /Connections /dialogs /docs /images /MusicGrooves /photos
Found on 2022-12-24 21:52
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.252.95
Domain: www.stdbfs.ja-developments.com
Port: 443
URL: https://www.stdbfs.ja-developments.comFirst seen 2024-01-04 21:44
Last seen 2024-07-06 11:11
Open for 183 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4a1837aa[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Kelvinavq/stdbfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-06 11:11298 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.128path-org.charleskeil.org
Port: 443
URL: https://www.128path-org.charleskeil.orgFirst seen 2022-10-24 21:30
Last seen 2024-07-06 08:00
Open for 620 days-
Severity: high
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1b0ccce1a956d22441704fbadc6121baeFound 34 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails /wpThumbnails/_notes
Found on 2024-07-06 08:00 -
Severity: high
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea960a7ff022d03656c1610334557161befFound 23 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-30 07:00 -
Severity: high
Fingerprint: 5f32cf5d6962f09c3838040e3838040e4c9b42574b72671de72bc24ec4990b94Found 20 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-26 08:35 -
Severity: high
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02eba9147bb01863e9388ff3f20077866bFound 24 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-24 05:34 -
Severity: high
Fingerprint: 5f32cf5d6962f09cdafa5447dafa5447b8ba7764d4a5799a3a4274638d191759Found 18 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-04-29 01:48 -
Severity: high
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aa46723af3ea5e3d81fbc2645a584b7739Found 33 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails
Found on 2023-09-07 06:41 -
Severity: high
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a07d716c7d75dc88ee7f3a7603efbc0095Found 13 files trough .DS_Store spidering: /.smileys /_notes /bands /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2023-08-31 17:33 -
Severity: high
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6f459ce2f5e6f2f7569a7a79685515aa4Found 28 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2023-04-26 20:48 -
Severity: high
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35bf1e3f9484360a2766c0dce07de46b09eFound 14 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2022-12-24 21:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: records.ncethicalsociety.org
Port: 443
URL: https://records.ncethicalsociety.orgFirst seen 2022-11-15 21:58
Last seen 2024-07-06 07:46
Open for 598 days-
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-07-06 07:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02a7ea88e30f7e6e5deff6df97440895bfFound 24 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-30 05:18 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c75d69a7675d69a765953edff2c6c4d39c887bd13e5e83880Found 51 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Programs
Found on 2024-06-06 04:54 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfc58bbbf25c655002fe28e07a6f548e99aFound 4 files trough .DS_Store spidering: /images /membersonly /Platforms /Programs
Found on 2024-06-04 04:29 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4a8257cbd7e2425277ae21ad91f16a0ccFound 40 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-05-29 11:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ce9dbcc92e9dbcc927d8f57b3130c5bedaae863c751ee2ac0Found 60 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs /Programs/images /Programs/images/3-1-2012_files /Programs/images/3-12-UPDATE_files /Programs/images/_notes /Programs/images/Email Spotlight /Programs/images/Email Spotlight/images /Programs/images/Email Spotlight/images/_notes /Programs/images/pngs
Found on 2024-05-28 08:38 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b7076adfd412c5f1f4bf37316ed5ee5fe86Found 26 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-05-24 00:20 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c3b95ca2b3b95ca2baeb1409cb77b4be66029b5cc14f75372Found 58 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs /Programs/images /Programs/images/3-1-2012_files /Programs/images/3-12-UPDATE_files /Programs/images/_notes /Programs/images/Email Spotlight /Programs/images/pngs
Found on 2024-03-21 16:39 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81c5f48fd20f4a62544e747ff2c3943312Found 41 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-03-08 10:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:39
Last seen 2024-07-06 07:43
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f47e2769895a4bbf293d2050f1c1849f8Found 10 files trough .DS_Store spidering: /administration /cgi-bin /db /directory /homepage /images /malicious_files /scripts /sermons /staff
Found on 2024-07-06 07:43
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:31
Last seen 2024-07-06 07:05
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbebb9ada1f12a53427246f790703d93044Found 15 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /MusicGrooves/_notes /MusicGrooves/images /photos
Found on 2024-07-06 07:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0173f50919af06df924b9fca5fbc1d62eFound 13 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /photos
Found on 2024-06-08 18:17 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f87723477e4eb59bd71435d26adabaf30c556Found 11 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /docs /images /MusicGrooves /photos
Found on 2024-04-29 01:31 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744dbcf7e17eda50c9ea554dd580462165ccFound 12 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /images /MusicGrooves /photos
Found on 2022-10-24 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:31
Last seen 2024-07-06 07:02
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f15e2e1ed78e55686c932c529Found 6 files trough .DS_Store spidering: /_notes /cgi-bin /images /images/_notes /logs /logs/_notes
Found on 2024-07-06 07:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: ehstrecords-info.ncethicalsociety.org
Port: 443
URL: https://ehstrecords-info.ncethicalsociety.orgFirst seen 2022-09-20 21:09
Last seen 2024-07-06 06:32
Open for 654 days-
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-07-06 06:32 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4a8257cbd7e2425277ae21ad91f16a0ccFound 40 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-07-02 19:16 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c248e4f81248e4f81c5f48fd20f4a62544e747ff2c3943312Found 41 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-30 21:15 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b7076adfd412c5f1f4bf37316ed5ee5fe86Found 26 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-26 17:32 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c75d69a7675d69a765953edff2c6c4d39c887bd13e5e83880Found 51 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Programs
Found on 2024-06-24 10:32 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ce9dbcc92e9dbcc927d8f57b3130c5bedaae863c751ee2ac0Found 60 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs /Programs/images /Programs/images/3-1-2012_files /Programs/images/3-12-UPDATE_files /Programs/images/_notes /Programs/images/Email Spotlight /Programs/images/Email Spotlight/images /Programs/images/Email Spotlight/images/_notes /Programs/images/pngs
Found on 2024-06-16 19:39 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c680cb8ce680cb8cea5d6f717a863e761817a0feb43e2662eFound 59 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs /Programs/images /Programs/images/3-1-2012_files /Programs/images/3-12-UPDATE_files /Programs/images/_notes /Programs/images/Email Spotlight /Programs/images/Email Spotlight/images /Programs/images/pngs
Found on 2024-06-08 15:29 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b91a908b7e28ee39664f7a75922ec1251ebFound 52 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs
Found on 2024-05-01 01:48 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02a7ea88e30f7e6e5deff6df97440895bfFound 24 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-03-21 14:07 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c3b95ca2b3b95ca2baeb1409cb77b4be66029b5cc14f75372Found 58 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs /Programs/images /Programs/images/3-1-2012_files /Programs/images/3-12-UPDATE_files /Programs/images/_notes /Programs/images/Email Spotlight /Programs/images/pngs
Found on 2024-03-08 10:34 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cef4770e6ef4770e6424e56ef6614ad299cf4bf63bd6e5c37Found 42 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2023-09-22 21:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:39
Last seen 2024-07-06 05:54
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f47e2769895a4bbf293d2050f1c1849f8Found 10 files trough .DS_Store spidering: /administration /cgi-bin /db /directory /homepage /images /malicious_files /scripts /sermons /staff
Found on 2024-07-06 05:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.anderson4bellingham.com
Port: 443
URL: https://www.anderson4bellingham.comFirst seen 2022-10-27 21:15
Last seen 2024-07-06 05:48
Open for 617 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-06 05:48
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-23 21:17
Last seen 2024-07-06 05:35
Open for 743 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228648f768[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/chuagh74/chuaghNet_www.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-07-06 05:35288 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.brightbalkanmorning.com
Port: 443
URL: https://mail.brightbalkanmorning.comFirst seen 2022-10-24 21:31
Last seen 2024-07-06 05:03
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f15e2e1ed78e55686c932c529Found 6 files trough .DS_Store spidering: /_notes /cgi-bin /images /images/_notes /logs /logs/_notes
Found on 2024-07-06 05:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: anderson4bellingham.taradactyldesign.com
Port: 80
URL: http://anderson4bellingham.taradactyldesign.comFirst seen 2022-12-28 22:03
Last seen 2024-07-06 04:29
Open for 555 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-06 04:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:15
Last seen 2024-07-06 03:54
Open for 617 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-06 03:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.records.ncethicalsociety.org
Port: 443
URL: https://www.records.ncethicalsociety.orgFirst seen 2022-11-15 21:58
Last seen 2024-07-06 03:37
Open for 598 days-
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-07-06 03:37 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbe40e6b8c7978474117f70173b00964a73Found 15 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-30 15:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b7076adfd412c5f1f4bf37316ed5ee5fe86Found 26 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-28 20:13 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c75d69a7675d69a765953edff2c6c4d39c887bd13e5e83880Found 51 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Programs
Found on 2024-06-26 19:04 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02a7ea88e30f7e6e5deff6df97440895bfFound 24 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-18 12:41 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b91a908b7e28ee39664f7a75922ec1251ebFound 52 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs
Found on 2024-06-16 08:57 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4a8257cbd7e2425277ae21ad91f16a0ccFound 40 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-08 15:35 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ce9dbcc92e9dbcc927d8f57b3130c5bedaae863c751ee2ac0Found 60 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs /Programs/images /Programs/images/3-1-2012_files /Programs/images/3-12-UPDATE_files /Programs/images/_notes /Programs/images/Email Spotlight /Programs/images/Email Spotlight/images /Programs/images/Email Spotlight/images/_notes /Programs/images/pngs
Found on 2024-05-26 08:33 -
Severity: medium
Fingerprint: 5f32cf5d6962f09cef4770e6ef4770e6424e56ef6614ad299cf4bf63bd6e5c37Found 42 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-05-12 23:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:19
Last seen 2024-07-06 03:33
Open for 617 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-07-06 03:33
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2024-01-04 21:44
Last seen 2024-07-06 02:21
Open for 183 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4a1837aa[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Kelvinavq/stdbfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-06 02:21298 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-01 21:58
Last seen 2024-07-06 01:54
Open for 582 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-07-06 01:54
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.brightbalkanmorning.charleskeil.org
Port: 443
URL: https://www.brightbalkanmorning.charleskeil.orgFirst seen 2022-10-24 21:31
Last seen 2024-07-06 01:19
Open for 620 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f15e2e1ed78e55686c932c529Found 6 files trough .DS_Store spidering: /_notes /cgi-bin /images /images/_notes /logs /logs/_notes
Found on 2024-07-06 01:19 -
Severity: low
Fingerprint: 5f32cf5d6962f09c3c1fc5e93c1fc5e9b50509f2d3b10520d80eff317230b5d3Found 5 files trough .DS_Store spidering: /_notes /cgi-bin /images /images/_notes /logs
Found on 2024-04-28 20:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-23 23:04
Last seen 2024-07-06 00:38
Open for 498 days-
Severity: high
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea960a7ff022d03656c1610334557161befFound 23 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-07-06 00:38 -
Severity: high
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02eba9147bb01863e9388ff3f20077866bFound 24 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-07-04 13:24 -
Severity: high
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1b0ccce1a956d22441704fbadc6121baeFound 34 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails /wpThumbnails/_notes
Found on 2024-06-24 07:00 -
Severity: high
Fingerprint: 5f32cf5d6962f09cab28146bab28146b96d1aad8c6bbe54678a0e5d730e8b13bFound 21 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-18 01:55 -
Severity: high
Fingerprint: 5f32cf5d6962f09c3838040e3838040e4c9b42574b72671de72bc24ec4990b94Found 20 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-02 20:04 -
Severity: high
Fingerprint: 5f32cf5d6962f09cdafa5447dafa5447b8ba7764d4a5799a3a4274638d191759Found 18 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-05-08 19:51 -
Severity: high
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6f459ce2f5e6f2f7569a7a79685515aa4Found 28 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-02-01 21:33
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.252.95
Domain: stdbfs.ja-developments.com
Port: 443
URL: https://stdbfs.ja-developments.comFirst seen 2024-01-04 21:44
Last seen 2024-07-05 20:51
Open for 182 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4a1837aa[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Kelvinavq/stdbfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-05 20:51298 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2024-01-04 21:44
Last seen 2024-07-05 20:51
Open for 182 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4a1837aa[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Kelvinavq/stdbfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-05 20:51298 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2024-01-04 21:44
Last seen 2024-07-05 20:51
Open for 182 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044baa2727ab8135b5bbc521bbb4a1837aa[core] repositoryformatversion = 0 filemode = false bare = false logallrefupdates = true symlinks = false ignorecase = true [remote "origin"] url = https://github.com/Kelvinavq/stdbfs.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "main"] remote = origin merge = refs/heads/main
Found on 2024-07-05 20:51298 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.brightbalkanmorning.com
Port: 443
URL: https://www.brightbalkanmorning.comFirst seen 2023-03-03 21:53
Last seen 2024-07-05 20:37
Open for 489 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c2eda814e2eda814efa4e382f15e2e1ed78e55686c932c529Found 6 files trough .DS_Store spidering: /_notes /cgi-bin /images /images/_notes /logs /logs/_notes
Found on 2024-07-05 20:37
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.252.95
Domain: mail.estonishingevenings.com
Port: 443
URL: https://mail.estonishingevenings.comFirst seen 2022-10-01 20:59
Last seen 2024-07-04 20:47
Open for 641 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522295112a7[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://maxlongint@bitbucket.org/maxlongint/estonishingevenings.git fetch = +refs/heads/*:refs/remotes/origin/* [user] email = maxlongint1010@gmail.com name = asdfghjkl [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-07-04 20:47369 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-24 21:52
Last seen 2024-07-04 20:46
Open for 557 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbebb9ada1f12a53427246f790703d93044Found 15 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /MusicGrooves/_notes /MusicGrooves/images /photos
Found on 2024-07-04 20:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f87723477e4eb59bd71435d26adabaf30c556Found 11 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /docs /images /MusicGrooves /photos
Found on 2024-06-18 09:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0173f50919af06df924b9fca5fbc1d62eFound 13 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /photos
Found on 2024-05-28 16:57 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744dbcf7e17eda50c9ea554dd580462165ccFound 12 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /images /MusicGrooves /photos
Found on 2022-12-24 21:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.4ir-microgrid.whcapitalleasing.com
Port: 443
URL: https://www.4ir-microgrid.whcapitalleasing.comFirst seen 2022-10-27 21:18
Last seen 2024-07-04 20:41
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:18
Last seen 2024-07-04 20:41
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: musicgrooves-org.charleskeil.org
Port: 443
URL: https://musicgrooves-org.charleskeil.orgFirst seen 2022-10-24 21:31
Last seen 2024-07-04 20:32
Open for 618 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbebb9ada1f12a53427246f790703d93044Found 15 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /MusicGrooves/_notes /MusicGrooves/images /photos
Found on 2024-07-04 20:32 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0173f50919af06df924b9fca5fbc1d62eFound 13 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /photos
Found on 2024-05-27 12:33 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fdfa3e56815364c4c87dd9e86d7f277a0Found 10 files trough .DS_Store spidering: /_notes /admin /articles /cgi-bin /Connections /dialogs /docs /images /MusicGrooves /photos
Found on 2022-12-24 21:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:15
Last seen 2024-07-04 20:30
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:30
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.wildacornapothecary.com
Port: 443
URL: https://mail.wildacornapothecary.comFirst seen 2022-12-28 22:06
Last seen 2024-07-04 20:23
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:23
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: reliancemachinecompany.com
Port: 443
URL: https://reliancemachinecompany.comFirst seen 2022-10-26 21:26
Last seen 2024-07-04 20:18
Open for 616 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf176425e7d578a373e3544373e3544373e3544Found 2 files trough .DS_Store spidering: /3567images /book_store
Found on 2024-07-04 20:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-08-29 21:07
Last seen 2024-07-04 20:13
Open for 309 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:13
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-28 22:10
Last seen 2024-07-04 20:12
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:12
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-28 22:10
Last seen 2024-07-04 20:12
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:12
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-19 21:55
Last seen 2024-07-04 20:10
Open for 592 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.wildacornapothecary.thebrandstand.co
Port: 443
URL: https://www.wildacornapothecary.thebrandstand.coFirst seen 2022-12-27 21:50
Last seen 2024-07-04 20:04
Open for 554 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:18
Last seen 2024-07-04 20:02
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-28 22:10
Last seen 2024-07-04 20:02
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.4irmicrogrid.whcapitalleasing.com
Port: 443
URL: https://www.4irmicrogrid.whcapitalleasing.comFirst seen 2023-02-28 08:03
Last seen 2024-07-04 20:02
Open for 492 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 20:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.alejandrobosqued.ammanetwork.org
Port: 443
URL: https://www.alejandrobosqued.ammanetwork.orgFirst seen 2022-11-19 21:55
Last seen 2024-07-04 19:56
Open for 592 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.anderson4bellingham.com
Port: 80
URL: http://www.anderson4bellingham.comFirst seen 2022-10-27 21:15
Last seen 2024-07-04 19:40
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.reliancemachinecompany.com
Port: 443
URL: https://www.reliancemachinecompany.comFirst seen 2022-10-26 21:26
Last seen 2024-07-04 19:36
Open for 616 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf176425e7d578a373e3544373e3544373e3544Found 2 files trough .DS_Store spidering: /3567images /book_store
Found on 2024-07-04 19:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: 4ir-microgrid.whcapitalleasing.com
Port: 443
URL: https://4ir-microgrid.whcapitalleasing.comFirst seen 2022-10-27 21:18
Last seen 2024-07-04 19:33
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:33
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:19
Last seen 2024-07-04 19:32
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-07-04 19:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-04-29 21:29
Last seen 2024-07-04 19:32
Open for 431 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: wildacornapothecary.thebrandstand.co
Port: 80
URL: http://wildacornapothecary.thebrandstand.coFirst seen 2022-12-27 21:50
Last seen 2024-07-04 19:32
Open for 554 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:39
Last seen 2024-07-04 19:27
Open for 618 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f47e2769895a4bbf293d2050f1c1849f8Found 10 files trough .DS_Store spidering: /administration /cgi-bin /db /directory /homepage /images /malicious_files /scripts /sermons /staff
Found on 2024-07-04 19:27
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-23 21:17
Last seen 2024-07-04 19:23
Open for 741 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228648f768[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/chuagh74/chuaghNet_www.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-07-04 19:23288 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:18
Last seen 2024-07-04 19:19
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.wildacornapothecary.com
Port: 443
URL: https://www.wildacornapothecary.comFirst seen 2022-12-28 22:06
Last seen 2024-07-04 19:19
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-19 21:55
Last seen 2024-07-04 19:16
Open for 592 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 19:16
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:19
Last seen 2024-07-04 18:56
Open for 615 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-07-04 18:56
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.wildacornapothecary.com
Port: 80
URL: http://mail.wildacornapothecary.comFirst seen 2022-12-28 22:06
Last seen 2024-07-04 18:50
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 18:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-01 21:58
Last seen 2024-07-04 18:50
Open for 580 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-07-04 18:50
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.anderson4bellingham.taradactyldesign.com
Port: 443
URL: https://www.anderson4bellingham.taradactyldesign.comFirst seen 2022-12-28 22:03
Last seen 2024-07-04 18:28
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 18:28
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-23 21:17
Last seen 2024-07-04 18:07
Open for 741 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228648f768[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/chuagh74/chuaghNet_www.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-07-04 18:07288 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:31
Last seen 2024-07-04 17:12
Open for 618 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbebb9ada1f12a53427246f790703d93044Found 15 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /MusicGrooves/_notes /MusicGrooves/images /photos
Found on 2024-07-04 17:12 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a0173f50919af06df924b9fca5fbc1d62eFound 13 files trough .DS_Store spidering: /_notes /admin /articles /articles/_notes /cgi-bin /Connections /dialogs /dialogs/_notes /docs /docs/_notes /images /MusicGrooves /photos
Found on 2024-06-06 17:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733fdfa3e56815364c4c87dd9e86d7f277a0Found 10 files trough .DS_Store spidering: /_notes /admin /articles /cgi-bin /Connections /dialogs /docs /images /MusicGrooves /photos
Found on 2022-12-24 21:52
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.reliancemachinecompany.com
Port: 443
URL: https://mail.reliancemachinecompany.comFirst seen 2022-10-26 21:26
Last seen 2024-07-04 16:29
Open for 616 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf176425e7d578a373e3544373e3544373e3544Found 2 files trough .DS_Store spidering: /3567images /book_store
Found on 2024-07-04 16:29
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.anderson4bellingham.com
Port: 443
URL: https://mail.anderson4bellingham.comFirst seen 2022-12-28 22:03
Last seen 2024-07-04 15:28
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 15:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: alejandrobosqued.ammanetwork.org
Port: 443
URL: https://alejandrobosqued.ammanetwork.orgFirst seen 2022-11-19 21:55
Last seen 2024-07-04 14:06
Open for 592 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 14:06
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.252.95
Domain: www.estonishingevenings.com
Port: 443
URL: https://www.estonishingevenings.comFirst seen 2022-10-01 20:59
Last seen 2024-07-04 13:33
Open for 641 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522295112a7[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://maxlongint@bitbucket.org/maxlongint/estonishingevenings.git fetch = +refs/heads/*:refs/remotes/origin/* [user] email = maxlongint1010@gmail.com name = asdfghjkl [branch "master"] remote = origin merge = refs/heads/master
Found on 2024-07-04 13:33369 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.ehstrecords-info.ncethicalsociety.org
Port: 443
URL: https://www.ehstrecords-info.ncethicalsociety.orgFirst seen 2022-09-20 21:10
Last seen 2024-07-04 11:26
Open for 652 days-
Severity: medium
Fingerprint: 5f32cf5d6962f09ce9dbcc92e9dbcc927d8f57b3130c5bedaae863c751ee2ac0Found 60 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs /Programs/images /Programs/images/3-1-2012_files /Programs/images/3-12-UPDATE_files /Programs/images/_notes /Programs/images/Email Spotlight /Programs/images/Email Spotlight/images /Programs/images/Email Spotlight/images/_notes /Programs/images/pngs
Found on 2024-07-04 11:26 -
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-07-02 12:16 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b7076adfd412c5f1f4bf37316ed5ee5fe86Found 26 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-24 03:48 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c75d69a7675d69a765953edff2c6c4d39c887bd13e5e83880Found 51 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Programs
Found on 2024-06-18 20:34 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c778888b4778888b4a8257cbd7e2425277ae21ad91f16a0ccFound 40 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-06-04 11:07 -
Severity: low
Fingerprint: 5f32cf5d6962f09cc169dbbec169dbbe40e6b8c7978474117f70173b00964a73Found 15 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-05-29 09:49 -
Severity: medium
Fingerprint: 5f32cf5d6962f09c7d264b917d264b91a908b7e28ee39664f7a75922ec1251ebFound 52 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Mission Statement/April 24 2012 GnD Meeting /membersonly/GnD/Mission Statement/March 26 2012 GnD Meeting /membersonly/GnD/Mission Statement/Survey 1-22-2012 - Group Responses /membersonly/GnD/Mission Statement/Survey 10-30-2011 /membersonly/GnD/Mission Statement/Survey 2-26-2012 - Individual Responses /membersonly/GnD/Mission Statement/Writing Guidelines /membersonly/GnD/Programs /membersonly/GnD/Programs/Programs - Survey -5-22-2011 /membersonly/images /membersonly/images/_notes /membersonly/newsletters /membersonly/newsletters/2000 /membersonly/newsletters/2001 /membersonly/newsletters/2002 /membersonly/newsletters/2003 /membersonly/newsletters/2004 /membersonly/newsletters/2005 /membersonly/newsletters/2006 /membersonly/newsletters/2007 /membersonly/newsletters/2009 /membersonly/Setup /Platforms /Platforms/images /Programs
Found on 2024-04-29 00:09 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02a7ea88e30f7e6e5deff6df97440895bfFound 24 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2024-03-08 10:37
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: 128path-org.charleskeil.org
Port: 443
URL: https://128path-org.charleskeil.orgFirst seen 2022-10-24 21:30
Last seen 2024-07-04 11:03
Open for 618 days-
Severity: high
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea960a7ff022d03656c1610334557161befFound 23 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-07-04 11:03 -
Severity: high
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1b0ccce1a956d22441704fbadc6121baeFound 34 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails /wpThumbnails/_notes
Found on 2024-07-02 12:58 -
Severity: high
Fingerprint: 5f32cf5d6962f09cab28146bab28146b96d1aad8c6bbe54678a0e5d730e8b13bFound 21 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-28 09:01 -
Severity: high
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02eba9147bb01863e9388ff3f20077866bFound 24 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-26 04:57 -
Severity: high
Fingerprint: 5f32cf5d6962f09cdafa5447dafa5447b8ba7764d4a5799a3a4274638d191759Found 18 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-20 10:50 -
Severity: high
Fingerprint: 5f32cf5d6962f09c3838040e3838040e4c9b42574b72671de72bc24ec4990b94Found 20 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-05-23 16:51 -
Severity: high
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6f459ce2f5e6f2f7569a7a79685515aa4Found 28 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2023-11-06 06:00 -
Severity: high
Fingerprint: 5f32cf5d6962f09c81c345f781c345f7ab24891447cd054a317122d345b6b3a8Found 32 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /wpThumbnails
Found on 2023-09-16 12:15
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-01 21:58
Last seen 2024-07-04 10:48
Open for 580 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-07-04 10:48
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-23 22:40
Last seen 2024-07-04 08:45
Open for 496 days-
Severity: high
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea960a7ff022d03656c1610334557161befFound 23 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-07-04 08:45 -
Severity: high
Fingerprint: 5f32cf5d6962f09c0f8dcf020f8dcf02eba9147bb01863e9388ff3f20077866bFound 24 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-28 02:23 -
Severity: high
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b1b0ccce1a956d22441704fbadc6121baeFound 34 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails /wpThumbnails/_notes
Found on 2024-06-24 16:35 -
Severity: high
Fingerprint: 5f32cf5d6962f09c31c2f0b631c2f0b6f459ce2f5e6f2f7569a7a79685515aa4Found 28 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-06-10 02:36 -
Severity: high
Fingerprint: 5f32cf5d6962f09c2acf29aa2acf29aa46723af3ea5e3d81fbc2645a584b7739Found 33 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /indexpath/_notes /indexpath/wpThumbnails /logs /logs/_notes /pathtimes /pathtimes/.smileys /pathtimes/_notes /pathtimes/Music /pathtimes/wpThumbnails /pathtimesbackup /pathtimesbackup/_notes /pathtimesbackup/pings /pr /pr/_notes /pr/images /smallrollover /smallrollover/_notes /wpThumbnails
Found on 2024-05-24 12:27 -
Severity: high
Fingerprint: 5f32cf5d6962f09cdafa5447dafa5447b8ba7764d4a5799a3a4274638d191759Found 18 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-03-08 10:52 -
Severity: high
Fingerprint: 5f32cf5d6962f09cab28146bab28146b96d1aad8c6bbe54678a0e5d730e8b13bFound 21 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /bands/_notes /bands/berkshire /bands/buffalo /bands/zumix /cgi-bin /footerfeet /footerfeet/_notes /footerfeet/wpThumbnails /images /images/_notes /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2024-01-06 00:41 -
Severity: high
Fingerprint: 5f32cf5d6962f09c39aac35b39aac35bf1e3f9484360a2766c0dce07de46b09eFound 14 files trough .DS_Store spidering: /.smileys /.smileys/_notes /_notes /bands /cgi-bin /footerfeet /images /indexpath /logs /pathtimes /pathtimesbackup /pr /smallrollover /wpThumbnails
Found on 2023-02-23 22:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.anderson4bellingham.taradactyldesign.com
Port: 80
URL: http://www.anderson4bellingham.taradactyldesign.comFirst seen 2022-12-28 22:03
Last seen 2024-07-04 06:22
Open for 553 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-04 06:22
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.anderson4bellingham.com
Port: 80
URL: http://mail.anderson4bellingham.comFirst seen 2022-12-28 22:03
Last seen 2024-07-02 21:21
Open for 551 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-02 21:21
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.wildacornapothecary.com
Port: 80
URL: http://www.wildacornapothecary.comFirst seen 2022-12-28 22:06
Last seen 2024-07-02 21:02
Open for 551 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-02 21:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.wildacornapothecary.thebrandstand.co
Port: 80
URL: http://www.wildacornapothecary.thebrandstand.coFirst seen 2022-12-27 21:50
Last seen 2024-07-02 15:44
Open for 552 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2024-07-02 15:44
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: newcenturyleadership-net.musicbeginnersguide.com
Port: 443
URL: https://newcenturyleadership-net.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2024-03-21 14:01
Open for 547 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-03-21 14:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.newcenturyleadership-org.musicbeginnersguide.com
Port: 443
URL: https://www.newcenturyleadership-org.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2024-03-21 12:49
Open for 547 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-03-21 12:49
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: newcenturyleadership-org.musicbeginnersguide.com
Port: 443
URL: https://newcenturyleadership-org.musicbeginnersguide.comFirst seen 2022-09-20 21:40
Last seen 2024-03-21 12:28
Open for 547 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-03-21 12:28
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.newcenturyleadership-net.musicbeginnersguide.com
Port: 443
URL: https://www.newcenturyleadership-net.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2024-03-21 11:40
Open for 547 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-03-21 11:40
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.newcenturyleadership.musicbeginnersguide.com
Port: 443
URL: https://www.newcenturyleadership.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2024-03-08 11:11
Open for 534 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-03-08 11:11
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: newcenturyleadership.musicbeginnersguide.com
Port: 443
URL: https://newcenturyleadership.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2024-03-07 20:10
Open for 533 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2024-03-07 20:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-23 21:36
Last seen 2024-02-02 23:01
Open for 344 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a045a029b6a65fa8e110fe86b8021c017bFound 13 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/inc/portfolio /wp-content/themes/frisco/framework/plugins
Found on 2024-02-02 23:01 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744dc9a550a5c06433885b282d7de59ea355Found 12 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2024-01-07 07:05 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfcdac9e8c2105d37f512bd1014708e30bfFound 4 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes
Found on 2023-04-26 07:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392abb746216fff0291dee25735d78338358dFound 7 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework
Found on 2023-02-23 21:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-23 22:04
Last seen 2024-02-02 22:52
Open for 344 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a045a029b6a65fa8e110fe86b8021c017bFound 13 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/inc/portfolio /wp-content/themes/frisco/framework/plugins
Found on 2024-02-02 22:52 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744dc9a550a5c06433885b282d7de59ea355Found 12 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2024-01-07 01:07 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392abb746216fff0291dee25735d78338358dFound 7 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework
Found on 2024-01-05 16:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772e264d2ec1bc11963a4a0259e235f0359Found 11 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2023-09-03 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-23 21:36
Last seen 2024-02-02 15:39
Open for 343 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a045a029b6a65fa8e110fe86b8021c017bFound 13 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/inc/portfolio /wp-content/themes/frisco/framework/plugins
Found on 2024-02-02 15:39 -
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772e264d2ec1bc11963a4a0259e235f0359Found 11 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2024-02-02 11:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744dc9a550a5c06433885b282d7de59ea355Found 12 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2024-01-05 19:27 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfcdac9e8c2105d37f512bd1014708e30bfFound 4 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes
Found on 2023-04-26 07:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c026392ab026392abb746216fff0291dee25735d78338358dFound 7 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework
Found on 2023-02-23 21:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-23 21:36
Last seen 2024-02-02 09:22
Open for 343 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a045a029b6a65fa8e110fe86b8021c017bFound 13 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/inc/portfolio /wp-content/themes/frisco/framework/plugins
Found on 2024-02-02 09:22 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744dc9a550a5c06433885b282d7de59ea355Found 12 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2024-01-07 09:49 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfcdac9e8c2105d37f512bd1014708e30bfFound 4 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes
Found on 2023-04-26 07:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0fe627c813a920508a8540924d8540924dFound 3 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/themes
Found on 2023-02-23 21:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2023-02-23 21:36
Last seen 2024-02-02 09:18
Open for 343 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cec7f8772ec7f8772e264d2ec1bc11963a4a0259e235f0359Found 11 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2024-02-02 09:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09cccdd54a0ccdd54a045a029b6a65fa8e110fe86b8021c017bFound 13 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/inc/portfolio /wp-content/themes/frisco/framework/plugins
Found on 2024-02-02 09:18 -
Severity: low
Fingerprint: 5f32cf5d6962f09c11d3744d11d3744dc9a550a5c06433885b282d7de59ea355Found 12 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes /wp-content/themes/frisco /wp-content/themes/frisco/admin /wp-content/themes/frisco/framework /wp-content/themes/frisco/framework/css /wp-content/themes/frisco/framework/css/font /wp-content/themes/frisco/framework/images /wp-content/themes/frisco/framework/inc /wp-content/themes/frisco/framework/plugins
Found on 2024-01-05 18:03 -
Severity: low
Fingerprint: 5f32cf5d6962f09c0215adfc0215adfcdac9e8c2105d37f512bd1014708e30bfFound 4 files trough .DS_Store spidering: /wp-content /wp-content/plugins /wp-content/plugins/contact-form-7 /wp-content/themes
Found on 2023-02-23 21:36
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: committeetoendslavery.com
Port: 443
URL: https://committeetoendslavery.comFirst seen 2022-10-07 21:02
Last seen 2024-01-12 21:32
Open for 462 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2024-01-12 21:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.committeetoendslavery.com
Port: 443
URL: https://mail.committeetoendslavery.comFirst seen 2022-10-07 21:02
Last seen 2024-01-12 21:32
Open for 462 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2024-01-12 21:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.committeetoendslavery.com
Port: 443
URL: https://www.committeetoendslavery.comFirst seen 2022-10-07 21:02
Last seen 2024-01-12 21:32
Open for 462 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2024-01-12 21:32
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.leeolsonforsenate.com
Port: 80
URL: http://mail.leeolsonforsenate.comFirst seen 2023-03-13 20:34
Last seen 2024-01-12 21:31
Open for 305 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2024-01-12 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.leeolsonforsenate.com
Port: 443
URL: https://mail.leeolsonforsenate.comFirst seen 2022-10-11 21:01
Last seen 2024-01-12 21:31
Open for 458 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2024-01-12 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-11 21:01
Last seen 2024-01-12 21:31
Open for 458 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2024-01-12 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.leeolsonforsenate.com
Port: 443
URL: https://www.leeolsonforsenate.comFirst seen 2022-10-11 21:01
Last seen 2024-01-12 21:31
Open for 458 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2024-01-12 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-11 21:01
Last seen 2024-01-12 21:31
Open for 458 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2024-01-12 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-11 21:01
Last seen 2024-01-12 21:31
Open for 458 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2024-01-12 21:31
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.newcenturyleadership-net.musicbeginnersguide.com
Port: 80
URL: http://www.newcenturyleadership-net.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2023-09-22 20:51
Open for 366 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-20 21:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: newcenturyleadership-net.musicbeginnersguide.com
Port: 80
URL: http://newcenturyleadership-net.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2023-09-22 20:51
Open for 366 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-20 21:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.valdrada.ammanetwork.org
Port: 80
URL: http://www.valdrada.ammanetwork.orgFirst seen 2022-12-24 21:47
Last seen 2023-06-26 20:35
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-24 21:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-24 21:47
Last seen 2023-06-26 20:35
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-24 21:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.valdrada.ammanetwork.org
Port: 443
URL: https://www.valdrada.ammanetwork.orgFirst seen 2022-12-24 21:47
Last seen 2023-06-26 20:35
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-24 21:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-24 21:47
Last seen 2023-06-26 20:35
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-24 21:47
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:18
Last seen 2023-04-29 21:40
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-27 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:18
Last seen 2023-04-29 21:40
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-27 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:18
Last seen 2023-04-29 21:40
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-27 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: 4ir-microgrid.whcapitalleasing.com
Port: 80
URL: http://4ir-microgrid.whcapitalleasing.comFirst seen 2022-10-27 21:18
Last seen 2023-04-29 21:40
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-27 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.4ir-microgrid.whcapitalleasing.com
Port: 80
URL: http://www.4ir-microgrid.whcapitalleasing.comFirst seen 2022-10-27 21:18
Last seen 2023-04-29 21:40
Open for 184 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-27 21:18
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.tube.dianaeftaiha.com
Port: 443
URL: https://www.tube.dianaeftaiha.comFirst seen 2022-10-02 21:00
Last seen 2023-04-03 20:32
Open for 182 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d6f4b64cd6f4b64cd6f4b64cd6f4b64cdFound 1 files trough .DS_Store spidering: /core
Found on 2022-10-02 21:00
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-02 21:01
Last seen 2023-04-03 20:32
Open for 182 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d6f4b64cd6f4b64cd6f4b64cd6f4b64cdFound 1 files trough .DS_Store spidering: /core
Found on 2022-10-02 21:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: rapecrisiscounseling-org.expatbackup.com
Port: 443
URL: https://rapecrisiscounseling-org.expatbackup.comFirst seen 2022-09-20 21:03
Last seen 2023-03-23 20:40
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-20 21:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.rapecrisiscounseling.org
Port: 443
URL: https://mail.rapecrisiscounseling.orgFirst seen 2022-11-20 21:59
Last seen 2023-03-23 20:40
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-20 21:59
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.rapecrisiscounseling-org.expatbackup.com
Port: 443
URL: https://www.rapecrisiscounseling-org.expatbackup.comFirst seen 2022-09-20 21:03
Last seen 2023-03-23 20:40
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-20 21:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: rapecrisiscounseling-org.expatbackup.com
Port: 80
URL: http://rapecrisiscounseling-org.expatbackup.comFirst seen 2022-09-20 21:03
Last seen 2023-03-23 20:40
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-20 21:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.rapecrisiscounseling.org
Port: 80
URL: http://mail.rapecrisiscounseling.orgFirst seen 2022-09-20 21:03
Last seen 2023-03-23 20:40
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-20 21:03
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.rapecrisiscounseling-org.expatbackup.com
Port: 80
URL: http://www.rapecrisiscounseling-org.expatbackup.comFirst seen 2022-09-20 21:04
Last seen 2023-03-23 20:40
Open for 183 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-09-20 21:04
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.radiantheartmedia.expatbackup.com
Port: 80
URL: http://www.radiantheartmedia.expatbackup.comFirst seen 2022-10-24 21:38
Last seen 2023-03-21 20:39
Open for 147 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: radiantheartmedia.expatbackup.com
Port: 80
URL: http://radiantheartmedia.expatbackup.comFirst seen 2022-10-24 21:38
Last seen 2023-03-21 20:39
Open for 147 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: radiantheartmedia.expatbackup.com
Port: 443
URL: https://radiantheartmedia.expatbackup.comFirst seen 2022-10-24 21:38
Last seen 2023-03-21 20:39
Open for 147 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.radiantheartmedia.expatbackup.com
Port: 443
URL: https://www.radiantheartmedia.expatbackup.comFirst seen 2023-01-19 21:38
Last seen 2023-03-21 20:39
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2023-01-19 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-19 21:55
Last seen 2023-03-21 20:32
Open for 121 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-19 21:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: alejandrobosqued.ammanetwork.org
Port: 80
URL: http://alejandrobosqued.ammanetwork.orgFirst seen 2022-11-19 21:55
Last seen 2023-03-21 20:32
Open for 121 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-19 21:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-11-19 21:55
Last seen 2023-03-21 20:32
Open for 121 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-19 21:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.alejandrobosqued.ammanetwork.org
Port: 80
URL: http://www.alejandrobosqued.ammanetwork.orgFirst seen 2022-11-19 21:55
Last seen 2023-03-21 20:32
Open for 121 days-
Severity: low
Fingerprint: 5f32cf5d6962f09cae99eea9ae99eea96367f45a086ed07d01b7f20fc0dbb463Found 23 files trough .DS_Store spidering: /index.php /jetpack-onboarding /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-11-19 21:55
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: ehstrecords-info.ncethicalsociety.org
Port: 80
URL: http://ehstrecords-info.ncethicalsociety.orgFirst seen 2022-09-20 21:09
Last seen 2023-01-20 22:11
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2023-01-20 22:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b7076adfd412c5f1f4bf37316ed5ee5fe86Found 26 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2022-11-20 22:02 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b135b19f02aed0b9c488fb7802428a0d10Found 34 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Programs /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2022-09-20 21:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.ehstrecords-info.ncethicalsociety.org
Port: 80
URL: http://www.ehstrecords-info.ncethicalsociety.orgFirst seen 2022-09-20 21:09
Last seen 2023-01-20 22:11
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2023-01-20 22:11 -
Severity: low
Fingerprint: 5f32cf5d6962f09c81c345f781c345f7f2a0a0d07372ebba640af350bf4a1029Found 32 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Programs /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2022-11-20 22:02 -
Severity: medium
Fingerprint: 5f32cf5d6962f09ca629b8b1a629b8b135b19f02aed0b9c488fb7802428a0d10Found 34 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/GnD/GnD Committee Goals & Objectives /membersonly/GnD/GnD Meetings - Minutes /membersonly/GnD/GnD Meetings - Minutes/2011 /membersonly/GnD/GnD Meetings - Minutes/2012 /membersonly/GnD/Leader Evaluation /membersonly/GnD/Membership /membersonly/GnD/Mission Statement /membersonly/GnD/Programs /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2022-09-20 21:09
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: newcenturyleadership.musicbeginnersguide.com
Port: 80
URL: http://newcenturyleadership.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2023-01-20 21:59
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-20 21:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.newcenturyleadership.musicbeginnersguide.com
Port: 80
URL: http://www.newcenturyleadership.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2023-01-20 21:59
Open for 122 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-20 21:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.records.ncethicalsociety.org
Port: 80
URL: http://www.records.ncethicalsociety.orgFirst seen 2022-11-15 21:58
Last seen 2023-01-15 21:46
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2023-01-15 21:46 -
Severity: low
Fingerprint: 5f32cf5d6962f09c87f05b7087f05b7076adfd412c5f1f4bf37316ed5ee5fe86Found 26 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/Board/2013/Members Meeting 1-20 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2022-11-15 21:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: records.ncethicalsociety.org
Port: 80
URL: http://records.ncethicalsociety.orgFirst seen 2022-11-15 21:58
Last seen 2023-01-15 21:46
Open for 60 days-
Severity: low
Fingerprint: 5f32cf5d6962f09ca0cc0fcfa0cc0fcf4e3e2d0893aeaae2e09c6fe8a6ef519eFound 25 files trough .DS_Store spidering: /images /images/_notes /membersonly /membersonly/Archive /membersonly/Archive/2004 Canvass /membersonly/Archive/Holmgren Files /membersonly/Archive/Holmgren Files/EHST logos /membersonly/Archive/Incorporation Documents /membersonly/Board /membersonly/Board/2004 /membersonly/Board/2005 /membersonly/Board/2006 /membersonly/Board/2008 /membersonly/Board/2008/Minutes2008 /membersonly/Board/2009 /membersonly/Board/2010 /membersonly/Board/2011 /membersonly/Board/2012 /membersonly/Board/2013 /membersonly/GnD /membersonly/images /membersonly/newsletters /membersonly/Setup /Platforms /Programs
Found on 2022-11-15 21:58
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:39
Last seen 2023-01-01 22:07
Open for 69 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f47e2769895a4bbf293d2050f1c1849f8Found 10 files trough .DS_Store spidering: /administration /cgi-bin /db /directory /homepage /images /malicious_files /scripts /sermons /staff
Found on 2022-10-24 21:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-28 22:10-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-28 22:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: 4irmicrogrid.whcapitalleasing.com
Port: 80
URL: http://4irmicrogrid.whcapitalleasing.comFirst seen 2022-12-28 22:10-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-28 22:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-28 22:10-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-28 22:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.4irmicrogrid.whcapitalleasing.com
Port: 80
URL: http://www.4irmicrogrid.whcapitalleasing.comFirst seen 2022-12-28 22:10-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-28 22:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-12-28 22:10-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-12-28 22:10
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: reliancemachinecompany.com
Port: 80
URL: http://reliancemachinecompany.comFirst seen 2022-10-26 21:26
Last seen 2022-12-28 21:57
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf176425e7d578a373e3544373e3544373e3544Found 2 files trough .DS_Store spidering: /3567images /book_store
Found on 2022-10-26 21:26
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.reliancemachinecompany.com
Port: 80
URL: http://mail.reliancemachinecompany.comFirst seen 2022-10-26 21:26
Last seen 2022-12-28 21:57
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf176425e7d578a373e3544373e3544373e3544Found 2 files trough .DS_Store spidering: /3567images /book_store
Found on 2022-10-26 21:26
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.reliancemachinecompany.com
Port: 80
URL: http://www.reliancemachinecompany.comFirst seen 2022-10-26 21:26
Last seen 2022-12-28 21:57
Open for 63 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c7cf176427cf176425e7d578a373e3544373e3544373e3544Found 2 files trough .DS_Store spidering: /3567images /book_store
Found on 2022-10-26 21:26
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-23 21:17
Last seen 2022-12-24 21:52
Open for 184 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228648f768[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/chuagh74/chuaghNet_www.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-06-23 21:17288 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-23 21:17
Last seen 2022-12-24 21:52
Open for 184 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228648f768[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/chuagh74/chuaghNet_www.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-06-23 21:17288 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-06-23 21:16
Last seen 2022-12-24 21:52
Open for 184 days-
Severity: medium
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a65228648f768[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://github.com/chuagh74/chuaghNet_www.git fetch = +refs/heads/*:refs/remotes/origin/* [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-06-23 21:16288 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.252.95
Domain: www.estonishingevenings.com
Port: 80
URL: http://www.estonishingevenings.comFirst seen 2022-10-01 20:59
Last seen 2022-12-01 21:56
Open for 61 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522295112a7[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://maxlongint@bitbucket.org/maxlongint/estonishingevenings.git fetch = +refs/heads/*:refs/remotes/origin/* [user] email = maxlongint1010@gmail.com name = asdfghjkl [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-10-01 20:59369 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.First seen 2022-10-01 20:59
Last seen 2022-12-01 21:56
Open for 61 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522295112a7[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://maxlongint@bitbucket.org/maxlongint/estonishingevenings.git fetch = +refs/heads/*:refs/remotes/origin/* [user] email = maxlongint1010@gmail.com name = asdfghjkl [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-10-01 20:59369 Bytes
-
-
Git configuration and history exposed
The following URL (usually
/.git/config) is publicly accessible and is leaking source code and repository configuration.IP: 162.241.252.95
Domain: mail.estonishingevenings.com
Port: 80
URL: http://mail.estonishingevenings.comFirst seen 2022-10-01 20:59
Last seen 2022-12-01 21:56
Open for 61 days-
Severity: high
Fingerprint: 2580fa947178c88602b1737db148c044b81b03713d63bb82370a6522295112a7[core] repositoryformatversion = 0 filemode = true bare = false logallrefupdates = true symlinks = false [remote "origin"] url = https://maxlongint@bitbucket.org/maxlongint/estonishingevenings.git fetch = +refs/heads/*:refs/remotes/origin/* [user] email = maxlongint1010@gmail.com name = asdfghjkl [branch "master"] remote = origin merge = refs/heads/master
Found on 2022-10-01 20:59369 Bytes
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: newcenturyleadership-org.musicbeginnersguide.com
Port: 80
URL: http://newcenturyleadership-org.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2022-11-20 22:00
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-20 21:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.newcenturyleadership-org.musicbeginnersguide.com
Port: 80
URL: http://www.newcenturyleadership-org.musicbeginnersguide.comFirst seen 2022-09-20 21:41
Last seen 2022-11-20 22:00
Open for 61 days-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-09-20 21:41
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:19-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-27 21:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:19-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-27 21:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-27 21:19-
Severity: low
Fingerprint: 5f32cf5d6962f09c63442d9d63442d9d28a25ad628a25ad628a25ad628a25ad6Found 1 files trough .DS_Store spidering: /.git
Found on 2022-10-27 21:19
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f47e2769895a4bbf293d2050f1c1849f8Found 10 files trough .DS_Store spidering: /administration /cgi-bin /db /directory /homepage /images /malicious_files /scripts /sermons /staff
Found on 2022-10-24 21:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:39-
Severity: low
Fingerprint: 5f32cf5d6962f09c8329733f8329733f47e2769895a4bbf293d2050f1c1849f8Found 10 files trough .DS_Store spidering: /administration /cgi-bin /db /directory /homepage /images /malicious_files /scripts /sermons /staff
Found on 2022-10-24 21:39
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-24 21:38-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.radiantheartmedia.com
Port: 80
URL: http://mail.radiantheartmedia.comFirst seen 2022-10-24 21:38-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.radiantheartmedia.com
Port: 443
URL: https://mail.radiantheartmedia.comFirst seen 2022-10-24 21:38-
Severity: low
Fingerprint: 5f32cf5d6962f09c9e04c3bc9e04c3bcd4b2e02b0b9199b13a9ccd230330a715Found 22 files trough .DS_Store spidering: /index.php /license.txt /loader.php /mojo-package.sh /readme.html /wp-activate.php /wp-admin /wp-blog-header.php /wp-comments-post.php /wp-config-sample.php /wp-config.php /wp-content /wp-cron.php /wp-includes /wp-links-opml.php /wp-load.php /wp-login.php /wp-mail.php /wp-settings.php /wp-signup.php /wp-trackback.php /xmlrpc.php
Found on 2022-10-24 21:38
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.leeolsonforsenate.bestexpertpicks.com
Port: 80
URL: http://www.leeolsonforsenate.bestexpertpicks.comFirst seen 2022-10-11 21:01-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2022-10-11 21:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.leeolsonforsenate.bestexpertpicks.com
Port: 443
URL: https://www.leeolsonforsenate.bestexpertpicks.comFirst seen 2022-10-11 21:01-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2022-10-11 21:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: leeolsonforsenate.bestexpertpicks.com
Port: 80
URL: http://leeolsonforsenate.bestexpertpicks.comFirst seen 2022-10-11 21:01-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2022-10-11 21:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: leeolsonforsenate.bestexpertpicks.com
Port: 443
URL: https://leeolsonforsenate.bestexpertpicks.comFirst seen 2022-10-11 21:01-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d80252b138cb9de5ddc554e5ddc554Found 3 files trough .DS_Store spidering: /.well-known /UserFiles /UserFiles/image
Found on 2022-10-11 21:01
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.committeetoendslavery.bestexpertpicks.com
Port: 80
URL: http://www.committeetoendslavery.bestexpertpicks.comFirst seen 2022-10-07 21:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2022-10-07 21:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.committeetoendslavery.bestexpertpicks.com
Port: 443
URL: https://www.committeetoendslavery.bestexpertpicks.comFirst seen 2022-10-07 21:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2022-10-07 21:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
First seen 2022-10-07 21:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2022-10-07 21:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: www.committeetoendslavery.com
Port: 80
URL: http://www.committeetoendslavery.comFirst seen 2022-10-07 21:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2022-10-07 21:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: mail.committeetoendslavery.com
Port: 80
URL: http://mail.committeetoendslavery.comFirst seen 2022-10-07 21:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2022-10-07 21:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: committeetoendslavery.bestexpertpicks.com
Port: 443
URL: https://committeetoendslavery.bestexpertpicks.comFirst seen 2022-10-07 21:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2022-10-07 21:02
-
-
MacOS file listing through .DS_Store file
.DS_Store” is an abbreviation for “Desktop Services Store”. These files are created automatically by Apples “Finder” software (which is part of their OS).
They store information about the files within a folder, including display options of folders, such as icon positions and view settings.
It may happen that .DS_Store files inadvertently leak filenames such as database backups or private administration panels.
IP: 162.241.252.95
Domain: committeetoendslavery.bestexpertpicks.com
Port: 80
URL: http://committeetoendslavery.bestexpertpicks.comFirst seen 2022-10-07 21:02-
Severity: low
Fingerprint: 5f32cf5d6962f09c1a5d9b0f1a5d9b0f47d802524ed56bd225a3411d25a3411dFound 3 files trough .DS_Store spidering: /.well-known /css /UserFiles
Found on 2022-10-07 21:02
-
-
Open service 162.241.252.95:443 · andrewformountvernon.taradactyldesign.com
2024-07-06 13:20
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:20:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://andrewformountvernon.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:20:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 29 seconds ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · taleofmylife.com
2024-07-06 13:19
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:19:11 GMT Server: Apache Link: <https://taleofmylife.com/wp-json/>; rel="https://api.w.org/", <https://taleofmylife.com/wp-json/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://taleofmylife.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.artofrv.com
2024-07-06 13:15
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:15:31 GMT Server: Apache Vary: accept,content-type X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://artofrv.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:15:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.theveggieguys.net
2024-07-06 13:15
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:15:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://theveggieguys.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.leavingisliving.com
2024-07-06 13:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:14:53 GMT Server: Apache Link: <https://www.leavingisliving.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.leavingisliving.com/index.php?rest_route=/wp/v2/pages/4499>; rel="alternate"; type="application/json", <https://www.leavingisliving.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:19:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 6 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.leavingisliving.com
2024-07-06 13:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:14:48 GMT Server: Apache Link: <https://www.leavingisliving.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://www.leavingisliving.com/index.php?rest_route=/wp/v2/pages/4499>; rel="alternate"; type="application/json", <https://www.leavingisliving.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:19:48 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 6 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tracerntnwidelog.com
2024-07-06 13:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:14:42 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tracerntnwidelog.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tracerntnwidelog.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tracerntnwidelog.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.rsmrf.asndi.org
2024-07-06 13:14
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:14:36 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://rsmrf.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 7 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ammaarquitectura.com
2024-07-06 13:14
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:14:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ammaarquitectura.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:14:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 7 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.sim-tel.com.au
2024-07-06 13:14
HTTP/1.1 503 Service Unavailable Date: Sat, 06 Jul 2024 13:14:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Retry-After: 608400 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Connection: close Transfer-Encoding: chunked Page title: Welcome to Sim-Tel! <!DOCTYPE html> <html lang="en-US" > <head> <meta charset="UTF-8"> <title>Welcome to Sim-Tel!</title> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <meta name="author" content="SIM-TEL Roxby Downs" /> <meta name="description" content="SIM-TEL Roxby Downs - Roxby's First Internet Provider" /> <meta name="keywords" content="Maintenance Mode" /> <meta name="robots" content="index, follow" /> <link rel="stylesheet" id="frontend-css" href="https://www.sim-tel.com.au/wp-content/plugins/wp-maintenance-mode/assets/css/style.min.css?ver=2.6.8" media="all"> <style type="text/css"> .bot-avatar { background-image: url("https://www.sim-tel.com.au/wp-content/plugins/wp-maintenance-mode/assets/images/chatbot.png"); } .wrap h1 { color: #ffffff; } .wrap h2 { color: #ffffff; } .background { background: url("https://www.sim-tel.com.au/wp-content/uploads/2019/02/IMG_20181107_194006041_HDR-3-1.jpg") no-repeat center top fixed; background-size: cover; } .wrap .countdown span { color: #ffffff; } </style> </head> <body class="background"> <div class="wrap" role="main"> <!-- Heading --> <h1>Welcome to Sim-Tel!</h1> <!-- Text --> <h2><p><strong>Our website is currently undergoing scheduled maintenance.</strong><br /><strong>Please contact Casey on 0490 809 407 or <a href="mailto:sales@sim-tel.com.au">sales@sim-tel.com.au</a></strong><br /><strong>Thank you for your understanding.</strong></p></h2> <!-- Countdown --> <div class="countdown" data-start="September 22, 2019 00:00:00" data-end="September 29, 2019 01:00:00"></div> <!-- Social networks --> <div class="social" data-target="1"> <a class="fb" href="https://www.facebook.com/simtelroxbydowns">facebook</a> </div> <!-- Contact --> <div class="contact"> <div class="form move_top"> <span class="close-contact_form"> <img src="https://www.sim-tel.com.au/wp-content/plugins/wp-maintenance-mode/assets/images/close.svg" alt=""> </span> <form class="contact_form"> <p class="col"> <input type="text" placeholder="Name" data-rule-required="true" data-msg-required="This field is required." name="name" class="name_input" /> </p> <p class="col last"> <input type="text" placeholder="E-mail" data-rule-required="true" data-rule-email="true" data-msg-required="This field is required." data-msg-email="Please enter a valid email address." name="email" class="email_input" /> </p> <input type="hidden" id="_wpnonce" name="_wpnonce" value="6684bb8241" /><input type="hidden" name="_wp_http_referer" value="/" /> <br clear="all" /> <p> <textarea placeholder="Your message" data-rule-required="true" data-msg-required="This field is required." name="content" class="content_textarea"></textarea> </p> <p class="submit"><input type="submit" value="Send" /></p> </form> </div> </div> <a class="contact_us" href="javascript:void(0);" data-open="move_top" data-close="move_bottom">Contact us</a> </div> <script type='text/javascript'> const wpmmVars = {"ajaxURL": "https://www.sim-tel.com.au/wp-admin/admin-ajax.php"}; </script> <script type="text/javascript" src="https://www.sim-tel.com.au/wp-includes/js/jquery/jquery.min.js" id="jquery-js"></script> <script type="text/javascript" src="https://www.sim-tel.com.au/wp-content/plugins/wp-maintenance-mode/assets/js/jquery.fitvids.min.js" id="fitvids-js"></script> <script type="text/javascript" src="https://www.sim-tel.com.au/wp-content/plugins/wp-maintenance-mode/assets/js/scripts.min.js?ver=2.6.8" id="frontend-js"></script> <script type="text/javascript" src="https://www.sim-tel.com.au/wp-content/plugins/wp-maintenance-mode/assets/js/jquery.plugin.min.js" id="countdown-dependency-js"></script> <script type="text/javascript" src="https://www.sim-tel.com.au/wp-content/plugins/wp-maintenance-mode/aFound 7 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · biovanish.revsz.com
2024-07-06 13:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:14:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://biovanish.revsz.com/wp-json/>; rel="https://api.w.org/", <https://biovanish.revsz.com/wp-json/wp/v2/pages/8>; rel="alternate"; type="application/json", <https://biovanish.revsz.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:14:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 7 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.embracingthesunlight.evangelineamel.com
2024-07-06 13:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:13:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://embracingthesunlight.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 7 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jointpainhack.revsz.com
2024-07-06 13:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:13:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jointpainhack.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tetradevelopment.com
2024-07-06 13:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:13:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tetradevelopment.com/wp-json/>; rel="https://api.w.org/", <https://tetradevelopment.com/wp-json/wp/v2/pages/8>; rel="alternate"; type="application/json", <https://tetradevelopment.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:13:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · serolean.trefort.net
2024-07-06 13:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:13:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://serolean.trefort.net/wp-json/>; rel="https://api.w.org/", <https://serolean.trefort.net/wp-json/wp/v2/pages/33>; rel="alternate"; type="application/json", <https://serolean.trefort.net/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:13:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.mysilverlinings.me
2024-07-06 13:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:13:18 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: nfdbrandname=bluehost; expires=Tue, 04 Jul 2034 13:13:19 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://mysilverlinings.me/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · test.healthmediapolicy.com
2024-07-06 13:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:13:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://test.healthmediapolicy.com/wp-json/>; rel="https://api.w.org/", <https://test.healthmediapolicy.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:13:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.enlitedesign.com
2024-07-06 13:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:13:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://enlitedesign.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:13:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · website-f9437d31.karthikpatil.com
2024-07-06 13:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:13:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:13:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.stallfreepropellers.com
2024-07-06 13:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:13:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stallfreepropellers.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:13:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · adventuristmoto.com
2024-07-06 13:13
HTTP/1.1 404 Not Found Date: Sat, 06 Jul 2024 13:13:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://adventuristmoto.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.digitalnomadsasia.net
2024-07-06 13:12
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:13:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://digitalnomadsasia.net/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:13:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Tue, 04 Jul 2034 13:13:03 GMT; Max-Age=315360000; path=/
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.appetitesathome.com
2024-07-06 13:12
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:12:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type Expires: Sat, 06 Jul 2024 14:12:57 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://appetitesathome.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 8 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · wildacornapothecary.thebrandstand.co
2024-07-06 13:12
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:12:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.wildacornapothecary.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:17:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.wildacornapothecary.com%2F; expires=Sat, 03-Aug-2024 13:12:18 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 9 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.art-beats.com
2024-07-06 13:11
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:12:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://art-beats.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:12:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 9 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · christiansthatparty.com
2024-07-06 13:11
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:11:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:16:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Christians that party — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Christians that party — Coming Soon</title> <script src="https://christiansthatparty.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://christiansthatparty.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> <div id="subscribe-text"> <p>Be the first to know when we launch, enter your email address and we will let you know when we go live and any future website updates we have.</p> </div> <div id="success" class="status-message"> Thank you, please check your email to confirm your subscription. </div> <div id="error-active" class="status-message"> Your email address is already subscribed to this website. Stay tuned to your inbox for our updates or try a different email address. </div> <div id="error-invalid" class="status-message"> There was an error with your submission and you were not subscribed. Please try again with a valid email address. </div> <form action="" method="post" accept-charset="utf-8" id="subscribe"> <input type="hidden" name="action" value="newfold_coming_soon_subscribe"> <input type="hidden" id="newfold-nonce-coming-soon-subscribe" name="newfold-nonce-coming-soon-subscribe" value="eb86901f9a" /><input type="hidden" name="_wp_http_referer" value="/" /> <span class="inputs email" id="subscribe-email"> <label id="subscribe-label" for="subscribe-field"> Email </label> <input type="email" name="email" required="required" value="" id="subscribe-field" placeholder="Enter your email address" > </span> <span class="inputs submit" id="subscribe-submit"> <input class="btn" type="submit" value="Subscribe" name="subscriptions_widget"> </span> </form> <script> var ajaxscript = { ajax_url: 'https://christiansthatparty.com/wp-admin/admin-ajax.php' }; jQuery(document).ready(function ($) { $('#subsFound 9 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · abbybell-org.bellcreativeco.com
2024-07-06 13:11
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:11:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://abbybell.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:11:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 10 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · switchcraftelectric.com
2024-07-06 13:11
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:11:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Pingback: https://switchcraftelectric.com/xmlrpc.php Link: <https://switchcraftelectric.com/wp-json/>; rel="https://api.w.org/", <https://switchcraftelectric.com/wp-json/wp/v2/pages/2>; rel="alternate"; type="application/json", <https://switchcraftelectric.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:11:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 10 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.transformativesolutionsnetwork-org.tsnpa.info
2024-07-06 13:11
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:11:13 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://transformativesolutionsnetwork.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:16:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 10 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · airphones.revsz.com
2024-07-06 13:10
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:10:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://airphones.revsz.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://airphones.revsz.com/index.php?rest_route=/wp/v2/pages/8>; rel="alternate"; type="application/json", <https://airphones.revsz.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Airphones are small & light weight wireless headphone experience with high-quality stereo sound and a long capacity charging case. <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>Airphones are small & light weight wireless headphone experience with high-quality stereo sound and a long capacity charging case.</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://airphones.revsz.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://airphones.revsz.com/wp-content/themes/the_deadbeat_theme/js/html5.js" type="text/javascript"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="AirPhones » Feed" href="https://airphones.revsz.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="AirPhones » Comments Feed" href="https://airphones.revsz.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/airphones.revsz.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.suppFound 10 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.keragenis.revsz.com
2024-07-06 13:10
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:10:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://keragenis.revsz.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:10:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 11 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · alimeliah.alisonmeliahphotography.com
2024-07-06 13:10
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:10:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Location: https://www.alimeliah.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 11 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · protectingpollinators.org
2024-07-06 13:09
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:09:42 GMT Server: Apache X-Pingback: https://protectingpollinators.org/xmlrpc.php Link: <https://protectingpollinators.org/index.php/wp-json/>; rel="https://api.w.org/", <https://protectingpollinators.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 11 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · 4irmicrogrid.whcapitalleasing.com
2024-07-06 13:09
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:09:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://www.4irmicrogrid.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:09:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 11 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.stevenkleindds.madsenadvertising.com
2024-07-06 13:09
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:09:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://stevenkleindds.madsenadvertising.com/xmlrpc.php X-Redirect-By: WordPress Location: https://stevenkleindds.madsenadvertising.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:09:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 12 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · jointgenesis.revsz.com
2024-07-06 13:08
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:08:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:08:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: jointgenesis — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>jointgenesis — Coming Soon</title> <script src="http://jointgenesis.revsz.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://jointgenesis.revsz.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jointgenesis.revsz.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 12 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ringhush.revsz.com
2024-07-06 13:07
Found 14 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · foc.ehs.mybluehost.me
2024-07-06 13:06
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:06:48 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.bingiinventions.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 14 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · justsmokinbarbecue.com
2024-07-06 13:06
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:06:46 GMT Server: Apache Link: <https://justsmokinbarbecue.com/wp-json/>; rel="https://api.w.org/", <https://justsmokinbarbecue.com/wp-json/wp/v2/pages/35>; rel="alternate"; type="application/json", <https://justsmokinbarbecue.com/>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://justsmokinbarbecue.com/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://justsmokinbarbecue.com Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:06:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 14 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tangithomas.com
2024-07-06 13:06
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:06:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tangithomas.com/wp-json/>; rel="https://api.w.org/", <https://tangithomas.com/wp-json/wp/v2/pages/11>; rel="alternate"; type="application/json", <https://tangithomas.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:06:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 14 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.legendinx.com
2024-07-06 13:04
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:04:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://legendinx.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:04:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Flegendinx.com%2F; expires=Sat, 03 Aug 2024 13:04:40 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 17 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · jmghomeservices.soulsojourner.com
2024-07-06 13:04
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:04:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jmghomeservices.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:04:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 17 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.tracerntnwidelog.com
2024-07-06 13:04
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 13:04:06 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://tracerntnwidelog.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tracerntnwidelog.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tracerntnwidelog.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 17 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.website-64e0a88e.oneflymama.com
2024-07-06 13:04
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:04:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Content-Security-Policy: script-src 'self' 'unsafe-inline' 'unsafe-eval' https: data: X-Redirect-By: WordPress Location: https://thepartycatalog.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:04:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=0d4a801c68679c185995827f5b3f01fe; path=/
Found 17 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.stevensweldingnd.com
2024-07-06 13:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:02:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stevensweldingnd.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 15:02:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 18 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.randytysonphotography.com
2024-07-06 13:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:01:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://randytysonphotography.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:06:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 19 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.meisinhardware.chuagh.net
2024-07-06 13:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:01:51 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://meisinhardware.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:06:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 19 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.alttransit.com
2024-07-06 13:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 13:01:06 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://alttransit.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 20 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · longislandchickencoops.com
2024-07-06 12:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:58:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://mothercluckincoops.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:58:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 22 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.therealestatesharks.com
2024-07-06 12:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:59:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Link: <https://therealestatesharks.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=c16b8aa9111d036f0fde0cc7276fa796; path=/ Transfer-Encoding: chunked
Found 22 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.knightwaylimited.com
2024-07-06 12:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:58:44 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://knightwaylimited.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://knightwaylimited.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://knightwaylimited.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 22 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.pacificrimdoods.com
2024-07-06 12:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:58:38 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:58:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Pacific Rim Doods Practice — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Pacific Rim Doods Practice — Coming Soon</title> <script src="https://pacificrimdoods.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://pacificrimdoods.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://pacificrimdoods.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 23 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.rochlinlc.com
2024-07-06 12:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:58:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rochlinlc.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:03:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 23 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.collectivesafety.com
2024-07-06 12:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:58:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://collectivesafety.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:03:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 23 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.greenwayoffice.com
2024-07-06 12:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:58:26 GMT Server: Apache Link: <https://www.greenwayoffice.com/wp-json/>; rel="https://api.w.org/", <https://www.greenwayoffice.com/wp-json/wp/v2/pages/143>; rel="alternate"; type="application/json", <https://www.greenwayoffice.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 23 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.marmabotanica.com
2024-07-06 12:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:58:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marmabotanica.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:58:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 23 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.pianoclinic.com
2024-07-06 12:56
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:56:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pianoclinic.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:56:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 24 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.soyemi.com
2024-07-06 12:55
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:55:56 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://soyemi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 25 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.summaries.wiki
2024-07-06 12:55
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:55:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://summaries.wiki/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:55:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 25 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · rnx.qiv.mybluehost.me
2024-07-06 12:55
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:55:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:55:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 12:55:38 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked Page title: empleo — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>empleo — Coming Soon</title> <script src="https://empleo.credicefi.com.do/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://empleo.credicefi.com.do/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://empleo.credicefi.com.do/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 26 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.christiansthatparty.com
2024-07-06 12:55
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:55:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:00:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Christians that party — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Christians that party — Coming Soon</title> <script src="https://christiansthatparty.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://christiansthatparty.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> <div id="subscribe-text"> <p>Be the first to know when we launch, enter your email address and we will let you know when we go live and any future website updates we have.</p> </div> <div id="success" class="status-message"> Thank you, please check your email to confirm your subscription. </div> <div id="error-active" class="status-message"> Your email address is already subscribed to this website. Stay tuned to your inbox for our updates or try a different email address. </div> <div id="error-invalid" class="status-message"> There was an error with your submission and you were not subscribed. Please try again with a valid email address. </div> <form action="" method="post" accept-charset="utf-8" id="subscribe"> <input type="hidden" name="action" value="newfold_coming_soon_subscribe"> <input type="hidden" id="newfold-nonce-coming-soon-subscribe" name="newfold-nonce-coming-soon-subscribe" value="eb86901f9a" /><input type="hidden" name="_wp_http_referer" value="/" /> <span class="inputs email" id="subscribe-email"> <label id="subscribe-label" for="subscribe-field"> Email </label> <input type="email" name="email" required="required" value="" id="subscribe-field" placeholder="Enter your email address" > </span> <span class="inputs submit" id="subscribe-submit"> <input class="btn" type="submit" value="Subscribe" name="subscriptions_widget"> </span> </form> <script> var ajaxscript = { ajax_url: 'https://christiansthatparty.com/wp-admin/admin-ajax.php' }; jQuery(document).ready(function ($) { $('#subsFound 26 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.farafaralosparceros.com
2024-07-06 12:55
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:55:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.farafaralosparceros.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:55:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 26 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mail.karelwalle.com
2024-07-06 12:55
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:55:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://karelwalle.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 13:00:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 26 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.dripstl.com
2024-07-06 12:54
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:55:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://dripstl.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:54:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 26 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · veryelderberry.artofrv.com
2024-07-06 12:54
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:54:29 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:59:29 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: veryelderberry — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>veryelderberry — Coming Soon</title> <script src="https://veryelderberry.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://veryelderberry.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://veryelderberry.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 27 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · thekicc.legendinx.com
2024-07-06 12:54
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:54:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thekicc.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:54:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 27 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.nervecontrol911.revsz.com
2024-07-06 12:49
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:49:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://nervecontrol911.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 31 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · estonishingevenings.com
2024-07-06 12:48
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:49:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.estonishingevenings.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:54:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 32 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.thebrandstand.co
2024-07-06 12:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:47:32 GMT Server: Apache X-Frame-Options: sameorigin X-XSS-Protection: 1 X-Content-Type-Options: nosniff Strict-Transport-Security: max-age=604800 Referrer-Policy: origin-when-cross-origin Permissions-Policy: accelerometer=(self), autoplay=(self), camera=(self), encrypted-media=(self), fullscreen=(self), geolocation=(self), gyroscope=(self), magnetometer=(self), microphone=(self), midi=(self), payment=(self), usb=(self) X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.thebrandstand.co/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 12:47:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 34 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tienda.guatech.online
2024-07-06 12:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:47:23 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://tienda.guatech.online/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 34 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · s.estebanlima.com
2024-07-06 12:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:47:02 GMT Server: Apache X-Jetpack-Boost-Cache: miss X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://segurisk.com.bo/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:47:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 34 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · jackmanind.com
2024-07-06 12:46
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:46:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jackmanind.com/wp-json/>; rel="https://api.w.org/", <https://jackmanind.com/wp-json/wp/v2/pages/22>; rel="alternate"; type="application/json", <https://jackmanind.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:51:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: EXPIRED Transfer-Encoding: chunked
Found 35 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.progenifix.trefort.net
2024-07-06 12:46
Found 35 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.shows.truesole.net
2024-07-06 12:46
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:46:35 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sat, 11 May 2024 12:53:10 GMT Accept-Ranges: bytes Content-Length: 13068 Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:46:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Type: text/html Page title: Blank Title - Home <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en" lang="en"> <head><script src="/gdpr/gdprscript.js?buildTime=1715364408&hasRemindMe=true&stealth=false"></script> <title>Blank Title - Home</title><meta property="og:site_name" content="Blank Title" /> <meta property="og:title" content="Blank Title" /> <meta property="og:description" content="Blank Title" /> <meta property="og:image" content="http://cdn2.editmysite.com/images/site/footer/og-image-placeholder-blank.png" /> <meta property="og:url" content="http://whoisduck.com/" /> <link rel="icon" type="image/png" href="//www.weebly.com/uploads/reseller/assets/1014-favicon.ico" /> <link id="wsite-base-style" rel="stylesheet" type="text/css" href="//cdn2.editmysite.com/css/sites.css?buildTime=1715364408" /> <link rel="stylesheet" type="text/css" href="//cdn2.editmysite.com/css/old/fancybox.css?1234" /> <link rel="stylesheet" type="text/css" href="/files/main_style.css?1715395093" title="wsite-theme-css" /> <style type='text/css'> .wsite-elements.wsite-not-footer:not(.wsite-header-elements) div.paragraph, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) p, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) .product-block .product-title, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) .product-description, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) .wsite-form-field label, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) .wsite-form-field label, #wsite-content div.paragraph, #wsite-content p, #wsite-content .product-block .product-title, #wsite-content .product-description, #wsite-content .wsite-form-field label, #wsite-content .wsite-form-field label, .blog-sidebar div.paragraph, .blog-sidebar p, .blog-sidebar .wsite-form-field label, .blog-sidebar .wsite-form-field label {} #wsite-content div.paragraph, #wsite-content p, #wsite-content .product-block .product-title, #wsite-content .product-description, #wsite-content .wsite-form-field label, #wsite-content .wsite-form-field label, .blog-sidebar div.paragraph, .blog-sidebar p, .blog-sidebar .wsite-form-field label, .blog-sidebar .wsite-form-field label {} .wsite-elements.wsite-footer div.paragraph, .wsite-elements.wsite-footer p, .wsite-elements.wsite-footer .product-block .product-title, .wsite-elements.wsite-footer .product-description, .wsite-elements.wsite-footer .wsite-form-field label, .wsite-elements.wsite-footer .wsite-form-field label{} .wsite-elements.wsite-not-footer:not(.wsite-header-elements) h2, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) .product-long .product-title, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) .product-large .product-title, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) .product-small .product-title, #wsite-content h2, #wsite-content .product-long .product-title, #wsite-content .product-large .product-title, #wsite-content .product-small .product-title, .blog-sidebar h2 {} #wsite-content h2, #wsite-content .product-long .product-title, #wsite-content .product-large .product-title, #wsite-content .product-small .product-title, .blog-sidebar h2 {} .wsite-elements.wsite-footer h2, .wsite-elements.wsite-footer .product-long .product-title, .wsite-elements.wsite-footer .product-large .product-title, .wsite-elements.wsite-footer .product-small .product-title{} #wsite-title {} .wsite-menu-default a {} .wsite-menu a {} .wsite-image div, .wsite-caption {} .galleryCaptionInnerText {} .fancybox-title {} .wslide-caption-text {} .wsite-phone {} .wsite-headline,.wsite-header-section .wsite-content-title {} .wsite-headline-paragraph,.wsite-header-section .paragraph {} .wsite-button-inner {} .wsite-not-footer blockquote {} .wsite-footer blockquote {} .blog-header h2 a {} #wsite-content h2.wsite-product-title {} .wsite-product .wsite-product-price a {} @media screen and (min-width: 767px) {.wsite-elements.wsite-not-footer:not(.wsite-header-elements) div.paragraph, .wsite-elements.wsite-not-footer:not(.wsite-header-elements) p, .wsite-elements.wsite-not-fFound 35 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.parapenteguatemala.com
2024-07-06 12:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:46:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://parapenteguatemala.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 35 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · keativity.sc-hosts.com
2024-07-06 12:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:46:12 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://keativity.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:46:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 35 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · dialdelivers.cedarwoodfarmstead.com
2024-07-06 12:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:42:53 GMT Server: Apache Link: <https://dialdelivers.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://dialdelivers.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://dialdelivers.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:47:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 38 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.photographybysri.com
2024-07-06 12:42
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:42:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://photographybysri.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:42:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 39 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.thejagroup.org
2024-07-06 12:42
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:42:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thejagroup.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:42:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 39 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · stereoinnovations.com
2024-07-06 12:40
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:40:57 GMT Server: Apache Link: <https://stereoinnovations.com/wp-json/>; rel="https://api.w.org/", <https://stereoinnovations.com/wp-json/wp/v2/pages/17>; rel="alternate"; type="application/json", <https://stereoinnovations.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 40 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.nightlightguy.com
2024-07-06 12:40
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:41:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://enlitedesign.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:41:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 40 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · susanfoxmd.com
2024-07-06 12:40
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:40:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <http://susanfoxmd.com/wp-json/>; rel="https://api.w.org/", <http://susanfoxmd.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Susan C. Fox MD, FACP | Internal Medicine <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title>Susan C. Fox MD, FACP | Internal Medicine</title> <link rel="stylesheet" type="text/css" media="screen" href="http://susanfoxmd.com/wp-content/themes/vcard/style.css" /> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="http://susanfoxmd.com/xmlrpc.php" /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Susan C. Fox MD, FACP » Feed" href="http://susanfoxmd.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Susan C. Fox MD, FACP » Comments Feed" href="http://susanfoxmd.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"http:\/\/susanfoxmd.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.3.18"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='http://susanfoxmd.com/wp-includes/css/dist/block-library/style.min.css?ver=5.3.18' type='text/css' media='all' /> <link rel='stylesheet' id='google-webfonts-css' href='http://fonts.googleapis.com/css?family=Droid+Sans&ver=5.3.18' type='text/css' media='all' /> <link rel='https://api.w.org/' href='http://susanfoxmd.com/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="http://susanfoxmd.com/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="http://susanfoxmd.com/wp-includes/wlwmanifest.xml" /> <meta name="generator" content="WordPress 5.3.18" /> <link rel="canonical" href="http://susanfoxmdFound 40 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · sbo88m.com
2024-07-06 12:40
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:40:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.sbo88m.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:45:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 41 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · stuffwedo.blog
2024-07-06 12:40
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:40:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://stuffwedo.blog/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:40:07 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 41 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.tomfastrealty.com
2024-07-06 12:40
Found 41 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.teamworkcares.com
2024-07-06 12:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:39:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sat, 06 Jul 2024 13:39:42 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://teamworkcares.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 42 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · synapsesmedicals.com
2024-07-06 12:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:39:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.synapsesmedicals.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:39:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 42 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.mclaincounseling.com
2024-07-06 12:39
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:39:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: McLain Counseling LLC — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>McLain Counseling LLC — Coming Soon</title> <script src="https://mclaincounseling.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://mclaincounseling.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://mclaincounseling.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 42 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.100k-crowd.co.uk
2024-07-06 12:38
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:38:49 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://100k-crowd.co.uk/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:38:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 42 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.lawanalysis.net
2024-07-06 12:38
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:38:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://lawanalysis.net/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:43:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 42 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.momgiggles.com
2024-07-06 12:38
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:38:41 GMT Server: Apache Link: <https://www.momgiggles.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:43:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 42 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.airphones.revsz.com
2024-07-06 12:38
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:38:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://airphones.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 43 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.kneesaverpooltool.com
2024-07-06 12:38
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:38:23 GMT Server: Apache Cache-Control: no-cache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kneesaverpooltool.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:38:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 43 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · sgiusaaustin.org
2024-07-06 12:37
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:37:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sgiusaaustin.org/wp-json/>; rel="https://api.w.org/", <https://wp.me/747HS>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://sgiusaaustin.org/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://sgiusaaustin.org Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:37:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 43 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.wgv.ehs.mybluehost.me
2024-07-06 12:37
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:37:44 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ftcmovement.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:42:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 43 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · rmv.psw.mybluehost.me
2024-07-06 12:37
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:37:43 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:37:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://rmv.psw.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://rmv.psw.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://rmv.psw.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 43 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · transformativesolutionsnetwork-org.tsnpa.info
2024-07-06 12:37
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:37:22 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://transformativesolutionsnetwork.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:42:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 44 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · klorrainesalon.com
2024-07-06 12:36
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:36:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <http://klorrainesalon.com/wp-json/>; rel="https://api.w.org/", <http://klorrainesalon.com/wp-json/wp/v2/pages/59>; rel="alternate"; type="application/json", <http://klorrainesalon.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:41:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=289405cc2662104423bb4e659026ddbe; path=/ Transfer-Encoding: chunked
Found 45 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.writeeditcopy.ca
2024-07-06 12:36
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:36:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://writeeditcopy.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:36:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 45 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.caldasyrios.com
2024-07-06 12:36
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:36:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://caldasyrios.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:41:07 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 45 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.helperinnovations.com
2024-07-06 12:35
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:36:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hatvisuals.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:36:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 45 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.hiy.ddq.mybluehost.me
2024-07-06 12:35
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:35:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://cid5280.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:35:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 45 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tetrasteelworx.guidingpc.com
2024-07-06 12:35
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:35:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tetrasteelworx.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:35:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 45 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.pirate.courses
2024-07-06 12:35
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:35:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.pirate.courses/wp-json/>; rel="https://api.w.org/", <https://www.pirate.courses/wp-json/wp/v2/pages/26>; rel="alternate"; type="application/json", <https://www.pirate.courses/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:35:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.pirate.courses%2F; expires=Sat, 03 Aug 2024 12:35:11 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 46 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.dallengilman.com
2024-07-06 12:34
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:35:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge Expires: Sat, 06 Jul 2024 13:35:01 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://dallengilman.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Vary: User-Agent X-Server-Cache: true X-Proxy-Cache: MISS
Found 46 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.hvacunionnj.com
2024-07-06 12:33
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:33:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hvacunionnj.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:33:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 47 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.vum.kdq.mybluehost.me
2024-07-06 12:33
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:33:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pragmate.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:33:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.healthfinance.ng
2024-07-06 12:33
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:33:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://healthfinance.ng/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 12:33:19 GMT; Max-Age=315360000; path=/
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tetraig.com
2024-07-06 12:33
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:33:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tetraig.com/wp-json/>; rel="https://api.w.org/", <https://tetraig.com/wp-json/wp/v2/pages/10>; rel="alternate"; type="application/json", <https://tetraig.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:33:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · gkoled.com
2024-07-06 12:33
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:33:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://gkoled.com/wp-json/>; rel="https://api.w.org/", <https://gkoled.com/wp-json/wp/v2/pages/12>; rel="alternate"; type="application/json", <https://gkoled.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.sterlinghard1.com
2024-07-06 12:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:33:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sterlinghard1.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:33:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · smarttranslator.revsz.com
2024-07-06 12:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:32:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://smarttranslator.revsz.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://smarttranslator.revsz.com/index.php?rest_route=/wp/v2/pages/7>; rel="alternate"; type="application/json", <https://smarttranslator.revsz.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:32:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: 1tbsp Of This Rare Herb Fixes Insomnia <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>1tbsp Of This Rare Herb Fixes Insomnia</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://smarttranslator.revsz.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://smarttranslator.revsz.com/wp-content/themes/the_deadbeat_theme/js/html5.js" type="text/javascript"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Sleep Guard Plus » Feed" href="https://smarttranslator.revsz.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Sleep Guard Plus » Comments Feed" href="https://smarttranslator.revsz.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/smarttranslator.revsz.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mlaibvestments.com
2024-07-06 12:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:32:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mlaibvestments.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:32:55 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.flatbin.com
2024-07-06 12:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:32:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hatvisuals.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:32:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · resveratone.revsz.com
2024-07-06 12:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:32:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://resveratone.revsz.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://resveratone.revsz.com/index.php?rest_route=/wp/v2/pages/11>; rel="alternate"; type="application/json", <https://resveratone.revsz.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Traditional Japanese Herb<br>Melts 53 Lbs In Weeks <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>Traditional Japanese Herb<br>Melts 53 Lbs In Weeks</title> <link rel="profile" href="https://gmpg.org/xfn/11" /> <link rel="pingback" href="https://resveratone.revsz.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://resveratone.revsz.com/wp-content/themes/the_deadbeat_theme/js/html5.js" type="text/javascript"></script> <![endif]--> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v23.0 - https://yoast.com/wordpress/plugins/seo/ --> <link rel="canonical" href="https://resveratone.revsz.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Traditional Japanese HerbMelts 53 Lbs In Weeks - Resveratone" /> <meta property="og:url" content="https://resveratone.revsz.com/" /> <meta property="og:site_name" content="Resveratone" /> <meta property="article:modified_time" content="2021-12-01T04:34:32+00:00" /> <meta property="og:image" content="https://resveratone.revsz.com/wp-content/uploads/2021/12/Vision-20-20-just.png" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://resveratone.revsz.com/","url":"https://resveratone.revsz.com/","name":"Traditional Japanese Herb Melts 53 Lbs In Weeks - Resveratone","isPartOf":{"@id":"https://resveratone.revsz.com/#website"},"primaryImageOfPage":{"@id":"https://resveratone.revsz.com/#primaryimage"},"image":{"@id":"https://resveratone.revsz.com/#primaryimage"},"thumbnailUrl":"https://resveratone.revsz.com/wp-content/uploads/2021/12/Vision-20-20-just.png","datePublished":"2021-12-01T04:34:28+00:00","dateModified":"2021-12-01T04:34:32+00:00","breadcrumb":{"@id":"https://resveratone.revsz.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://resveratone.revsz.com/"]}]},{"@type":"ImageObject","inLanguage":"en-US","@id":"https://resveratone.revsz.com/#primaryimage","url":"https://i0.wp.com/resveratone.revsz.com/wp-content/uploads/2021/12/Vision-20-20-just.png?fit=684%2C387&ssl=1","contentUrl":"https://i0.wp.com/resveratone.revsz.com/wp-content/uploads/2021/12/Vision-20-20-just.png?fit=684%2C387&ssl=1","width":684,"height":387},{"@type":"BreadcrumbList","@id":"https://resveratone.revsz.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://resveratone.revsz.com/#website","url":"https://resveratone.revsz.com/","name":"Resveratone","description":"Fat Cell Breakthrough","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://resveratone.revsz.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Resveratone » Feed" href="https://resveratone.revsz.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Resveratone » Comments Feed" href="https://resveratone.revsz.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/resveratone.revsz.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · quietplus.revsz.com
2024-07-06 12:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:32:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://quietplus.revsz.com/wp-json/>; rel="https://api.w.org/", <https://quietplus.revsz.com/wp-json/wp/v2/pages/59>; rel="alternate"; type="application/json", <https://quietplus.revsz.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:32:45 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 48 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.website-46cf2538.revsz.com
2024-07-06 12:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:32:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://reviewz.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:32:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 49 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ncnativebees-org.rda.ruz.mybluehost.me
2024-07-06 12:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:32:17 GMT Server: Apache Link: <https://ncnativebees.org/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: North Carolina Native Pollinators – Just another WordPress site <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>North Carolina Native Pollinators – Just another WordPress site</title> <link rel='dns-prefetch' href='//ncnativebees.org' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Feed" href="https://ncnativebees.org/feed/" /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Comments Feed" href="https://ncnativebees.org/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/ncnativebees.org\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.0.22"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://ncnativebees.org/wp-includes/css/dist/block-library/style.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='https://ncnativebees.org/wp-includes/css/dist/block-library/theme.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-style-css' href='https://ncnativebees.org/wp-content/themes/twentynineteen/style.css?ver=1.1' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-print-style-css' href='https://ncnativebees.org/wp-content/themes/twentynineteen/print.css?ver=1.1' type='text/css' media='print' /> <link rel='https://api.w.org/' href='https://ncnativebees.org/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://ncnativebees.org/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://ncnativebees.org/wp-includes/wlwmanifest.xml" /> <Found 49 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.mishkasocialservices.org
2024-07-06 12:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:32:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mishkasocialservices.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:32:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 49 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.uqk.fnp.mybluehost.me
2024-07-06 12:31
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:31:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress X-LiteSpeed-Cache-Control: public,max-age=604800 X-LiteSpeed-Tag: 25a_HTTP.200,25a_HTTP.301,25a_front,25a_URL.6666cd76f96956469e7be39d750cc7d9,25a_F,25a_Po.323,25a_PGS,25a_ Location: https://estebanlima.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_llms_session_70b702bb074a685c8d8434dc49426fdf=5a6269a8cf6c7740fd48a7e71a53040a%7C%7C1720290715%7C%7C1720287115%7C%7C6ca64d52e581e9a65ac2f803659ffcc9; expires=Sat, 06-Jul-2024 18:31:55 GMT; Max-Age=21600; path=/; secure; HttpOnly
Found 49 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ncnativebees.org
2024-07-06 12:31
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:31:40 GMT Server: Apache Link: <https://ncnativebees.org/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: North Carolina Native Pollinators – Just another WordPress site <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>North Carolina Native Pollinators – Just another WordPress site</title> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Feed" href="https://ncnativebees.org/feed/" /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Comments Feed" href="https://ncnativebees.org/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/ncnativebees.org\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.0.22"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://ncnativebees.org/wp-includes/css/dist/block-library/style.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='https://ncnativebees.org/wp-includes/css/dist/block-library/theme.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-style-css' href='https://ncnativebees.org/wp-content/themes/twentynineteen/style.css?ver=1.1' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-print-style-css' href='https://ncnativebees.org/wp-content/themes/twentynineteen/print.css?ver=1.1' type='text/css' media='print' /> <link rel='https://api.w.org/' href='https://ncnativebees.org/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://ncnativebees.org/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://ncnativebees.org/wp-includes/wlwmanifest.xml" /> <meta name="generator" content="WordPress 5.0.22" />Found 50 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.klickzbysri.com
2024-07-06 12:31
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:31:25 GMT Server: Apache X-Redirect-By: Permalink Manager Set-Cookie: PHPSESSID=8d66a5e0ec0bef906514777dee429be3; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://klickzbysri.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:31:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Strict-Transport-Security: max-age=300 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 50 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.bethanychristianchurchofelpaso.com
2024-07-06 12:30
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:30:07 GMT Server: Apache Link: <https://bethanychristianchurchofelpaso.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 51 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · twoguyswithguitars.com
2024-07-06 12:28
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:28:31 GMT Server: Apache X-Pingback: https://twoguyswithguitars.com/xmlrpc.php Link: <https://twoguyswithguitars.com/wp-json/>; rel="https://api.w.org/", <https://twoguyswithguitars.com/wp-json/wp/v2/pages/36>; rel="alternate"; type="application/json", <https://twoguyswithguitars.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 53 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.brainsavior.revsz.com
2024-07-06 12:27
Found 53 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.athuladassanatemple.org
2024-07-06 12:26
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:26:23 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://athuladassanatemple.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 55 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.tetraig.com
2024-07-06 12:26
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:26:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tetraig.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:26:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 55 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.quietplus.revsz.com
2024-07-06 12:25
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:25:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://quietplus.revsz.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:25:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 56 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.openit.com.bo
2024-07-06 12:25
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:25:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://openit.com.bo/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 56 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · brightbalkanmorning.charleskeil.org
2024-07-06 12:24
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:24:38 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 18 Apr 2023 22:19:17 GMT Accept-Ranges: bytes Content-Length: 2004 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: Bright Balkan Morning <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN""http://www.w3.org/TR/html4/loose.dtd"><html><head><meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1"><meta name="description" content="Romani Lives and the Power of Music in Greek Macedonia"><meta name="keywords" content="music, text book, student, Dick Blau, Charles Keil, Angeliki Vellou Keil, Steven Feld, photographs, pictures, bells, gypsy, gypsies, zourna, daouli, bands, live music"> <title>Bright Balkan Morning</title><link href="bbm.css" rel="stylesheet" type="text/css"></head><body> <div id="headerdiv" class="header"><a href="about.html" class="header">about the book</a> <span id="pipe" class="pipe">|</span> <span class="header"><a href="teachers.html" class="header">teachers</a></span> <span id="pipe" class="pipe">|</span> <a href="music.html" class="header">music</a> <span id="pipe" class="pipe">|</span> <a href="authors.html" class="header"> authors</a> <span id="pipe" class="pipe">|</span> <a href="reviews.html" class="header">reviews</a> <span id="pipe" class="pipe">| </span> <a href="buythebook.html" class="header">buy the book</a> </div> <div id="bgimage" class="bgimage" style="background-image: url(images/introduction.jpg);"> <div id="textdiv" style="position: relative; left: 550px; width: 305px; top: 100px;" > <p>"It's a beautiful and important work recommended <br> to anyone who cares about how ordinary outsiders <br> get by and get over."</p> <p>Robert Christgau, the LA Times</p> <p> </p> <p>"Music , for most of my students, is the only remaining creative activity they can understand, aside from computer graphics and comics. <i>Bright Balkan Morning</i> manages to get past their illiteracy."</p> <p>Robert K. Dentan, Anthropologist </p> </div> </div> <div id="footer" class="footer">Copyright 2023 Bright Balkan Morning. All rights reserved. Site design by Shilpa Singru.</div></body></html>
Found 57 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.harborplumbingco.com
2024-07-06 12:23
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:23:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://harborplumbingco.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:23:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 58 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · bakerblogger.com
2024-07-06 12:22
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:22:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:22:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 12:22:25 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked Page title: Baker Blogger — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Baker Blogger — Coming Soon</title> <script src="https://bakerblogger.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bakerblogger.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bakerblogger.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 59 minutes ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tropislim.trefort.net
2024-07-06 12:20
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ryrimportadora.cl
2024-07-06 12:20
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:20:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ryrimportadora.cl/wp-json/>; rel="https://api.w.org/", <https://ryrimportadora.cl/wp-json/wp/v2/pages/1991>; rel="alternate"; type="application/json", <https://ryrimportadora.cl/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:25:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · featherstonepoetry.znt.nmp.mybluehost.me
2024-07-06 12:20
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:20:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://featherstonepoetry.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:20:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 12:20:33 GMT; Max-Age=315360000; path=/ Set-Cookie: mailchimp_landing_site=https%3A%2F%2Ffeatherstonepoetry.com%2F; expires=Sat, 03 Aug 2024 12:20:37 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.still-pointfocus.com
2024-07-06 12:18
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:18:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://still-pointfocus.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:23:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.essencehealthagency.co.nz
2024-07-06 12:17
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:18:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://essencehealthagency.co.nz/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:18:04 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.loveinclakecounty.com
2024-07-06 12:14
HTTP/1.1 302 Moved Temporarily Date: Sat, 06 Jul 2024 12:14:39 GMT Server: Apache Expires: Sat, 06 Jul 2024 12:14:40 GMT Pragma: no-cache Cache-Control: no-cache, must-revalidate, maxage=0 Vary: User-Agent Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sat, 06 Jul 2024 12:14:40 GMT Location: https://loveinclakecounty.org/home/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.alttransit.edianecapital.com
2024-07-06 12:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:14:38 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://alttransit.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alttransit.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alttransit.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · outreachhospitals.com
2024-07-06 12:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:14:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://outreachhospitals.com/wp-json/>; rel="https://api.w.org/", <https://outreachhospitals.com/wp-json/wp/v2/pages/2377>; rel="alternate"; type="application/json", <https://outreachhospitals.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.benitezramirez.com
2024-07-06 12:12
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:12:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://benitezramirez.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:17:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · gloryartglass.com
2024-07-06 12:12
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:12:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gloryartglass.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.protectingpollinators.org
2024-07-06 12:11
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:11:51 GMT Server: Apache X-Pingback: https://protectingpollinators.org/xmlrpc.php Upgrade: h2,h2c Connection: Upgrade, close Location: https://protectingpollinators.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.dsmalliance.com
2024-07-06 12:11
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:11:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://dsmalliance.com/xmlrpc.php X-Redirect-By: WordPress Location: https://dsmalliance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.pknoodle.afreshlifego.com
2024-07-06 12:08
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:08:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pknoodle.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:13:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · djclimate.com
2024-07-06 12:08
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:08:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: http://djclimate.com/xmlrpc.php X-Redirect-By: WordPress Location: https://djclimate.com/About+Dj+Climate Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:13:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · s3consultingsolutions.com
2024-07-06 12:06
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:06:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://s3consultingsolutions.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:06:18 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · atomy.abctrader.us
2024-07-06 12:06
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:06:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:06:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Atomy — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Atomy — Coming Soon</title> <script src="http://atomy.abctrader.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://atomy.abctrader.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://atomy.abctrader.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · anderson4bellingham.taradactyldesign.com
2024-07-06 12:06
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:06:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anderson4bellingham.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:06:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.bakingforcompliments.ca
2024-07-06 12:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:05:04 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:05:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Baking for Compliments — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Baking for Compliments — Coming Soon</title> <script src="https://bakingforcompliments.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bakingforcompliments.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bakingforcompliments.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.idealinversiones.com
2024-07-06 12:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:05:03 GMT Server: Apache Link: <https://idealinversiones.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://idealinversiones.com/index.php?rest_route=/wp/v2/pages/146>; rel="alternate"; type="application/json", <https://idealinversiones.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.sunpower.abctrader.us
2024-07-06 12:04
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:04:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sunpower.abctrader.us/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:04:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · simplywebseo.com
2024-07-06 12:03
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:04:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: 43b_HTTP.200 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://simplywebseo.com/wp-json/>; rel="https://api.w.org/", <https://simplywebseo.com/wp-json/wp/v2/cartflows_step/73>; rel="alternate"; type="application/json", <https://simplywebseo.com/?p=73>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fsimplywebseo.com%2F; expires=Sat, 03 Aug 2024 12:04:00 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: cartflows_session_72=72_b8101dbb9ab3d69852baa0358d5a78dc; expires=Sat, 06 Jul 2024 12:34:00 GMT; Max-Age=1800; path=/; secure Set-Cookie: wcf-visited-flow-72=%5B73%5D; expires=Sun, 06 Jul 2025 12:04:00 GMT; Max-Age=31536000; path=/; domain=1 Set-Cookie: wcf-step-visited-72=%7B%2273%22%3A%7B%22control_step_id%22%3A73%2C%22current_step_id%22%3A73%2C%22step_type%22%3A%22landing%22%2C%22visit_id%22%3A30270%2C%22conversion%22%3A%22no%22%7D%7D; expires=Sun, 06 Jul 2025 12:04:00 GMT; Max-Age=31536000; path=/; domain=1 Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.minotshriners-org.biztechnd.com
2024-07-06 12:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:03:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://minotshriners.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 14:03:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.stoppsychiatricprofiling-org.aka.auj.mybluehost.me
2024-07-06 12:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:03:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://www.stoppsychiatricprofiling.org/xmlrpc.php X-Redirect-By: WordPress Location: https://www.stoppsychiatricprofiling.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:08:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · origenre.sailsinthewind.com
2024-07-06 12:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:03:22 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: nfdbrandname=bluehost; expires=Tue, 04 Jul 2034 12:03:24 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://origenre.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:08:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.dialdelivers.com
2024-07-06 12:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:03:16 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://dialdelivers.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 12:08:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.estebanlima.com
2024-07-06 12:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:02:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress X-LiteSpeed-Cache-Control: public,max-age=604800 X-LiteSpeed-Tag: 25a_HTTP.200,25a_HTTP.301,25a_front,25a_URL.6666cd76f96956469e7be39d750cc7d9,25a_F,25a_Po.323,25a_PGS,25a_ Location: https://estebanlima.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_llms_session_70b702bb074a685c8d8434dc49426fdf=b6ba91711af4bdfa45cea22eb9a540a8%7C%7C1720288964%7C%7C1720285364%7C%7C6a99b619dbc5f5813af32a1d81e0c83e; expires=Sat, 06-Jul-2024 18:02:44 GMT; Max-Age=21600; path=/; secure; HttpOnly
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.umustudio.com
2024-07-06 12:02
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 12:02:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.umustudio.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=600 Expires: Sat, 06 Jul 2024 12:12:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · vitalflow.revsz.com
2024-07-06 12:02
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.private.hannamcompany.com
2024-07-06 12:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 12:00:15 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://private.hannamcompany.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.grz.wyd.mybluehost.me
2024-07-06 11:59
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:59:29 GMT Server: Apache Link: <https://biztechnd.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://biztechnd.com/index.php?rest_route=/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://biztechnd.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ebw.ehs.mybluehost.me
2024-07-06 11:54
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:54:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://felineanswers.com/wp-json/>; rel="https://api.w.org/", <https://felineanswers.com/wp-json/wp/v2/pages/160>; rel="alternate"; type="application/json", <https://felineanswers.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:59:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · twosistersdesignsnd.com
2024-07-06 11:54
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:54:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://twosistersdesignsnd.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://twosistersdesignsnd.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://twosistersdesignsnd.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.adventuresinadhd.com
2024-07-06 11:53
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:53:59 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://www.adventuresinadhd.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/7MDiS>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.hablemosdefolklore.estebanlima.com
2024-07-06 11:53
HTTP/1.1 404 Not Found Date: Sat, 06 Jul 2024 11:53:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Jetpack-Boost-Cache: miss Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Link: <https://hablemosdefolklore.com/wp-json/>; rel="https://api.w.org/" Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · website-caee3af4.legendinx.com
2024-07-06 11:53
HTTP/1.1 403 Forbidden Date: Sat, 06 Jul 2024 11:53:05 GMT Server: Apache Content-Length: 318 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 403 Forbidden <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>403 Forbidden</title> </head><body> <h1>Forbidden</h1> <p>You don't have permission to access this resource.</p> <p>Additionally, a 403 Forbidden error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.codasocalconference.com
2024-07-06 11:52
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:52:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://codasocalconference.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:52:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · hymmedicalsa.com
2024-07-06 11:52
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:52:35 GMT Server: Apache Link: <https://hymmedicalsa.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://hymmedicalsa.com/index.php?rest_route=/wp/v2/pages/22>; rel="alternate"; type="application/json", <https://hymmedicalsa.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.glamorousbeauty.space
2024-07-06 11:52
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:52:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://glamorousbeauty.space/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:52:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · andrewformountvernon.com
2024-07-06 11:52
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:52:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://andrewformountvernon.com/wp-json/>; rel="https://api.w.org/", <https://andrewformountvernon.com/wp-json/wp/v2/pages/15>; rel="alternate"; type="application/json", <https://andrewformountvernon.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:52:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.meri-usa.lno.rln.mybluehost.me
2024-07-06 11:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:51:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://meri-usa.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:56:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.bitcomplianceassurance.com
2024-07-06 11:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:51:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bitcomplianceassurance.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:56:54 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.hannamcompany.com
2024-07-06 11:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:51:44 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://hannamcompany.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mishkasocialservices.org
2024-07-06 11:51
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:51:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://mishkasocialservices.org/wp-json/>; rel="https://api.w.org/", <https://mishkasocialservices.org/wp-json/wp/v2/pages/345>; rel="alternate"; type="application/json", <https://mishkasocialservices.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:51:28 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found about an hour ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.marlodj.obertys.com
2024-07-06 11:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:51:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://marlodj.obertys.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:51:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.hvacunionnj.simplywebseo.com
2024-07-06 11:50
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:50:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hvacunionnj.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:50:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.nen.jgp.mybluehost.me
2024-07-06 11:50
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:50:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://www.fishfacepublishing.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:55:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.alternativehousecarehome.com
2024-07-06 11:50
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:50:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://alternativehousecarehome.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:55:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.myhappyhealthyhome.madsenadvertising.com
2024-07-06 11:49
HTTP/1.1 302 Found Date: Sat, 06 Jul 2024 11:49:55 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.stallfreepropellers.com
2024-07-06 11:49
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:49:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stallfreepropellers.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:49:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tetradevelopment-net.guidingpc.com
2024-07-06 11:49
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:49:06 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://tetradevelopment.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:49:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.portfoliostyles.donswpbox.com
2024-07-06 11:49
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:49:06 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Investment Portfolios - Analyzing Styles and Securities — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Investment Portfolios - Analyzing Styles and Securities — Coming Soon</title> <script src="https://portfoliostyles.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://portfoliostyles.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://portfoliostyles.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.pirate.courses
2024-07-06 11:49
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:49:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.pirate.courses/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:49:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fwww.pirate.courses%2F; expires=Sat, 03 Aug 2024 11:49:10 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ameybusiness.com
2024-07-06 11:49
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:49:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://ameybusiness.com/wp-json/>; rel="https://api.w.org/", <https://ameybusiness.com/wp-json/wp/v2/pages/23>; rel="alternate"; type="application/json", <https://ameybusiness.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:54:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.visawebs.com
2024-07-06 11:49
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:49:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.visawebs.com/wp-json/>; rel="https://api.w.org/", <https://www.visawebs.com/wp-json/wp/v2/pages/815>; rel="alternate"; type="application/json", <https://www.visawebs.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:49:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.checkenginemobilerepair.com
2024-07-06 11:49
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:49:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://checkenginemobilerepair.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:54:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.sempermd.com
2024-07-06 11:48
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:48:54 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://sempermd.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.flatironsmanagementgroup.zbx.hnq.mybluehost.me
2024-07-06 11:48
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:48:47 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://flatironsmanagementgroup.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:53:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · gonzalezfamilyfarm.com
2024-07-06 11:48
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:48:35 GMT Server: Apache Link: <https://gonzalezfamilyfarm.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://gonzalezfamilyfarm.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; type="application/json", <https://gonzalezfamilyfarm.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:48:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.umustudio.com
2024-07-06 11:48
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:48:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.umustudio.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=600 Expires: Sat, 06 Jul 2024 11:58:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · marmabotanica.sc-hosts.com
2024-07-06 11:48
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:48:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marmabotanica.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:48:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.curiousmeow.davolynindustries.com
2024-07-06 11:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:47:56 GMT Server: Apache Pragma: no-cache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Set-Cookie: PHPSESSID=e6c1d67382d9d70fb7a31233883a605e; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://curiousmeow.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · curiousmeow.davolynindustries.com
2024-07-06 11:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:47:54 GMT Server: Apache Pragma: no-cache Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Set-Cookie: PHPSESSID=0ea482fc170f7427174c3f879eda905f; path=/ Upgrade: h2,h2c Connection: Upgrade, close Location: https://curiousmeow.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.resveratone.revsz.com
2024-07-06 11:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:47:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://resveratone.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · susanfoxmd.com
2024-07-06 11:46
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:46:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://susanfoxmd.com/wp-json/>; rel="https://api.w.org/", <https://susanfoxmd.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Susan C. Fox MD, FACP | Internal Medicine <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title>Susan C. Fox MD, FACP | Internal Medicine</title> <link rel="stylesheet" type="text/css" media="screen" href="https://susanfoxmd.com/wp-content/themes/vcard/style.css" /> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://susanfoxmd.com/xmlrpc.php" /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Susan C. Fox MD, FACP » Feed" href="https://susanfoxmd.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Susan C. Fox MD, FACP » Comments Feed" href="https://susanfoxmd.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/susanfoxmd.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.3.18"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://susanfoxmd.com/wp-includes/css/dist/block-library/style.min.css?ver=5.3.18' type='text/css' media='all' /> <link rel='stylesheet' id='google-webfonts-css' href='http://fonts.googleapis.com/css?family=Droid+Sans&ver=5.3.18' type='text/css' media='all' /> <link rel='https://api.w.org/' href='https://susanfoxmd.com/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://susanfoxmd.com/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://susanfoxmd.com/wp-includes/wlwmanifest.xml" /> <meta name="generator" content="WordPress 5.3.18" /> <link rel="canonical" href="https://Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · kneesaverpooltool.com
2024-07-06 11:44
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:44:20 GMT Server: Apache Cache-Control: no-cache WPO-Cache-Status: cached Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sat, 06 Jul 2024 06:23:30 GMT Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:44:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.mosmanvillagecommunity.org
2024-07-06 11:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:44:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://mosmanvillagecommunity.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · healthfinance-ng.medinetone.com
2024-07-06 11:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:44:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://healthfinance.ng/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 11:44:12 GMT; Max-Age=315360000; path=/
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.aerc.abctrader.us
2024-07-06 11:43
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:43:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:43:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: American Everglow Regional Center — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>American Everglow Regional Center — Coming Soon</title> <script src="https://aerc.abctrader.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://aerc.abctrader.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://aerc.abctrader.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · simplywebseo-online.simplywebseo.com
2024-07-06 11:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:43:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://coinhardwareglobal.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:43:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.mynewkentuckyhome.com
2024-07-06 11:42
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:42:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mynewkentuckyhome.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:47:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · alternativehousecarehome.com
2024-07-06 11:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:42:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://alternativehousecarehome.com/wp-json/>; rel="https://api.w.org/", <https://alternativehousecarehome.com/wp-json/wp/v2/pages/14>; rel="alternate"; type="application/json", <https://alternativehousecarehome.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:47:13 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · coinhardwareglobal.simplywebseo.com
2024-07-06 11:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:42:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://coinhardwareglobal.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:42:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.lno.rln.mybluehost.me
2024-07-06 11:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:42:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:42:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html> <head> <meta name="viewport" content="width=device-width"> <title> Welcome — Coming Soon </title> <script src="https://box5702.temp.domains/~lnorlnmy/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url("https://box5702.temp.domains/~lnorlnmy/wp-content/plugins/mojo-marketplace-wp-plugin/images/cs-bluehost-bg.jpg"); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom: 0; left: 0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16px; font-size: 11px; top: 2px; }Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.eb5.abctrader.us
2024-07-06 11:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:42:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:42:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: EB5.ABCTrader.US — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>EB5.ABCTrader.US — Coming Soon</title> <script src="https://eb5.abctrader.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://eb5.abctrader.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://eb5.abctrader.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · openit.com.bo
2024-07-06 11:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:42:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://openit.com.bo/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:42:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Open IT | Soluciones tecnológicas libres <!DOCTYPE html> <!--[if lt IE 7]> <html class="ie ie6 lte9 lte8 lte7" lang="en-US"> <![endif]--> <!--[if IE 7]> <html class="ie ie7 lte9 lte8 lte7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8 lte9 lte8" lang="en-US"> <![endif]--> <!--[if IE 9]> <html class="ie ie9 lte9" lang="en-US"> <![endif]--> <!--[if gt IE 9]> <html> <![endif]--> <!--[if !IE]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <title>Open IT | Soluciones tecnológicas libres</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://openit.com.bo/xmlrpc.php" /> <link rel="stylesheet" href="https://openit.com.bo/wp-content/themes/echelon/shortcodes.css" type="text/css" media="screen" /> <link rel="stylesheet" href="https://openit.com.bo/wp-content/themes/echelon/style.css" type="text/css" media="screen" /> <link rel="stylesheet" href="https://openit.com.bo/wp-content/themes/echelon/lib/scripts/css.php" type="text/css" media="screen" /> <!--[if IE 6]> <link rel="stylesheet" type="text/css" href="https://openit.com.bo/wp-content/themes/echelon/styles/_ie/ie6.css"> <![endif]--> <!--[if IE 7]> <link rel="stylesheet" type="text/css" href="https://openit.com.bo/wp-content/themes/echelon/styles/_ie/ie7.css"> <![endif]--> <!--[if IE 8]> <link rel="stylesheet" type="text/css" href="https://openit.com.bo/wp-content/themes/echelon/styles/_ie/ie8.css"> <![endif]--> <!--[if lt IE 9]> <script type="text/javascript" src="https://openit.com.bo/wp-content/themes/echelon/lib/scripts/respond.min.js"></script> <![endif]--> <script type="text/javascript"> /* <![CDATA[ */ var imageResize = "timthumb", resizeDisabled = "", assetsUri = "https://openit.com.bo/wp-content/themes/echelon/images/assets", imageNonce = "e4afb44d56", disableSlidemenu = "false", prettyphotoTheme = "pp_default", imagePadding = "12", responsiveSite = "true"; document.write('<style type="text/css">.noscript{visibility: hidden;}.ie .noscript{visibility: collapse;}.noscript_dn{display: none;}h1,h2,h3,h4,.logo a,.jqueryslidemenu li span,#header+#intro .intro_title,#intro .intro_title,#intro .teaser,#slider_module+#intro h3,#sidebar .widgettitle,.about_author_title,.share_this_title,.additional_posts_title,.commentlist_title,#reply-title,#comments-title, .blog_tabs,#outro,#outro a,.toggle a,.toggle_accordion a,.author_name,.commentlist cite,.commentlist cite a,#content .teaser{opacity: 0;-ms-filter:"progid:DXImageTransform.Microsoft.Alpha(Opacity=0)";}</style>'); /* ]]> */ </script> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Open IT » Feed" href="https://openit.com.bo/feed/" /> <link rel="alternate" type="application/rss+xml" title="Open IT » Comments Feed" href="https://openit.com.bo/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/openit.com.bo\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.26"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,564Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.glutenfree-mimi.com
2024-07-06 11:42
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:42:06 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://glutenfree-mimi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · 128path.org
2024-07-06 11:41
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:41:54 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Fri, 08 Sep 2017 18:04:33 GMT Accept-Ranges: bytes Content-Length: 9079 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: 12/8 PATH - Brass bands serving dancers and building community spirit <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>12/8 PATH - Brass bands serving dancers and building community spirit</title> <meta content="12/8, path, paths, brass bands, dancers, community spirit, pleasure, playing, mobility, inclusion, funny hats, happiness, joy, musicking, dancing, drumming, music, dance, community, children, spirit, path bands, Path Times, spirituality, pedagogy, poetry, paganism, green politics, species diversity, cultural diversity, movements, reclaiming, demonstrations, performance, street music, horns, drums, festivals, funk, second line, dixieland, swing, samba, salsa, conga, comparsa, partying, mobile, inclusive, grooving, communitas, social change, twelve step, eight fold path, rites, rituals, William Blake, four fold vision, call/response, biocentric, animism, solstice, Malcolm X, biocentric, strolling group, shuffle rhythms, praxis, step program, Gregory Bateson, trumpets, trombones, sousaphone, saxophones, bass drum, snare drum, guiro, agogo, echology, ecology of mind, riffs, triune brain, equinox, full moon, wakes, processions, parades, picnics, weddings, participatory discrepancies, public domain, in the zone, flow, focus, libertarian, socialism, Greenpeace, Human Rights Watch, Cultural Survival, Buffalo, Seattle, Boston, New York, paired instruments, self-determination, self-organization, cultural integrity, species integrity, Brazil, Cuba, New Orleans, dynamic pattern." name="Keywords" /> <meta content="The 12/8 Path is a brass band movement for reclaiming the powers of music-dance performance for all people, but especially children, in their communities" name="Description" /> <script language="JavaScript"> <!-- <!-- hide this script from non-javascript-enabled browsers /* Functions that swaps images. */ // stop hiding --> function MM_preloadImages() { //v3.0 var d=document; if(d.images){ if(!d.MM_p) d.MM_p=new Array(); var i,j=d.MM_p.length,a=MM_preloadImages.arguments; for(i=0; i<a.length; i++) if (a[i].indexOf("#")!=0){ d.MM_p[j]=new Image; d.MM_p[j++].src=a[i];}} } function MM_swapImgRestore() { //v3.0 var i,x,a=document.MM_sr; for(i=0;a&&i<a.length&&(x=a[i])&&x.oSrc;i++) x.src=x.oSrc; } function MM_findObj(n, d) { //v4.01 var p,i,x; if(!d) d=document; if((p=n.indexOf("?"))>0&&parent.frames.length) { d=parent.frames[n.substring(p+1)].document; n=n.substring(0,p);} if(!(x=d[n])&&d.all) x=d.all[n]; for (i=0;!x&&i<d.forms.length;i++) x=d.forms[i][n]; for(i=0;!x&&d.layers&&i<d.layers.length;i++) x=MM_findObj(n,d.layers[i].document); if(!x && d.getElementById) x=d.getElementById(n); return x; } function MM_swapImage() { //v3.0 var i,j=0,x,a=MM_swapImage.arguments; document.MM_sr=new Array; for(i=0;i<(a.length-2);i+=3) if ((x=MM_findObj(a[i]))!=null){document.MM_sr[j++]=x; if(!x.oSrc) x.oSrc=x.src; x.src=a[i+2];} } //--> </script> </head> <body bgcolor="#ee1a1a" onload="MM_preloadImages('indexpath/indexpath_r1_c1_f2.gif','indexpath/indexpath_r2_c1_f2.gif','indexpath/indexpath_r3_c1_f2.gif','indexpath/indexpath_r4_c1_f2.gif','indexpath/indexpath_r5_c1_f2.gif','indexpath/indexpath_r6_c1_f2.gif')"> <div align="center"> <p><img height="48" alt="12/8 Path" width="265" border="0" _wpro_SRC="path.gif" src="path.gif" /> </p> <table cellpadding="5" width="100%" border="0"> <tbody> <tr> <td width="25%"> <table width="50%"> <tbody> <tr valign="center"> <td width="537" height="92"><font face="'Arial Black',Arial,sans-serif">Want to be in a band for dancers that is mobile, inclusive and wears funny hats? Get on the 12/8 path..... </font></td></tr></tbody></table></td> <td width="50%"> <table cellpadding="5" width="100%" border="0"> <tbody> <tr> <td valign="bottom" width="35%"> <div align="right"><a href="http://musicgrooves.org"><img height="144" alt="Music Grooves Book Cover" width="88" border="0" src="MusicGrooves.jpg" /></a></div></td> <td valign="top" width="28%" rowspan="Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · caldasyrios.com
2024-07-06 11:41
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:41:55 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://caldasyrios.com/wp-json/>; rel="https://api.w.org/", <https://caldasyrios.com/wp-json/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://wp.me/PaLRwc-5>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:46:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.website-385bfe7c.revsz.com
2024-07-06 11:41
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:41:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thejagroup.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:41:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · bakingforcompliments.com
2024-07-06 11:41
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:41:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:41:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Baking for Compliments — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Baking for Compliments — Coming Soon</title> <script src="https://bakingforcompliments.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bakingforcompliments.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bakingforcompliments.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.kneesaverpooltool.davolynindustries.com
2024-07-06 11:41
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:41:28 GMT Server: Apache Cache-Control: no-cache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kneesaverpooltool.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:41:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.musicgrooves-org.charleskeil.org
2024-07-06 11:41
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:41:29 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Thu, 06 Jul 2017 16:35:18 GMT Accept-Ranges: bytes Content-Length: 5604 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: Music Grooves Home Page <?php require_once('Connections/LinkID.php'); ?> <?php mysql_select_db($database_LinkID, $LinkID); $query_TopicAreas = "SELECT AreaID, ShortName FROM TopicAreas"; $TopicAreas = mysql_query($query_TopicAreas, $LinkID) or die(mysql_error()); $row_TopicAreas = mysql_fetch_assoc($TopicAreas); $totalRows_TopicAreas = mysql_num_rows($TopicAreas); ?> <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1"> <title>Music Grooves Home Page</title> <link href="mg.css" rel="stylesheet" type="text/css"> <script language="JavaScript" type="text/JavaScript"> <!-- function MM_goToURL(area) { //v3.0 document.MM_returnValue = false; parent.location="topics.php?AreaID=" + area; } //--> </script> <meta name="keywords" content="music,groove,grooving,groovology,sound,anthropology,participation,dialogues,dialogic,dialectics,style,culture,African-Americans,musical experience,lift-up-over sounding,mediation,performance,commodification,commodified,communication,participatory discrepancies,iconicity,Kaluli,stereotype,class,speech,natural world,aesthetics,listening experience,hegemony,civilization,jazz,dance,environment,cultural studies,Polish-Americans,records,recordings,rituals,process,copyright,world beat,layered,interacting,interplay,how to study music,bibliography,schizophonia,schismogenesis,practices,male bonding,identity,reflexive discourse,interpretive moves,popular music,models,polka,blues,speech,conversation,interviewing,metaphors,affecting presence,juxtaposed essays,Papua New Guinea,James Brown,Aretha Franklin,Louis Armstrong,Robert Armstrong,Mickey Hart,Tiv,resistance,joy"> <meta name="description" content="Music Grooves is an adventure in scholarly and personal dialogue. We link two thematic preoccupations central to the study of music: the experience of musical participation and the experience of musical mediation. To more personally and vocally unite the essay materials, we recorded and transcribed our own speech about music and playing and listening to it together. We talk about grooving, sound, participation, style, musical experience, culture, mediation, performance, records and recording, lift-up-over sounding, participatory discrepenacies, and the purposes of this site are to make our dialogues easily available and to encourage others to dialogue along with us."> </head> <body> <div align="center"> <table width="700" border="0" cellspacing="0" cellpadding="0"> <tr> <td width="367" height="96" valign="top" background="images/MGHeaderBG.jpg"><div align="left"><a href="index.php"><img src="images/MGText.gif" alt="Music Grooves - Join our dialogues" width="346" height="60" border="0"></a></div> <div align="center"> <!-- <select name="select" size="1" onChange="MM_goToURL(selectedIndex);return document.MM_returnValue"> <option selected value="">Select A Topic Area</option> <?php do { ?> <option value="<?php echo $row_TopicAreas['AreaID']?>"><?php echo $row_TopicAreas['ShortName']?></option> <?php } while ($row_TopicAreas = mysql_fetch_assoc($TopicAreas)); $rows = mysql_num_rows($TopicAreas); if($rows > 0) { mysql_data_seek($TopicAreas, 0); $row_TopicAreas = mysql_fetch_assoc($TopicAreas); } ?> </select> --> </div> </td> <td width="271" height="96" valign="top" background="images/MGHeaderBG.jpg"><div align="right" class="style5"> <div align="left"> <a href="http://musicgrooves.org/">HOME</a><br> <a href="http://musicgrooves.org/photos.html">PHOTOS</a><br> <a href="http://musicgrooves.org/articles.html">ARTICLES</a><br> <a href="http://musicgrooves.org/reviews.html">REVIEWS</a><br> <a href="http://musicgrooves.org/bios.html">BIOS</a> </div> </div></td> <td width="61" height="96" valign="top" background="images/MGHeaderBG.jpg"><div align="right"><img src="imagFound 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · epcmconsultores-com-bo.estebanlima.com
2024-07-06 11:41
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:41:23 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://epcmconsultores.com.bo/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.lakecountryarts.org
2024-07-06 11:41
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:41:12 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://lakecountryarts.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.anitalahey.ca
2024-07-06 11:40
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:40:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://anitalahey.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:45:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jmghomeservices.com
2024-07-06 11:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:40:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jmghomeservices.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:40:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · website-64e0a88e.oneflymama.com
2024-07-06 11:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:39:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Content-Security-Policy: script-src 'self' 'unsafe-inline' 'unsafe-eval' https: data: X-Redirect-By: WordPress Location: https://thepartycatalog.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:39:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=0f9869307c90e6b258ebdf121b54a380; path=/
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · website-b44a4054.aka.auj.mybluehost.me
2024-07-06 11:38
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:38:44 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:38:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Center for the Human Rights of Users and Survivors of Psychiatry — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Center for the Human Rights of Users and Survivors of Psychiatry — Coming Soon</title> <script src="http://aka.auj.mybluehost.me/website_b44a4054/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://aka.auj.mybluehost.me/website_b44a4054/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://aka.auj.mybluehost.me/website_b44a4054/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · dallengilman.com
2024-07-06 11:35
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:35:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://dallengilman.com/wp-json/>; rel="https://api.w.org/", <https://dallengilman.com/wp-json/wp/v2/pages/26>; rel="alternate"; type="application/json", <https://wp.me/PaqSL1-q>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:35:52 GMT Vary: Accept-Encoding,User-Agent host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · addict502.com
2024-07-06 11:35
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:35:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.addict502.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tangithomas.nbg.ehs.mybluehost.me
2024-07-06 11:35
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:35:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tangithomas.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:35:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · ncnativebees.org
2024-07-06 11:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:32:58 GMT Server: Apache Link: <http://ncnativebees.org/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: North Carolina Native Pollinators – Just another WordPress site <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>North Carolina Native Pollinators – Just another WordPress site</title> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Feed" href="http://ncnativebees.org/feed/" /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Comments Feed" href="http://ncnativebees.org/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"http:\/\/ncnativebees.org\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.0.22"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='http://ncnativebees.org/wp-includes/css/dist/block-library/style.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='http://ncnativebees.org/wp-includes/css/dist/block-library/theme.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-style-css' href='http://ncnativebees.org/wp-content/themes/twentynineteen/style.css?ver=1.1' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-print-style-css' href='http://ncnativebees.org/wp-content/themes/twentynineteen/print.css?ver=1.1' type='text/css' media='print' /> <link rel='https://api.w.org/' href='http://ncnativebees.org/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="http://ncnativebees.org/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="http://ncnativebees.org/wp-includes/wlwmanifest.xml" /> <meta name="generator" content="WordPress 5.0.22" /> <style typFound 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.worldwidebh.ja-developments.com
2024-07-06 11:31
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:31:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:31:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Worldwide Business Holding — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Worldwide Business Holding — Coming Soon</title> <script src="http://worldwidebh.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://worldwidebh.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://worldwidebh.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · loversclubfilms.com
2024-07-06 11:31
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:31:18 GMT Server: Apache Link: <https://loversclubfilms.com/wp-json/>; rel="https://api.w.org/", <https://loversclubfilms.com/wp-json/wp/v2/pages/7>; rel="alternate"; type="application/json", <https://loversclubfilms.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 11:31:18 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · glutenfree-mimi.com
2024-07-06 11:31
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:31:09 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://glutenfree-mimi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.jacynthedurochermedia.com
2024-07-06 11:30
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:31:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jacynthedurochermedia.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:35:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · jlbccommunityalliance.com
2024-07-06 11:30
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:30:02 GMT Server: Apache P3P: CP="ALL DSP NID CURa ADMa DEVa HISa OTPa OUR NOR NAV DEM" Link: <https://jlbccommunityalliance.com/wp-json/>; rel="https://api.w.org/", <https://jlbccommunityalliance.com/wp-json/wp/v2/pages/7366>; rel="alternate"; type="application/json", <https://jlbccommunityalliance.com/>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://jlbccommunityalliance.com/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://jlbccommunityalliance.com Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:30:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.gonzalezfamilyfarm.cid5280.com
2024-07-06 11:29
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:29:51 GMT Server: Apache Link: <https://gonzalezfamilyfarm.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://gonzalezfamilyfarm.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; type="application/json", <https://gonzalezfamilyfarm.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:29:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mosmanvillagecommunity.org
2024-07-06 11:29
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:29:26 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding,Cookie Link: <https://mosmanvillagecommunity.org/wp-json/>; rel="https://api.w.org/", <https://mosmanvillagecommunity.org/wp-json/wp/v2/pages/350>; rel="alternate"; type="application/json", <https://mosmanvillagecommunity.org/>; rel=shortlink host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ecmi-eg.org
2024-07-06 11:29
HTTP/1.1 302 Found Date: Sat, 06 Jul 2024 11:29:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 233 Location: https://www.ecmi-eg.org/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://www.ecmi-eg.org/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.caravanaperubolivia.camaraperubolivia.org.pe
2024-07-06 11:29
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:29:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.caravanaperubolivia.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:29:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.glutenfree-mimi.com
2024-07-06 11:28
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:28:47 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://glutenfree-mimi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.csr1online.com
2024-07-06 11:28
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:28:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:28:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=11e997b3a24347cb9a1b038eadff8d67; path=/ set-cookie: __cf_bm=gub3BcBXGLAyd.cBOXEKgbE0bq4bxb57Z87rKndXJG4-1720265323-1.0.1.1-Hv4XHJpNZix_tSNLpscCET5QrftXMbiIf2aqYHPqAxGV86IqGKKyZpj5x7m_d9.naFMsXl1juOl8jvm5aU.1tFbIwK69ndwneVN8ElHDbB4; path=/; expires=Sat, 06-Jul-24 11:58:43 GMT; domain=.clickfunnels.com; HttpOnly; Secure set-cookie: _cfuvid=8qWrR0YcWgfL4LKlORWnFrb2Glczb7ZWgqxwpRejmCc-1720265323008-0.0.1.1-604800000; path=/; domain=.clickfunnels.com; HttpOnly; Secure; SameSite=None Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.ocd5280.com
2024-07-06 11:27
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:27:25 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ocd5280.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:27:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · dsmalliance.com
2024-07-06 11:27
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:27:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: http://dsmalliance.com/xmlrpc.php X-Redirect-By: WordPress Location: https://dsmalliance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · myhappyhealthyhome.madsenadvertising.com
2024-07-06 11:27
HTTP/1.1 302 Found Date: Sat, 06 Jul 2024 11:27:03 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.icapproducts.com
2024-07-06 11:26
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:26:07 GMT Server: Apache Link: <https://icapcanada.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://icapcanada.com/index.php?rest_route=/wp/v2/pages/73>; rel="alternate"; type="application/json", <https://icapcanada.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.iacvt.com
2024-07-06 11:23
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:23:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://iacvt.com/main-page/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:23:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.mediwiserx.com
2024-07-06 11:23
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:23:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mediwiserx.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:28:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · kseducationsolutions.com
2024-07-06 11:23
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:23:22 GMT Server: Apache Link: <https://kseducationsolutions.com/wp-json/>; rel="https://api.w.org/", <https://kseducationsolutions.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=.35" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <link href="../wp-content/themes/KSES/styles/ks.css" rel="stylesheet" type="text/css" /> <style type="text/css"> <!-- body { background-image:url(../wp-content/themes/KSES/images/bg.jpg); background-position:top center; background-repeat:no-repeat; background-color:#525556; } --> </style> </head> <body> <div id="navBar"> <div style="position:relative;"> <div id="Logo"><img src="../wp-content/themes/KSES/images/KSES_Logo.png" width="181" height="130" /></div> <div id="subscribe"> <form id="subscribes" name="subscribes" method="post" action=""> <table width="383" border="0" cellspacing="2" cellpadding="2"> <tr> <td width="160" class="subscribe">Subscribe</td> <td width="147" class="subscribe"><input name="email" type="text" id="email" style="color:#999;" value="Enter Email Address" size="30" /> </td> </tr> <tr> <td> </td> <td align="right"><a href="javascript:document.subscribes.submit()"><img src="../wp-content/themes/KSES/images/submit.png" width="44" height="20" border="0" /></a></td> </tr> </table> </form> </div> <div id="nav"> <div class="Nav" id="btn"><a href="home"> <div id="spacing">Home</div></a></div> <div class="Nav" id="divide">|</div> <div class="Nav" id="btn"><a href="services"> <div id="spacing">Services</div></a></div ><div class="Nav" id="divide">|</div> <div class="Nav" id="btn"><a href="about"> <div id="spacing">About KS</div></a></div> <div class="Nav" id="divide">|</div> <div class="Nav" id="btn"><a href="fees"> <div id="spacing"> Financial Education/FEES</div></a></div> <div class="Nav" id="divide">|</div> <div class="Nav" id="btn"><a href="contact"> <div id="spacing"> Contact/Speaking Requests</div></a></div> </div> </div> </div> <script language="javascript">alert(message successfully sent)</script> <div id="hdrImg"> <div id="slider-wrapper"> <div id="slide" > <img src="../wp-content/themes/KSES/images/HeaderImage-1.png" width="1102" height="511" border="0"/> </div> </div> </div> <div id="content"> <div id="box"><a href="services"><img src="../wp-content/themes/KSES/images/box1.png" alt="" name="" width="260" height="279" border="0" /></a></div> <div id="box"><a href="fees"><img src="../wp-content/themes/KSES/images/box2.png" alt="" name="" width="260" height="279" border="0" /></a></div> <div id="box" ><a href="about"><img src="../wp-content/themes/KSES/images/box3.png"alt="" name="" width="260" height="279" border="0" /></a></div> <div id="box" ><a href="contact"><img src="../wp-content/themes/KSES/images/box4.png" alt="" name="" width="260" height="279" border="0" /></a></div> <div class="clear"></div> <div id="welcome"> <h1></h1> <div class="bodyCopy"></div> </p> </div> <div id="homeVideo"> </div> <div class="clear"></div> </div> <div id="footer"> <div><img src="../wp-content/themes/KSES/images/index_06.png" width="1102" height="10" /></div> <div class="footerText" id="footerLft"> <span class="footerText">� K&S Education Solutions</span></div> <div class="footerText" id="footerRght"><a href="mailto:sbutts@kseducationsolutions.co">sbutts@kseducationsolutions.com</a> | 313.433.1089 </div> <div class="clear"></div> </div> <script> /(trident|msie)/i.test(navigator.userAgent)&&document.getElementById&&window.addEventListener&&window.addEventListener("hashchange",function(){var t,e=location.hash.substring(1);/^[A-z0-9_-]+$/.test(e)&&(t=document.getElementById(e))&&(/^(?:a|select|input|button|textarea)$/i.test(t.tagName)||(t.tabIndex=-1),t.focus())},!1); </script> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · evc.rzk.mybluehost.me
2024-07-06 11:22
HTTP/1.1 503 Service Unavailable Date: Sat, 06 Jul 2024 11:22:48 GMT Server: Apache Content-Length: 428 Connection: close Content-Type: text/html; charset=iso-8859-1 Page title: 503 Service Unavailable <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>503 Service Unavailable</title> </head><body> <h1>Service Unavailable</h1> <p>The server is temporarily unable to service your request due to maintenance downtime or capacity problems. Please try again later.</p> <p>Additionally, a 503 Service Unavailable error was encountered while trying to use an ErrorDocument to handle the request.</p> </body></html>
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.gonzalezfamilyfarm.com
2024-07-06 11:22
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:22:14 GMT Server: Apache Link: <https://gonzalezfamilyfarm.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://gonzalezfamilyfarm.com/index.php?rest_route=/wp/v2/pages/30>; rel="alternate"; type="application/json", <https://gonzalezfamilyfarm.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:22:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.curatedtouring.com
2024-07-06 11:21
HTTP/1.1 302 Found Date: Sat, 06 Jul 2024 11:21:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=iso-8859-1 Content-Length: 241 Location: https://mail.curatedtouring.com/cgi-sys/suspendedpage.cgi X-Server-Cache: true X-Proxy-Cache: MISS host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Page title: 302 Found <!DOCTYPE HTML PUBLIC "-//IETF//DTD HTML 2.0//EN"> <html><head> <title>302 Found</title> </head><body> <h1>Found</h1> <p>The document has moved <a href="https://mail.curatedtouring.com/cgi-sys/suspendedpage.cgi">here</a>.</p> </body></html>
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · primalcreationsllc.com
2024-07-06 11:21
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:21:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.primalcreationsllc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.likeagencyofficial.com
2024-07-06 11:20
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:20:44 GMT Server: Apache Link: <https://www.likeagencyofficial.com/wp-json/>; rel="https://api.w.org/", <https://www.likeagencyofficial.com/wp-json/wp/v2/pages/17781>; rel="alternate"; type="application/json", <https://www.likeagencyofficial.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=3600 Expires: Sat, 06 Jul 2024 12:20:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jdesign-office.publishersjapan.com
2024-07-06 11:20
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:20:20 GMT Server: Apache Link: <https://www.jdesign-office.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.jointgenesis.revsz.com
2024-07-06 11:20
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:20:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:20:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: jointgenesis — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>jointgenesis — Coming Soon</title> <script src="https://jointgenesis.revsz.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jointgenesis.revsz.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jointgenesis.revsz.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.stephenmoorespeaks.com
2024-07-06 11:17
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:17:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://stephenmoorespeaks.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/aq7dN>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:17:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fstephenmoorespeaks.com%2F; expires=Sat, 03 Aug 2024 11:17:46 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · snytile.com
2024-07-06 11:17
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:17:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Pingback: https://snytile.com/xmlrpc.php Link: <https://snytile.com/wp-json/>; rel="https://api.w.org/", <https://snytile.com/wp-json/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://snytile.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:17:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fsnytile.com%2F; expires=Sat, 03-Aug-2024 11:17:27 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.kattswestsidestories.com
2024-07-06 11:16
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:17:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://kattswestsidestories.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://kattswestsidestories.com/index.php?rest_route=/wp/v2/pages/66>; rel="alternate"; type="application/json", <https://kattswestsidestories.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.kseducationsolutions.com
2024-07-06 11:16
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:16:20 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://kseducationsolutions.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · thefuturistparty.tentaclekitty.com
2024-07-06 11:15
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:15:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thefuturistparty.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://thefuturistparty.com/index.php?rest_route=/wp/v2/pages/20>; rel="alternate"; type="application/json", <https://thefuturistparty.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jpb.dmo.mybluehost.me
2024-07-06 11:15
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:15:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jpb.dmo.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:15:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.licentiousnovelties.com
2024-07-06 11:15
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:15:39 GMT Server: Apache Link: <https://licentiousnovelties.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://licentiousnovelties.com/index.php?rest_route=/wp/v2/pages/73>; rel="alternate"; type="application/json", <https://licentiousnovelties.com/>; rel=shortlink Set-Cookie: mailchimp_landing_site=https%3A%2F%2Flicentiousnovelties.com%2F; expires=Sat, 03 Aug 2024 11:15:40 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:15:39 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.aclinnovations.com
2024-07-06 11:15
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:15:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Strict-Transport-Security: max-age=31536000; includeSubDomains Referrer-Policy: strict-origin-when-cross-origin X-Frame-Options: sameorigin X-Redirect-By: WordPress Location: https://aclinnovations.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:15:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tourismshark.lob.hnq.mybluehost.me
2024-07-06 11:15
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:15:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tourismshark.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:20:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_travel_session=5da2e827f7fc9b558283b0ce4f53b51f%7C%7C1720266312%7C%7C1720265952; expires=Sat, 06 Jul 2024 11:45:12 GMT; Max-Age=1800; path=/
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.asndi.org
2024-07-06 11:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:14:37 GMT Server: Apache Link: <https://www.asndi.org/wp-json/>; rel="https://api.w.org/", <https://www.asndi.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Association of Diabetes Investigators | A diabetes research organization headed by Dr. Marc Rendell <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width"> <title>Association of Diabetes Investigators | A diabetes research organization headed by Dr. Marc Rendell</title> <link rel="profile" href="http://gmpg.org/xfn/11"> <link rel="pingback" href="https://www.asndi.org/wp/xmlrpc.php"> <!--[if lt IE 9]> <script src="https://www.asndi.org/wp/wp-content/themes/twentythirteen/js/html5.js"></script> <![endif]--> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Association of Diabetes Investigators » Feed" href="https://www.asndi.org/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/12.0.0-1\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.asndi.org\/wp\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.2.21"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55357,56424,55356,57342,8205,55358,56605,8205,55357,56424,55356,57340],[55357,56424,55356,57342,8203,55358,56605,8203,55357,56424,55356,57340])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://www.asndi.org/wp/wp-includes/css/dist/block-library/style.min.css?ver=5.2.21' type='text/css' media='all' /> <link rel='stylesheet' id='twentythirteen-fonts-css' href='https://fonts.googleapis.com/css?family=Source+Sans+Pro%3A300%2C400%2C700%2C300italic%2C400italic%2C700italic%7CBitter%3A400%2C700&subset=latin%2Clatin-ext' type='text/css' media='all' /> <link rel='stylesheet' id='genericons-css' href='https://www.asndi.org/wp/wp-content/themes/twentythirteen/genericons/genericons.css?ver=3.03' type='text/css' media='all' /> <link rel='stylesheet' id='twentythirteen-style-css' href='https://www.asndi.orgFound 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.aerc.abctrader.us
2024-07-06 11:14
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:14:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aerc.abctrader.us/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:14:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.collectivesafety.com
2024-07-06 11:14
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:14:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://collectivesafety.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:19:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · jmghomeservices.com
2024-07-06 11:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:14:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:14:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: JMG Home Services — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>JMG Home Services — Coming Soon</title> <script src="https://jmghomeservices.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://jmghomeservices.com/wp-content/plugins/bluehost-wordpress-plugin/static/coming-soon.css?v=2.12.20" /> </head> <body data-rsssl=1> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>A New WordPress Site!</h1> <h2>Coming Soon!</h2> <a class="btn" href="https://jmghomeservices.com/wp-login.php"> Admin Login </a> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com/wordpress" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://jmghomeservices.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.jackmanind.com
2024-07-06 11:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:14:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jackmanind.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:19:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tourismshark.com
2024-07-06 11:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:13:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tourismshark.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:18:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_travel_session=0f3c4273b7e890d3f32b29f9cd172291%7C%7C1720266237%7C%7C1720265877; expires=Sat, 06 Jul 2024 11:43:57 GMT; Max-Age=1800; path=/
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.labellesince1919.com
2024-07-06 11:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:13:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:13:49 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04-Jul-2034 11:13:51 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://labellesince1919.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://labellesince1919.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://labellesince1919.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.elisastancil.com
2024-07-06 11:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:13:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://elisastancillevine.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:18:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=49e4f9da3f33c94c738cad274fa6c045; path=/
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.loveinclakecty.net
2024-07-06 11:13
HTTP/1.1 302 Moved Temporarily Date: Sat, 06 Jul 2024 11:13:30 GMT Server: Apache Expires: Sat, 06 Jul 2024 11:13:30 GMT Pragma: no-cache Cache-Control: no-cache, must-revalidate, maxage=0 Vary: User-Agent Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sat, 06 Jul 2024 11:13:30 GMT Location: https://loveinclakecounty.org/home/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · website-46cf2538.revsz.com
2024-07-06 11:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:13:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://reviewz.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:13:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · booksbydennis.com
2024-07-06 11:12
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:12:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 142028 Last-Modified: Sat, 06 Jul 2024 10:19:33 GMT Accept-Ranges: bytes Cache-Control: max-age=400, public, public Expires: Sat, 06 Jul 2024 11:19:33 GMT Vary: Accept-Encoding,Cookie host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Powered-By: W3 Total Cache/2.6.1 Pragma: public X-Server-Cache: true X-Proxy-Cache: MISS Page title: Children’s Author, Songwriter, Educator, Oklahoma City <!DOCTYPE html> <html lang="en-US"> <head><style>img.lazy{min-height:1px}</style><link rel="preload" href="https://booksbydennis.com/wp-content/plugins/w3-total-cache/pub/js/lazyload.min.js" as="script"> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1, minimum-scale=1"> <link rel="profile" href="https://gmpg.org/xfn/11"> <link rel="pingback" href="https://booksbydennis.com/xmlrpc.php"> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v22.7 - https://yoast.com/wordpress/plugins/seo/ --> <title>Children’s Author, Songwriter, Educator, Oklahoma City</title> <meta name="description" content="Dennis Mathew is a renowned children's author from the USA, located in Oklahoma City. He is a singer and songwriter as well and has had the honor of working with elementary and primary schools all across the United States and around the world." /> <link rel="canonical" href="https://booksbydennis.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Children’s Author, Songwriter, Educator, Oklahoma City" /> <meta property="og:description" content="Dennis Mathew is a renowned children's author from the USA, located in Oklahoma City. He is a singer and songwriter as well and has had the honor of working with elementary and primary schools all across the United States and around the world." /> <meta property="og:url" content="https://booksbydennis.com/" /> <meta property="og:site_name" content="Books by Dennis LLC" /> <meta property="article:modified_time" content="2024-04-21T17:48:12+00:00" /> <meta property="og:image" content="https://booksbydennis.com/wp-content/uploads/2021/05/DennisPic.jpg" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://booksbydennis.com/","url":"https://booksbydennis.com/","name":"Children’s Author, Songwriter, Educator, Oklahoma City","isPartOf":{"@id":"https://booksbydennis.com/#website"},"primaryImageOfPage":{"@id":"https://booksbydennis.com/#primaryimage"},"image":{"@id":"https://booksbydennis.com/#primaryimage"},"thumbnailUrl":"https://booksbydennis.com/wp-content/uploads/2021/05/DennisPic.jpg","datePublished":"2018-08-09T12:35:35+00:00","dateModified":"2024-04-21T17:48:12+00:00","description":"Dennis Mathew is a renowned children's author from the USA, located in Oklahoma City. He is a singer and songwriter as well and has had the honor of working with elementary and primary schools all across the United States and around the world.","breadcrumb":{"@id":"https://booksbydennis.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://booksbydennis.com/"]}]},{"@type":"ImageObject","inLanguage":"en-US","@id":"https://booksbydennis.com/#primaryimage","url":"https://booksbydennis.com/wp-content/uploads/2021/05/DennisPic.jpg","contentUrl":"https://booksbydennis.com/wp-content/uploads/2021/05/DennisPic.jpg"},{"@type":"BreadcrumbList","@id":"https://booksbydennis.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://booksbydennis.com/#website","url":"https://booksbydennis.com/","name":"Books by Dennis LLC","description":"children's book author","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://booksbydennis.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <meta name="google-site-verification" content="cOrW5QYgX9kfOo6VvOxkcHCqW4LlRv1SkX0wMO_xqKQ" /> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//www.googletagmanager.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Books by Dennis LLCFound 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.cid5280.com
2024-07-06 11:12
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.s3consultingsolutions.legendinx.com
2024-07-06 11:12
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:12:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://s3consultingsolutions.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:12:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.tsnpa.info
2024-07-06 11:12
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:12:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:17:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Transformative Solutions Network — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Transformative Solutions Network — Coming Soon</title> <script src="https://tsnpa.info/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://tsnpa.info/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://tsnpa.info/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.stdbfs.ja-developments.com
2024-07-06 11:11
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:11:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Standard Global <!DOCTYPE html> <html lang="en"> <head> <meta charset="UTF-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <title>Standard Global</title> <!-- css --> <link rel="icon" href="assets/img/logo azul.png"> <link rel="stylesheet" href="css/config.css"> <link rel="stylesheet" href="css/normalize.css"> <link rel="stylesheet" href="css/index.css"> <!-- unicons --> <link rel="stylesheet" href="https://unicons.iconscout.com/release/v4.0.0/css/line.css" /> </head> <body> <div class="pimg1"> <div class="ptext"> <img src="assets/img/logo.webp" class="border trans"></img> </div> </div> <main> <div class="container"> <nav> <button id="menu"> <i class="uil uil-bars"></i> Menu </button> <ul> <li><a href="index.php">Home</a></li> <li><a href="about.php">About Us</a></li> <li><a href="services.php">Services</a></li> <li><a href="process.php">The Process</a></li> <li><a href="contact.php">Contact Us</a></li> | <li><a href="login.php">Log in</a></li> <li><a href="register.php">Register</a></li> </ul> <div class="down"> <a href="#follow"><i class="uil uil-arrow-down"></i></a> </div> </nav> <section class="section"> <div class="page"> <h2>Home</h2> </div> <div class="content"> <p>Welcome to <h1>Standard Global Business & Financial Services</h1> (<strong>SG</strong>), a private limited company that offers full accounts receivable/payable management, bookkeeping, accounting and controlling and financial services.</p> <p><strong>SG</strong> is specialized in providing tailored and customized solutions for the client’s needs and requirements.</p> <p><strong>SG</strong> offers a vast array of financial solutions worldwide.</p> </div> </section> <section class="follow" id="follow"> <h2>FOLLOW US</h2> <a target="_blank" href="https://www.linkedin.com/company-beta/24772744/"><i class="uil uil-linkedin-alt"></i></a> </section> </div> </main> <!-- scripts --> <script src="js/parallax.js"></script> <script src="js/index.js"></script> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · 0ec.es
2024-07-06 11:11
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:11:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://0ec.es/wp-json/>; rel="https://api.w.org/", <https://0ec.es/wp-json/wp/v2/pages/17>; rel="alternate"; type="application/json", <https://0ec.es/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:11:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.estoagroup.com
2024-07-06 11:10
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:10:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://estoagroup.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:15:57 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== content-Security-Policy: upgrade-insecure-requests X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · pacificrimdoods.com
2024-07-06 11:10
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:10:56 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:10:56 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Pacific Rim Doods Practice — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Pacific Rim Doods Practice — Coming Soon</title> <script src="https://pacificrimdoods.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://pacificrimdoods.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://pacificrimdoods.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jerryspizza.com
2024-07-06 11:10
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:10:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jerryspizza.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:15:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · grz.wyd.mybluehost.me
2024-07-06 11:10
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:10:44 GMT Server: Apache Link: <https://biztechnd.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://biztechnd.com/index.php?rest_route=/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://biztechnd.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · softwarelibre.org.bo
2024-07-06 11:09
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:09:51 GMT Server: Apache Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.softwarelibre.org.bo/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · pastpresentpurple.com
2024-07-06 11:08
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:08:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.pastpresentpurple.com/ Cache-Control: max-age=600 Expires: Sat, 06 Jul 2024 11:18:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.pastpresentpurple.com
2024-07-06 11:08
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:08:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.pastpresentpurple.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=600 Expires: Sat, 06 Jul 2024 11:18:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.altaibalance.revsz.com
2024-07-06 11:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:07:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://altaibalance.revsz.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:07:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.discountbargainmalestrippers.com
2024-07-06 11:07
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:07:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <!DOCTYPE html> <html class="sp-html sp-is-mobile sp-seedprod sp-h-full" lang="en-US"> <head> <!-- Open Graph --> <meta property="og:url" content="https://mail.discountbargainmalestrippers.com/" /> <meta property="og:type" content="website" /> <!-- Twitter Card --> <meta name="twitter:card" content="summary" /> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <!-- Default CSS --> <link rel='stylesheet' id='seedprod-css-css' href='https://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/css/tailwind.min.css?ver=6.15.7' type='text/css' media='all' /> <link rel='stylesheet' id='seedprod-fontawesome-css' href='https://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/fontawesome/css/all.min.css?ver=6.15.7' type='text/css' media='all' /> <!-- Google Font --> <link rel="stylesheet" href="https://fonts.googleapis.com/css?family=Averia+Libre:700|Dosis:600|Open+Sans+Condensed:300|Great+Vibes:400&display=swap"> <!-- Global Styles --> <style> #sp-page{color:#FFFFFF} #sp-page .sp-header-tag-h1,#sp-page .sp-header-tag-h2,#sp-page .sp-header-tag-h3,#sp-page .sp-header-tag-h4,#sp-page .sp-header-tag-h5,#sp-page .sp-header-tag-h6{color:#FFFFFF}#sp-page h1,#sp-page h2,#sp-page h3,#sp-page h4,#sp-page h5,#sp-page h6{color:#FFFFFF; font-family:'Great Vibes';font-weight:400;font-style:normal} #sp-page a{color:#5699CC} #sp-page a:hover{color:#3780b8}#sp-page .btn{background-color:#5699CC}body{background-color:#FFFFFF !important; background-image:url('https://discountbargainmalestrippers.com/wp-content/uploads/2023/03/1000D7C9-03A3-4321-B484-22F34D2EF201_1_105_c.jpeg');} @media only screen and (max-width: 480px) { #sp-niijfv {height:60px !important;} #sp-xp7nhn {text-align:center !important;} #sp-jknss8 {height:60px !important;} .sp-headline-block-y0sc75, #sp-y0sc75, #y0sc75 {text-align:center !important;} .sp-headline-block-t95iwn, #sp-t95iwn, #t95iwn {text-align:center !important;} .sp-text-wrapper-p7ef8k, #sp-p7ef8k, #p7ef8k {text-align:left !important;} #sp-d4et4f {height:60px !important;} #sp-button-parent-q09cvl {text-align:center !important;} #sp-qkrns1 {height:60px !important;} } @media only screen and (min-width: 480px) { } </style> <!-- JS --> <script> </script> <script src="https://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/js/sp-scripts.min.js" defer></script> <script src="https://discountbargainmalestrippers.com/wp-includes/js/jquery/jquery.min.js"></script> </head> <body class="spBgcover sp-h-full sp-antialiased sp-bg-slideshow"> <div id="sp-page" class="spBgcover sp-content-4" style="background-color: rgb(255, 255, 255); background-image: url('https://discountbargainmalestrippers.com/wp-content/uploads/2023/03/1000D7C9-03A3-4321-B484-22F34D2EF201_1_105_c.jpeg'); font-family: 'Open Sans Condensed', sans-serif; font-weight: 300;"><section id="sp-ks8a8s" class="sp-el-section " style="width: 1024px; max-width: 100%; padding: 10px; border-radius: 10px;"><pre ></pre><div id="sp-vw3kvy" class="sp-el-row sm:sp-flex sp-w-full sp-m-auto sp-justify-between" style="padding: 0px; width: auto; max-width: 1000px; background-color: rgba(0, 0, 0, 0.35);"><pre ></pre><div id="sp-ovbx1s" class="sp-el-col sp-w-full " style="width: calc(100% - 0px);"><pre ></pre><style type="text/css"> #sp-ovbx1s .sp-col-top .seedprod-shape-fill {fill: undefined;} #sp-ovbx1s .sp-col-top svg {width: undefined%;height: undefinedpx;transform: translateX(-50%);} #sp-ovbx1s .sp-col-bottom .seedprod-shape-fill {fill: undefined;} #sp-ovbx1s .sp-col-bottom svg {width: undefined%;height: undefinedpx;transform: translateX(-50%);} </style><div class="sp-col-shape sp-col-top" style="z-index: 0;"><div></div></div><div class="sp-col-shape sp-col-bottom" style="z-index: 0;"><div></div></div><div id="sp-niijfv" class="sp-spacer" style="height: 12px;"></div><figure id="sp-xp7nhn" class="sp-image-wrapper sp-el-block" style=Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · gtpham.com
2024-07-06 11:07
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:08:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://gtpham.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://gtpham.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://gtpham.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · cltaerialproductions.com
2024-07-06 11:07
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:08:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cltaerialproductions.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://cltaerialproductions.com/index.php?rest_route=/wp/v2/pages/2>; rel="alternate"; type="application/json", <https://cltaerialproductions.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.loveinclakecty.net
2024-07-06 11:07
HTTP/1.1 302 Moved Temporarily Date: Sat, 06 Jul 2024 11:07:29 GMT Server: Apache Expires: Sat, 06 Jul 2024 11:07:29 GMT Pragma: no-cache Cache-Control: no-cache, must-revalidate, maxage=0 Vary: User-Agent Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Sat, 06 Jul 2024 11:07:29 GMT Location: https://loveinclakecounty.org/home/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mail.seasonedconversations.org
2024-07-06 11:06
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:06:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://seasonedconversations.org/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 11:06:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.barrelandbond.com
2024-07-06 11:06
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:06:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://barrelandbond.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:06:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.stevensweldingnd.biztechnd.com
2024-07-06 11:06
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:06:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stevensweldingnd.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:06:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · theveggieguys.net
2024-07-06 11:06
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:06:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://theveggieguys.net/index.php?rest_route=/>; rel="https://api.w.org/", <https://theveggieguys.net/index.php?rest_route=/wp/v2/pages/40>; rel="alternate"; type="application/json", <https://theveggieguys.net/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · medinetone.com
2024-07-06 11:06
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:06:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://medinetone.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://medinetone.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://medinetone.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · glutenfree-mimi.com
2024-07-06 11:06
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:06:11 GMT Server: Apache Link: <https://glutenfree-mimi.com/wp-json/>; rel="https://api.w.org/", <https://glutenfree-mimi.com/wp-json/wp/v2/pages/80>; rel="alternate"; type="application/json", <https://glutenfree-mimi.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.missinformed.blog
2024-07-06 11:06
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:06:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bellcreativeco.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:06:10 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.pii.abctrader.us
2024-07-06 11:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:06:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://pii.abctrader.us/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:06:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · cedarwoodfarmstead.com
2024-07-06 11:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:05:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://cedarwoodfarmstead.com/wp-json/>; rel="https://api.w.org/", <https://cedarwoodfarmstead.com/wp-json/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://cedarwoodfarmstead.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 11:10:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.eruns.co
2024-07-06 11:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:05:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://eruns.co/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:05:46 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tetradevelopment.guidingpc.com
2024-07-06 11:04
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:04:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tetradevelopment.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:04:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · myrealtormonica.com
2024-07-06 11:02
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 11:02:22 GMT Server: Apache Link: <https://myrealtormonica.com/wp-json/>; rel="https://api.w.org/", <https://myrealtormonica.com/wp-json/wp/v2/pages/2>; rel="alternate"; type="application/json", <https://myrealtormonica.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 13:02:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.seasonedconversations.org
2024-07-06 11:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:00:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://seasonedconversations.org/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 11:00:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.davolynindustries.com
2024-07-06 11:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 11:00:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://davolynindustries.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.marmabotanica.sc-hosts.com
2024-07-06 10:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:58:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marmabotanica.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:58:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · rtrdumpsters.com
2024-07-06 10:54
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:54:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://rtrdumpsters.com/wp-json/>; rel="https://api.w.org/", <https://rtrdumpsters.com/wp-json/wp/v2/pages/13>; rel="alternate"; type="application/json", <https://rtrdumpsters.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:54:50 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.jlbccommunityalliance.com
2024-07-06 10:54
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:54:26 GMT Server: Apache P3P: CP="ALL DSP NID CURa ADMa DEVa HISa OTPa OUR NOR NAV DEM" X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://jlbccommunityalliance.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:54:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · estonishingevenings.com
2024-07-06 10:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:53:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.estonishingevenings.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:58:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · perfectioncleaningnc.com
2024-07-06 10:53
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:53:14 GMT Server: Apache Link: <https://perfectioncleaningnc.com/wp-json/>; rel="https://api.w.org/", <https://perfectioncleaningnc.com/wp-json/wp/v2/pages/19>; rel="alternate"; type="application/json", <https://perfectioncleaningnc.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.perfectioncleaningnc.com
2024-07-06 10:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:53:06 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://perfectioncleaningnc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · thephotographybite.com
2024-07-06 10:53
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:53:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thephotographybite.com/wp-json/>; rel="https://api.w.org/", <https://thephotographybite.com/wp-json/wp/v2/pages/766>; rel="alternate"; type="application/json", <https://thephotographybite.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:53:08 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · thephotographybite.wan.vec.mybluehost.me
2024-07-06 10:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:53:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thephotographybite.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:53:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.cbrimprovementstrategies.com
2024-07-06 10:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:53:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://cbrimprovementstrategies.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:58:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.settingsbyheidi.com
2024-07-06 10:52
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:52:56 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://settingsbyheidi.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:52:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.beeseengearpromo.com
2024-07-06 10:52
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:52:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://beeseengear.com/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 10:52:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · addicteddopeness.com
2024-07-06 10:51
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:51:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://addicteddopeness.com/wp-json/>; rel="https://api.w.org/", <https://addicteddopeness.com/wp-json/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://addicteddopeness.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:56:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.octometal.com
2024-07-06 10:51
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:51:44 GMT Server: Apache Link: <https://octometal.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://octometal.com/index.php?rest_route=/wp/v2/pages/5>; rel="alternate"; type="application/json", <https://octometal.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:56:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ipr.org.pk
2024-07-06 10:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:51:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://ipr.org.pk/xmlrpc.php X-Redirect-By: WordPress Location: https://ipr.org.pk/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:56:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.riq.mrn.mybluehost.me
2024-07-06 10:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:51:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://npo-qa.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:51:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 2 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.stevensweldingnd.com
2024-07-06 10:50
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:50:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stevensweldingnd.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:50:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.westernlottoandbet.com
2024-07-06 10:48
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:48:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://westernlottoandbet.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:53:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.glucodyn.revsz.com
2024-07-06 10:47
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · calmingwavesofbakersfield.legendinx.com
2024-07-06 10:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:47:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://calmingwavesofbakersfield.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:47:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · s3consultingsolutions.legendinx.com
2024-07-06 10:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:47:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://s3consultingsolutions.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:47:55 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · barrelandbond.com
2024-07-06 10:47
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:47:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://barrelandbond.com/wp-json/>; rel="https://api.w.org/", <https://barrelandbond.com/wp-json/wp/v2/pages/17>; rel="alternate"; type="application/json", <https://barrelandbond.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:47:31 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.lakecountryarts.org
2024-07-06 10:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:46:34 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://lakecountryarts.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.guidingpc.com
2024-07-06 10:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:44:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://guidingpc.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:44:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · bakingforcompliments.writeeditcopy.com
2024-07-06 10:44
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:44:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:44:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Baking for Compliments — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Baking for Compliments — Coming Soon</title> <script src="https://bakingforcompliments.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bakingforcompliments.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bakingforcompliments.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.janacharvat.com
2024-07-06 10:42
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:43:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://janacharvat.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:43:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.kinseycre.com
2024-07-06 10:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:42:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Last-Modified: Sat, 06 Jul 2024 04:51:12 GMT Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 10:42:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · snowteethwhitening.revsz.com
2024-07-06 10:41
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:41:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://snowteethwhitening.revsz.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://snowteethwhitening.revsz.com/index.php?rest_route=/wp/v2/pages/8>; rel="alternate"; type="application/json", <https://snowteethwhitening.revsz.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: How To Get A Million Dollar Smile <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>How To Get A Million Dollar Smile</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://snowteethwhitening.revsz.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://snowteethwhitening.revsz.com/wp-content/themes/the_deadbeat_theme/js/html5.js" type="text/javascript"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Snow Teeth Whitening » Feed" href="https://snowteethwhitening.revsz.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Snow Teeth Whitening » Comments Feed" href="https://snowteethwhitening.revsz.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/snowteethwhitening.revsz.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jlbccommunityalliance.com
2024-07-06 10:40
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:40:36 GMT Server: Apache P3P: CP="ALL DSP NID CURa ADMa DEVa HISa OTPa OUR NOR NAV DEM" X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://jlbccommunityalliance.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:40:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · synapsesmedicals.medinetone.com
2024-07-06 10:40
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:40:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.synapsesmedicals.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:40:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.website-c2d5f655.afreshlifego.com
2024-07-06 10:40
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:40:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:40:11 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: EB5.ABCTrader.US — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>EB5.ABCTrader.US — Coming Soon</title> <script src="https://eb5.abctrader.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://eb5.abctrader.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://eb5.abctrader.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · handstoheartcpr.net
2024-07-06 10:36
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:36:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://handstoheartcpr.net/wp-json/>; rel="https://api.w.org/", <https://handstoheartcpr.net/wp-json/wp/v2/pages/23>; rel="alternate"; type="application/json", <https://handstoheartcpr.net/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:36:32 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.stephanieferrara.com
2024-07-06 10:36
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:36:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stephanieferrara.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:36:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Vary: User-Agent X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.nen.jgp.mybluehost.me
2024-07-06 10:29
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:29:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://www.fishfacepublishing.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:34:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.nsx.zgu.mybluehost.me
2024-07-06 10:28
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:28:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://naturaljunkie.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.jpb.dmo.mybluehost.me
2024-07-06 10:26
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:26:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jpb.dmo.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:26:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.fuerzapublishinghouse.blog
2024-07-06 10:20
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:20:59 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://fuerzapublishinghouse.blog/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · lilliquistforbellingham.taradactyldesign.com
2024-07-06 10:18
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:18:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.lilliquistforbellingham.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:18:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · marmabotanica.com
2024-07-06 10:15
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:15:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://marmabotanica.com/wp-json/>; rel="https://api.w.org/", <https://marmabotanica.com/wp-json/wp/v2/pages/475>; rel="alternate"; type="application/json", <https://marmabotanica.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:15:53 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · therealandthereckoned-com.alisonmeliahphotography.com
2024-07-06 10:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:14:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://therealandthereckoned.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:14:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · coinhardwareglobal.com
2024-07-06 10:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:14:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://coinhardwareglobal.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:14:02 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.vitalflow.revsz.com
2024-07-06 10:11
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:11:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://vitalflow.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.childfundpoliticas.elaticogt.com
2024-07-06 10:11
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:11:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://childfundpoliticas.elaticogt.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:11:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · anderson4bellingham.taradactyldesign.com
2024-07-06 10:10
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:10:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://anderson4bellingham.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:10:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.myempoweringlife.com
2024-07-06 10:09
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:09:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests; Location: https://myempoweringlife.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:14:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.licentiousnovelties.com
2024-07-06 10:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:07:30 GMT Server: Apache X-Redirect-By: WordPress Set-Cookie: mailchimp_landing_site=https%3A%2F%2Flicentiousnovelties.com%2F; expires=Sat, 03 Aug 2024 10:07:36 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Upgrade: h2,h2c Connection: Upgrade, close Location: https://licentiousnovelties.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:07:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.workingtheimage.com
2024-07-06 10:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:07:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://workingtheimage.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:07:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.nervedefend.revsz.com
2024-07-06 10:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:04:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nervedefend.revsz.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:03:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tourismshark.lob.hnq.mybluehost.me
2024-07-06 10:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:03:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tourismshark.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:08:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_travel_session=7fbb3cbff30e08e0b44944b3d386934c%7C%7C1720262038%7C%7C1720261678; expires=Sat, 06 Jul 2024 10:33:58 GMT; Max-Age=1800; path=/
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.summaries.wiki
2024-07-06 10:03
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:03:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://summaries.wiki/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 12:03:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.chinesecolorcode.com
2024-07-06 10:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:00:49 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://chinesecolorcode.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.picare-ai.jcq.gxm.mybluehost.me
2024-07-06 10:00
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 10:00:19 GMT Server: Apache cf-edge-cache: cache,platform=wordpress Link: <https://picare.ai/index.php?rest_route=/>; rel="https://api.w.org/", <https://picare.ai/index.php?rest_route=/wp/v2/pages/7>; rel="alternate"; type="application/json", <https://picare.ai/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.sempermd.com
2024-07-06 10:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 10:00:02 GMT Server: Apache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://sempermd.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.thekicc.com
2024-07-06 09:59
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:59:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thekicc.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:59:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.bakerblogger.com
2024-07-06 09:59
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:59:49 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bakerblogger.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:59:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 09:59:47 GMT; Max-Age=315360000; path=/
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.abmtahid.com
2024-07-06 09:59
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:59:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://abmtahid.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:59:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · countrywidecoffee.com
2024-07-06 09:59
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:59:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://countrywidecoffee.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://countrywidecoffee.com/index.php?rest_route=/wp/v2/pages/8>; rel="alternate"; type="application/json", <https://countrywidecoffee.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:59:16 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.website-4c610ce3.revsz.com
2024-07-06 09:59
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:59:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:59:17 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: onlined.org — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>onlined.org — Coming Soon</title> <script src="http://onlined.org/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://onlined.org/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://onlined.org/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.prodentim.revsz.com
2024-07-06 09:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:59:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://prodentim.revsz.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:59:02 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mail.reviewz.org
2024-07-06 09:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:58:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://reviewz.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:58:58 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.gloryartglass.net
2024-07-06 09:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:58:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://gloryartglass.net/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · guatech.online
2024-07-06 09:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:58:45 GMT Server: Apache Link: <https://guatech.online/index.php?rest_route=/>; rel="https://api.w.org/", <https://guatech.online/index.php?rest_route=/wp/v2/pages/22>; rel="alternate"; type="application/json", <https://guatech.online/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.omargonzalezphotography.com
2024-07-06 09:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:58:35 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.omargonzalezphotography.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.website-43b8d4cd.legendinx.com
2024-07-06 09:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:58:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sterlinghard1.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:58:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.marchostetter.com
2024-07-06 09:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:58:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://marchostetter.com/ Cache-Control: max-age=28800 Expires: Sat, 06 Jul 2024 17:58:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.carvengineering.com
2024-07-06 09:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:58:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://carvengineering.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:58:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.olivine.revsz.com
2024-07-06 09:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:57:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://olivine.revsz.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:57:56 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · davolynindustries.davolynindustries.com
2024-07-06 09:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:57:45 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kneesaverpooltool.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ocd5280.cid5280.com
2024-07-06 09:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:57:14 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ocd5280.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:57:14 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · pinmeuputah.com
2024-07-06 09:56
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:57:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type,User-Agent X-Redirect-By: WordPress Location: https://www.pinmeuputah.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 10:01:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: is_mobile=1; path=/; domain=pinmeuputah.com
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.originaldemolition.com
2024-07-06 09:56
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:56:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://originaldemolition.com/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 09:56:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · keravitapro.revsz.com
2024-07-06 09:56
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:56:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://keravitapro.revsz.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://keravitapro.revsz.com/index.php?rest_route=/wp/v2/pages/10>; rel="alternate"; type="application/json", <https://keravitapro.revsz.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: I would have never thought that a fungus infested nail, would lead to my dad’s leg being amputated… <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>I would have never thought that a fungus infested nail, would lead to my dad’s leg being amputated…</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://keravitapro.revsz.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://keravitapro.revsz.com/wp-content/themes/the_deadbeat_theme/js/html5.js" type="text/javascript"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Keravita Pro » Feed" href="https://keravitapro.revsz.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Keravita Pro » Comments Feed" href="https://keravitapro.revsz.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/keravitapro.revsz.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExcFound 3 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.reviewz.org
2024-07-06 09:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:51:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://reviewz.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:51:12 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · myhappyhealthyhome.madsenadvertising.com
2024-07-06 09:51
HTTP/1.1 302 Found Date: Sat, 06 Jul 2024 09:51:07 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.herpesyl.revsz.com
2024-07-06 09:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:51:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://herpesyl.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · website-8e250bc2.legendinx.com
2024-07-06 09:49
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:49:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stridechamps.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:49:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.flexotone.revsz.com
2024-07-06 09:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:45:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://flexotone.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.anitalahey.com
2024-07-06 09:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:44:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://anitalahey.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:49:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.discountbargainmalestrippers.com
2024-07-06 09:41
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:41:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://discountbargainmalestrippers.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:41:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.oliviaf17-sg-host-com.cid5280.com
2024-07-06 09:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:39:39 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://oliviaf17.sg-host.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:39:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.unicoach.com
2024-07-06 09:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:39:23 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.unicoach.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:39:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.thephotographybite.com
2024-07-06 09:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:39:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thephotographybite.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:39:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.perfectioncleaningnc.com
2024-07-06 09:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:39:10 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://perfectioncleaningnc.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · protectingpollinators.org
2024-07-06 09:37
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:37:50 GMT Server: Apache X-Pingback: http://protectingpollinators.org/xmlrpc.php Link: <http://protectingpollinators.org/index.php/wp-json/>; rel="https://api.w.org/", <http://protectingpollinators.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · idealinversiones.com
2024-07-06 09:37
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:37:33 GMT Server: Apache Link: <https://idealinversiones.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://idealinversiones.com/index.php?rest_route=/wp/v2/pages/146>; rel="alternate"; type="application/json", <https://idealinversiones.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · sim-tel-com-au.freeautoelectrician.com.au
2024-07-06 09:37
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:37:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.sim-tel.com.au/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:37:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · neufeldmissions.com
2024-07-06 09:36
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:36:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://neufeldmissions.com/wp-json/>; rel="https://api.w.org/", <https://neufeldmissions.com/wp-json/wp/v2/pages/42>; rel="alternate"; type="application/json", <https://neufeldmissions.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · xlt.ddq.mybluehost.me
2024-07-06 09:36
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:36:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Vary: accept,content-type,Accept-Encoding Link: <https://oneflymama.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/cS3hS>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:41:25 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · sheilasinspiredlife.com
2024-07-06 09:36
HTTP/1.1 500 Internal Server Error Date: Sat, 06 Jul 2024 09:36:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Connection: close Transfer-Encoding: chunked Page title: WordPress › Error <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='max-image-preview:large, noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.stefanieharrington.com
2024-07-06 09:36
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:36:17 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-ProPhoto-Cache: MISS Content-Security-Policy: upgrade-insecure-requests X-Redirect-By: WordPress Location: https://www.stefanieharrington.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.rsmrf.com
2024-07-06 09:35
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:35:22 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://rsmrf.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · teamworkcares.com
2024-07-06 09:35
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:35:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://teamworkcares.com/wp-json/>; rel="https://api.w.org/", <https://teamworkcares.com/wp-json/wp/v2/pages/48>; rel="alternate"; type="application/json", <https://teamworkcares.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:35:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.promedverify.com
2024-07-06 09:35
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:35:20 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://promedverify.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:35:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · alttransit.edianecapital.com
2024-07-06 09:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:32:42 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://alttransit.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alttransit.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alttransit.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · myhappyhealthyhome.com
2024-07-06 09:31
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:31:16 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 <html> <head> <meta name="robots" content="noarchive" /> <meta name="googlebot" content="nosnippet" /> </head> <body> <div align=center> <h3>Error. Page cannot be displayed. Please contact your service provider for more details. (26)</h3> <!--- 162.241.252.95---> </div> </body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · cbdiemorganics.com
2024-07-06 09:27
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:27:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.cbdiemorganics.com/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 09:27:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · stoppsychiatricprofiling.org
2024-07-06 09:23
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:23:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://www.stoppsychiatricprofiling.org/xmlrpc.php X-Redirect-By: WordPress Location: https://www.stoppsychiatricprofiling.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:28:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · hvacunionnj.simplywebseo.com
2024-07-06 09:22
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:23:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hvacunionnj.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:22:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · workingtheimage.writeeditcopy.com
2024-07-06 09:18
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:18:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://workingtheimage.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:18:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.gotogordoncomputers.com
2024-07-06 09:18
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:18:15 GMT Server: Apache X-Pingback: https://gotogordoncomputers.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://gotogordoncomputers.com/ Cache-Control: max-age=3600 Expires: Sat, 06 Jul 2024 10:18:15 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.ravagolawgroup.com
2024-07-06 09:18
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:18:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ravagolawgroup.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:18:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Tue, 04-Jul-2034 09:18:13 GMT; Max-Age=315360000; path=/
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.cbdiemorganics.com
2024-07-06 09:18
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:18:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://www.cbdiemorganics.com/wp-json/>; rel="https://api.w.org/", <https://www.cbdiemorganics.com/wp-json/wp/v2/pages/6749>; rel="alternate"; type="application/json", <https://www.cbdiemorganics.com/>; rel=shortlink Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 09:18:04 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · davolynindustries.com
2024-07-06 09:15
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:15:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://davolynindustries.com/wp-json/>; rel="https://api.w.org/", <https://davolynindustries.com/wp-json/wp/v2/pages/17>; rel="alternate"; type="application/json", <https://davolynindustries.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · glucofort.revsz.com
2024-07-06 09:14
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:14:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://glucofort.revsz.com/wp-json/>; rel="https://api.w.org/", <https://glucofort.revsz.com/wp-json/wp/v2/pages/42>; rel="alternate"; type="application/json", <https://glucofort.revsz.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:14:19 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.gnx.ubp.mybluehost.me
2024-07-06 09:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:13:14 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:13:14 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://gnx.ubp.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://gnx.ubp.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://gnx.ubp.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · kaizenmagic.com
2024-07-06 09:09
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:09:25 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://kaizenmagic.com/wp-json/>; rel="https://api.w.org/", <https://kaizenmagic.com/wp-json/wp/v2/pages/8>; rel="alternate"; type="application/json", <https://kaizenmagic.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:09:23 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.thesoyemigroup.soyemi.com
2024-07-06 09:08
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:08:40 GMT Server: Apache Link: <https://soyemi.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · crpdcourse-org.aka.auj.mybluehost.me
2024-07-06 09:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:07:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://crpdcourse.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:12:52 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tribalmerch.whoisduck.com
2024-07-06 09:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:05:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tribalmerch.whoisduck.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:05:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · binkleystore.binkleystore.com
2024-07-06 09:04
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:05:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://binkleystore.binkleystore.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://binkleystore.binkleystore.com/index.php?rest_route=/wp/v2/pages/31>; rel="alternate"; type="application/json", <https://binkleystore.binkleystore.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:09:59 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.alimeliah.com
2024-07-06 09:03
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:03:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <http://www.alimeliah.com/wp-json/>; rel="https://api.w.org/", <http://www.alimeliah.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Olympia + Tacoma Photographer | Ali Meliah Photography <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <link rel="pingback" href="http://www.alimeliah.com/xmlrpc.php" /> <script type="text/javascript"> document.documentElement.className = 'js'; </script> <script>var et_site_url='http://www.alimeliah.com';var et_post_id='8';function et_core_page_resource_fallback(a,b){"undefined"===typeof b&&(b=a.sheet.cssRules&&0===a.sheet.cssRules.length);b&&(a.onerror=null,a.onload=null,a.href?a.href=et_site_url+"/?et_core_page_resource="+a.id+et_post_id:a.src&&(a.src=et_site_url+"/?et_core_page_resource="+a.id+et_post_id))} </script><title>Olympia + Tacoma Photographer | Ali Meliah Photography</title> <meta name='robots' content='noindex,follow' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Olympia + Tacoma Photographer » Feed" href="http://www.alimeliah.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Olympia + Tacoma Photographer » Comments Feed" href="http://www.alimeliah.com/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"http:\/\/www.alimeliah.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.26"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <meta content="Divi v.3.17.2" name="generator"/><style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='divi-style-css' href='http://www.alimeliah.com/wp-content/themes/Divi/style.css?ver=3.17.2' type='text/css' media='all' /> <link rel='stylesheet' id='et-builder-googlefonts-cached-css' href='http://fonts.googleapis.com/css?family=Shrikhand%3Aregular%7CLato%3A100%2C100italic%2C300%2C300italic%2Cregular%2Citalic%2C700%2C700italic%2C900%2C900italic%7CMontserrat%3A100%2C100italic%2C200%2C200italic%2C300%2C300italic%2Cregular%2Citalic%2C500%Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mail.kseducationsolutions.com
2024-07-06 09:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:03:33 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: http://kseducationsolutions.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.bakingforcompliments.writeeditcopy.com
2024-07-06 09:03
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:03:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:03:30 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Baking for Compliments — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Baking for Compliments — Coming Soon</title> <script src="https://bakingforcompliments.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://bakingforcompliments.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://bakingforcompliments.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.karelwalle.com
2024-07-06 09:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:03:30 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://karelwalle.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:08:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · spinalforce.revsz.com
2024-07-06 09:03
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · flatbin.com
2024-07-06 09:03
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:03:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hatvisuals.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:03:19 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · discountbargainmalestrippers.taradactyldesign.com
2024-07-06 09:02
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:03:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <!DOCTYPE html> <html class="sp-html sp-is-mobile sp-seedprod sp-h-full" lang="en-US"> <head> <!-- Open Graph --> <meta property="og:url" content="http://discountbargainmalestrippers.taradactyldesign.com/" /> <meta property="og:type" content="website" /> <!-- Twitter Card --> <meta name="twitter:card" content="summary" /> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <!-- Default CSS --> <link rel='stylesheet' id='seedprod-css-css' href='http://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/css/tailwind.min.css?ver=6.15.7' type='text/css' media='all' /> <link rel='stylesheet' id='seedprod-fontawesome-css' href='http://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/fontawesome/css/all.min.css?ver=6.15.7' type='text/css' media='all' /> <!-- Google Font --> <link rel="stylesheet" href="https://fonts.googleapis.com/css?family=Averia+Libre:700|Dosis:600|Open+Sans+Condensed:300|Great+Vibes:400&display=swap"> <!-- Global Styles --> <style> #sp-page{color:#FFFFFF} #sp-page .sp-header-tag-h1,#sp-page .sp-header-tag-h2,#sp-page .sp-header-tag-h3,#sp-page .sp-header-tag-h4,#sp-page .sp-header-tag-h5,#sp-page .sp-header-tag-h6{color:#FFFFFF}#sp-page h1,#sp-page h2,#sp-page h3,#sp-page h4,#sp-page h5,#sp-page h6{color:#FFFFFF; font-family:'Great Vibes';font-weight:400;font-style:normal} #sp-page a{color:#5699CC} #sp-page a:hover{color:#3780b8}#sp-page .btn{background-color:#5699CC}body{background-color:#FFFFFF !important; background-image:url('https://discountbargainmalestrippers.com/wp-content/uploads/2023/03/1000D7C9-03A3-4321-B484-22F34D2EF201_1_105_c.jpeg');} @media only screen and (max-width: 480px) { #sp-niijfv {height:60px !important;} #sp-xp7nhn {text-align:center !important;} #sp-jknss8 {height:60px !important;} .sp-headline-block-y0sc75, #sp-y0sc75, #y0sc75 {text-align:center !important;} .sp-headline-block-t95iwn, #sp-t95iwn, #t95iwn {text-align:center !important;} .sp-text-wrapper-p7ef8k, #sp-p7ef8k, #p7ef8k {text-align:left !important;} #sp-d4et4f {height:60px !important;} #sp-button-parent-q09cvl {text-align:center !important;} #sp-qkrns1 {height:60px !important;} } @media only screen and (min-width: 480px) { } </style> <!-- JS --> <script> </script> <script src="http://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/js/sp-scripts.min.js" defer></script> <script src="http://discountbargainmalestrippers.com/wp-includes/js/jquery/jquery.min.js"></script> </head> <body class="spBgcover sp-h-full sp-antialiased sp-bg-slideshow"> <div id="sp-page" class="spBgcover sp-content-4" style="background-color: rgb(255, 255, 255); background-image: url('https://discountbargainmalestrippers.com/wp-content/uploads/2023/03/1000D7C9-03A3-4321-B484-22F34D2EF201_1_105_c.jpeg'); font-family: 'Open Sans Condensed', sans-serif; font-weight: 300;"><section id="sp-ks8a8s" class="sp-el-section " style="width: 1024px; max-width: 100%; padding: 10px; border-radius: 10px;"><pre ></pre><div id="sp-vw3kvy" class="sp-el-row sm:sp-flex sp-w-full sp-m-auto sp-justify-between" style="padding: 0px; width: auto; max-width: 1000px; background-color: rgba(0, 0, 0, 0.35);"><pre ></pre><div id="sp-ovbx1s" class="sp-el-col sp-w-full " style="width: calc(100% - 0px);"><pre ></pre><style type="text/css"> #sp-ovbx1s .sp-col-top .seedprod-shape-fill {fill: undefined;} #sp-ovbx1s .sp-col-top svg {width: undefined%;height: undefinedpx;transform: translateX(-50%);} #sp-ovbx1s .sp-col-bottom .seedprod-shape-fill {fill: undefined;} #sp-ovbx1s .sp-col-bottom svg {width: undefined%;height: undefinedpx;transform: translateX(-50%);} </style><div class="sp-col-shape sp-col-top" style="z-index: 0;"><div></div></div><div class="sp-col-shape sp-col-bottom" style="z-index: 0;"><div></div></div><div id="sp-niijfv" class="sp-spacer" style="height: 12px;"></div><figure id="sp-xp7nhn" class="sp-image-wrapper sp-el-block"Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.theheartofbehavior.com
2024-07-06 09:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:02:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://theheartofbehavior.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:07:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · abserv.com
2024-07-06 09:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:02:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ameybusiness.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:07:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.sincerelymemoona.com
2024-07-06 09:02
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:02:26 GMT Server: Apache X-UA-Compatible: IE=edge Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Sincerely Memoona! — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Sincerely Memoona! — Coming Soon</title> <script src="https://sincerelymemoona.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://sincerelymemoona.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://sincerelymemoona.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · tetrasteelworx.com
2024-07-06 09:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:01:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tetrasteelworx.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:01:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.bmwdiys.myempoweringlife.com
2024-07-06 09:01
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.familyburton.com
2024-07-06 09:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:00:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://familyburton.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:00:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tetrasteelworx.guidingpc.com
2024-07-06 09:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 09:00:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tetrasteelworx.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 11:00:33 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · socialpri.me
2024-07-06 09:00
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 09:00:27 GMT Server: Apache X-Pingback: https://socialpri.me/xmlrpc.php Link: <https://socialpri.me/wp-json/>; rel="https://api.w.org/", <https://socialpri.me/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:05:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.kingsklosetny.com
2024-07-06 08:59
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:59:53 GMT Server: Apache X-Pingback: https://kingsklosetny.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kingsklosetny.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mail.mclaincounseling.com
2024-07-06 08:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:58:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: McLain Counseling LLC — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>McLain Counseling LLC — Coming Soon</title> <script src="http://mclaincounseling.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://mclaincounseling.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://mclaincounseling.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · nervecontrol911.revsz.com
2024-07-06 08:58
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.p23.org
2024-07-06 08:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:58:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://p23.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:03:42 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · texasstylerv.heatherandthedogs.com
2024-07-06 08:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:58:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-cache Link: <https://texasstylerv.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:58:47 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.klorrainesalon.com
2024-07-06 08:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:58:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://klorrainesalon.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:03:41 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=27267235579f0f080e7a791a5b1b47c1; path=/
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.healthmediapolicy.com
2024-07-06 08:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:58:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://healthmediapolicy.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:58:36 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · curafen.revsz.com
2024-07-06 08:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:58:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://curafen.revsz.com/wp-json/>; rel="https://api.w.org/", <https://curafen.revsz.com/wp-json/wp/v2/pages/12>; rel="alternate"; type="application/json", <https://curafen.revsz.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:03:21 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · jerryspizza.com
2024-07-06 08:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:58:11 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://jerryspizza.com/wp-json/>; rel="https://api.w.org/", <https://jerryspizza.com/wp-json/wp/v2/pages/22>; rel="alternate"; type="application/json", <https://jerryspizza.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:03:09 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.innersherpa.life
2024-07-06 08:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:58:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:58:06 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Inner Sherpa — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Inner Sherpa — Coming Soon</title> <script src="https://innersherpa.life/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://innersherpa.life/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://innersherpa.life/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · greenwayoffice.com
2024-07-06 08:58
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:58:03 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.greenwayoffice.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.0ec.es
2024-07-06 08:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:57:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://0ec.es/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:57:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.lilliquistforbellingham.com
2024-07-06 08:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:57:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.lilliquistforbellingham.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:57:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.ladowellphotography.com
2024-07-06 08:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:57:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://ladowellphotography.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 09:02:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.virtuallykari.com
2024-07-06 08:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:57:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://virtuallykari.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:57:28 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=d4dc9da08e70f55d5fb670e856ca09d5; path=/
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.absoluteprohibition-org.aka.auj.mybluehost.me
2024-07-06 08:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:57:15 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Location: https://www.absoluteprohibition.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ferraralimited.com
2024-07-06 08:57
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:57:11 GMT Server: Apache Cache-Control: no-cache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://empoweredcreativitycoach.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Vary: User-Agent Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.mosaiclanguageservices.znt.nmp.mybluehost.me
2024-07-06 08:56
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:56:50 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://mosaiclanguageservices.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:56:47 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.aguadelavillahn.com
2024-07-06 08:54
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:54:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://aguadelavillahn.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · eurekalearning-ca.oiv.qwy.mybluehost.me
2024-07-06 08:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:53:12 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eurekalearning.ca/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.eurekalearning.ca
2024-07-06 08:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:53:11 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eurekalearning.ca/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.eurekalearning.ca
2024-07-06 08:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:53:09 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://eurekalearning.ca/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mail.crpdcourse.org
2024-07-06 08:52
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:52:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://crpdcourse.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:57:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.switchcraftelectric.com
2024-07-06 08:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:51:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: http://switchcraftelectric.com/xmlrpc.php X-Redirect-By: WordPress Location: https://switchcraftelectric.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:51:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · stephanieferrara.empoweredcreativitycoach.com
2024-07-06 08:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:51:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stephanieferrara.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:51:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Vary: User-Agent X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 4 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.settingsbyheidi.com
2024-07-06 08:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:51:08 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://settingsbyheidi.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:51:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · megapowerantigua.com
2024-07-06 08:51
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:51:09 GMT Server: Apache Vary: Accept-Encoding,Cookie Cache-Control: max-age=3, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Content-Length: 144803 Last-Modified: Sat, 06 Jul 2024 08:26:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Content-Type: text/html; charset=UTF-8 Page title: Cars for Sale: Electric Vehicles, New & Used | Megapower Antigua <!doctype html><html lang="en-GB"><head><meta charset="UTF-8"><meta name="viewport" content="width=device-width, initial-scale=1"><link rel="profile" href="http://gmpg.org/xfn/11"><link rel="pingback" href="https://megapowerantigua.com/xmlrpc.php"><meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <script>window._wca = window._wca || [];</script> <link media="all" href="https://megapowerantigua.com/wp-content/cache/autoptimize/css/autoptimize_49c752d458dc85e4ea8a5d622da897a5.css" rel="stylesheet" /><title>Cars for Sale: Electric Vehicles, New & Used | Megapower Antigua</title><meta name="description" content="Authorised electric vehicle dealer in Antigua. New & used electric cars for sale. SUVs, vans & motorbikes. Servicing & repairs by certified EV technicians." /><link rel="canonical" href="https://megapowerantigua.com/" /><meta property="og:locale" content="en_GB" /><meta property="og:type" content="website" /><meta property="og:title" content="Cars for Sale: Electric Vehicles, New & Used | Megapower Antigua" /><meta property="og:description" content="Authorised electric vehicle dealer in Antigua. New & used electric cars for sale. SUVs, vans & motorbikes. Servicing & repairs by certified EV technicians." /><meta property="og:url" content="https://megapowerantigua.com/" /><meta property="og:site_name" content="Megapower Antigua" /><meta property="article:publisher" content="https://www.facebook.com/MegapowerAntigua/" /><meta property="article:modified_time" content="2024-03-05T01:18:14+00:00" /><meta property="og:image" content="https://megapowerantigua.com/wp-content/uploads/2022/05/saic-mg-motor-mg-zs-ev-2021-011-min.png" /><meta property="og:image:width" content="1500" /><meta property="og:image:height" content="750" /><meta property="og:image:type" content="image/png" /><meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://megapowerantigua.com/","url":"https://megapowerantigua.com/","name":"Cars for Sale: Electric Vehicles, New & Used | Megapower Antigua","isPartOf":{"@id":"https://megapowerantigua.com/#website"},"about":{"@id":"https://megapowerantigua.com/#organization"},"primaryImageOfPage":{"@id":"https://megapowerantigua.com/#primaryimage"},"image":{"@id":"https://megapowerantigua.com/#primaryimage"},"thumbnailUrl":"https://i0.wp.com/megapowerantigua.com/wp-content/uploads/2022/05/saic-mg-motor-mg-zs-ev-2021-011-min.png?fit=1500%2C750&ssl=1","datePublished":"2020-02-18T22:14:41+00:00","dateModified":"2024-03-05T01:18:14+00:00","description":"Authorised electric vehicle dealer in Antigua. New & used electric cars for sale. SUVs, vans & motorbikes. Servicing & repairs by certified EV technicians.","breadcrumb":{"@id":"https://megapowerantigua.com/#breadcrumb"},"inLanguage":"en-GB","potentialAction":[{"@type":"ReadAction","target":["https://megapowerantigua.com/"]}]},{"@type":"ImageObject","inLanguage":"en-GB","@id":"https://megapowerantigua.com/#primaryimage","url":"https://i0.wp.com/megapowerantigua.com/wp-content/uploads/2022/05/saic-mg-motor-mg-zs-ev-2021-011-min.png?fit=1500%2C750&ssl=1","contentUrl":"https://i0.wp.com/megapowerantigua.com/wp-content/uploads/2022/05/saic-mg-motor-mg-zs-ev-2021-011-min.png?fit=1500%2C750&ssl=1","width":1500,"height":750,"caption":"Grey MG ZS EV"},{"@type":"BreadcrumbList","@id":"https://megapowerantigua.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"https://megapowerantigua.com/#website","url":"https://megapowerantigua.com/","name":"Megapower Antigua","description":"Cars for Sale | Electric Vehicles | Used Cars","publisher":{"@id":"https://megapowerantigua.com/#organization"},"potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://megapowerantigua.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ammaarquitectura.com
2024-07-06 08:49
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:49:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Cache-Enabled: False Link: <https://ammaarquitectura.com/wp-json/>; rel="https://api.w.org/", <https://ammaarquitectura.com/wp-json/wp/v2/pages/17>; rel="alternate"; type="application/json", <https://ammaarquitectura.com/>; rel=shortlink Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Próximamente <!DOCTYPE html> <html lang="es"> <head> <meta charset="UTF-8" /> <title>Próximamente</title> <meta name="viewport" content="width=device-width, maximum-scale=1, initial-scale=1, minimum-scale=1"> <meta name="description" content=""/> <meta http-equiv="X-UA-Compatible" content="" /> <meta property="og:site_name" content="Rehabilitación de Edificios, Sostenibilidad e Inversiones - "/> <meta property="og:title" content="Próximamente"/> <meta property="og:type" content="Maintenance"/> <meta property="og:url" content="https://ammaarquitectura.com"/> <meta property="og:description" content="Próximamente estaremos online"/> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://ammaarquitectura.com/xmlrpc.php" /> <link rel='stylesheet' id='mtnc-style-css' href='https://ammaarquitectura.com/wp-content/plugins/maintenance/load/css/style.css?ver=1707418957' type='text/css' media='all' /> <link rel='stylesheet' id='mtnc-fonts-css' href='https://ammaarquitectura.com/wp-content/plugins/maintenance/load/css/fonts.css?ver=1707418957' type='text/css' media='all' /> <style type="text/css">body {background-color: #ffffff}.preloader {background-color: #ffffff}body {font-family: Open Sans; }.site-title, .preloader i, .login-form, .login-form a.lost-pass, .btn-open-login-form, .site-content, .user-content-wrapper, .user-content, footer, .maintenance a{color: #000000;} a.close-user-content, #mailchimp-box form input[type="submit"], .login-form input#submit.button {border-color:#000000} input[type="submit"]:hover{background-color:#000000} input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-text-fill-color:#000000} body > .login-form-container{background-color:#ffffff}.btn-open-login-form{background-color:#ffffff}input:-webkit-autofill, input:-webkit-autofill:focus{-webkit-box-shadow:0 0 0 50px #ffffff inset}input[type='submit']:hover{color:#ffffff} #custom-subscribe #submit-subscribe:before{background-color:#ffffff} .main-container, .main-container:after { background-color: #fff !important; } div#btn-open-login-form { display: none; }</style> <!--[if IE]> <style type="text/css"> </style> <script type="text/javascript" src="https://ammaarquitectura.com/wp-content/plugins/maintenance/load/js/jquery.backstretch.min.js"></script> <![endif]--> <link rel="stylesheet" href="https://fonts.bunny.net/css?family=Open%20Sans:300,300italic,regular,italic,600,600italic,700,700italic,800,800italic:300"></head> <body data-cmplz=1 class="maintenance "> <div class="main-container"> <div class="preloader"><i class="fi-widget" aria-hidden="true"></i></div> <div id="wrapper"> <div class="center logotype"> <header> <div class="logo-box" rel="home"> <img src="https://ammaarquitectura.com/wp-includes/images/media/default.svg" srcset="https://ammaarquitectura.com/wp-includes/images/media/default.svg 2x" width="340" alt="logo"> </div> </header> </div> <div id="content" class="site-content"> <div class="center"> <h2 class="heading font-center" style="font-weight:300;font-style:normal">Próximamente</h2><div class="description" style="font-weight:300;font-style:normal"><p>Próximamente estaremos online</p> </div> </div> </div> </div> <!-- end wrapper --> <footer> <div class="center"> <div style="font-weight:300;font-style:normal">© ammaarquitectura.com</div> </div> </footer> </div> <div class="login-form-container"> <input type="hidden" id="mtnc_login_check" name="mtnc_login_check" value="ffbe112b2b" /><input type="hidden" name="_wp_http_referer" value="/" /><form id="login-form" class="login-form" method="post"><label>Acceso del usuario</label><span class="login-error"></span><span class="licon user-icon"><input type="text" name="log" id="log" value="" size="20" class="input username" placeholder="Nombre de usuario" /></span><span class="picon pass-icon"><input type="password" name="pwd" id="login_password" value="" size="20" class="input password" placeholder="Contraseña" /></span><a class="loFound 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.glutenfree-mimi.com
2024-07-06 08:49
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:49:13 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://glutenfree-mimi.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · omargonzalezphotography.com
2024-07-06 08:48
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:48:02 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.omargonzalezphotography.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.prldood.pacificrimlabradoodles.com
2024-07-06 08:47
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:47:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:47:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: prl Dood site — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>prl Dood site — Coming Soon</title> <script src="https://prldood.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://prldood.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://prldood.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · prldood.pacificrimlabradoodles.com
2024-07-06 08:47
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:47:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:47:37 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: prl Dood site — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>prl Dood site — Coming Soon</title> <script src="https://prldood.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://prldood.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://prldood.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.iacvt.com
2024-07-06 08:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:44:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://iacvt.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:44:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.rsmrf.org
2024-07-06 08:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:44:22 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://rsmrf.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.testing.careaidafrica.org
2024-07-06 08:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:44:11 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://testing.careaidafrica.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:49:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ammaarquitectura.ammanetwork.org
2024-07-06 08:44
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:44:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ammaarquitectura.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:44:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · volumil.revsz.com
2024-07-06 08:43
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.a1-freight.com
2024-07-06 08:42
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:42:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tribalmerch.whoisduck.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:42:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · kaizenmagic.com
2024-07-06 08:41
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:41:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kaizenmagic.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:41:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · mail.kneesaverpooltool.com
2024-07-06 08:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:39:17 GMT Server: Apache Cache-Control: no-cache X-UA-Compatible: IE=edge X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://kneesaverpooltool.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:39:17 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.zuj.nxb.mybluehost.me
2024-07-06 08:38
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:38:53 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:38:52 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://zuj.nxb.mybluehost.me/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://zuj.nxb.mybluehost.me/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://zuj.nxb.mybluehost.me/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.torchpodcast.com
2024-07-06 08:38
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:38:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://torchpodcast.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:43:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.rnx.qiv.mybluehost.me
2024-07-06 08:36
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:36:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:36:34 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 08:36:35 GMT; Max-Age=315360000; path=/ Transfer-Encoding: chunked Page title: empleo — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>empleo — Coming Soon</title> <script src="https://empleo.credicefi.com.do/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://empleo.credicefi.com.do/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://empleo.credicefi.com.do/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.thejagroup.org
2024-07-06 08:36
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:36:23 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thejagroup.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:36:22 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.photographybysri.com
2024-07-06 08:34
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:34:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://photographybysri.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:34:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.twosistersdesignsnd.com
2024-07-06 08:34
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:34:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://twosistersdesignsnd.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.twosistersdesignsnd.com
2024-07-06 08:34
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:34:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://twosistersdesignsnd.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://twosistersdesignsnd.com/index.php?rest_route=/wp/v2/pages/4>; rel="alternate"; type="application/json", <https://twosistersdesignsnd.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.seasonedconversations-org.cid5280.com
2024-07-06 08:33
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:33:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://seasonedconversations.org/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 08:33:34 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.website-64e0a88e.oneflymama.com
2024-07-06 08:31
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:31:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Content-Security-Policy: script-src 'self' 'unsafe-inline' 'unsafe-eval' https: data: X-Redirect-By: WordPress Location: https://thepartycatalog.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:31:53 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=49f8446310c4ad617f0c1fd4547ba5bc; path=/
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · unsbet365.com
2024-07-06 08:28
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:28:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://www.unsbet365.com/xmlrpc.php X-Redirect-By: WordPress Location: https://www.unsbet365.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.abbybell.org
2024-07-06 08:28
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:28:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://abbybell.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:28:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · thejagroup.org
2024-07-06 08:27
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:27:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://thejagroup.org/wp-json/>; rel="https://api.w.org/", <https://thejagroup.org/wp-json/wp/v2/pages/10>; rel="alternate"; type="application/json", <https://thejagroup.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:27:38 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · essencehealthagency.co.nz
2024-07-06 08:27
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:27:36 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://essencehealthagency.co.nz/wp-json/>; rel="https://api.w.org/", <https://essencehealthagency.co.nz/wp-json/wp/v2/pages/151995>; rel="alternate"; type="application/json", <https://essencehealthagency.co.nz/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:27:33 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.drumair.com
2024-07-06 08:27
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:27:37 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Sat, 06 Jul 2024 09:27:37 GMT Cache-Control: max-age=3600 X-Redirect-By: WordPress Location: https://drumair.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · gotogordoncomputers.com
2024-07-06 08:26
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:26:43 GMT Server: Apache X-Pingback: https://gotogordoncomputers.com/xmlrpc.php Link: <https://gotogordoncomputers.com/wp-json/>; rel="https://api.w.org/", <https://gotogordoncomputers.com/wp-json/wp/v2/pages/126>; rel="alternate"; type="application/json", <https://gotogordoncomputers.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=3600 Expires: Sat, 06 Jul 2024 09:26:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · youngsteadtlab-org.rda.ruz.mybluehost.me
2024-07-06 08:26
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:26:26 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://youngsteadtlab.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.ncnativebees.org
2024-07-06 08:25
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:25:17 GMT Server: Apache Link: <https://ncnativebees.org/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: North Carolina Native Pollinators – Just another WordPress site <!doctype html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width, initial-scale=1" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <title>North Carolina Native Pollinators – Just another WordPress site</title> <link rel='dns-prefetch' href='//ncnativebees.org' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Feed" href="https://ncnativebees.org/feed/" /> <link rel="alternate" type="application/rss+xml" title="North Carolina Native Pollinators » Comments Feed" href="https://ncnativebees.org/comments/feed/" /> <script type="text/javascript"> window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/ncnativebees.org\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.0.22"}}; !function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode;p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0);e=i.toDataURL();return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])?!1:!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([55358,56760,9792,65039],[55358,56760,8203,9792,65039])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(n=t.source||{}).concatemoji?c(n.concatemoji):n.wpemoji&&n.twemoji&&(c(n.twemoji),c(n.wpemoji)))}(window,document,window._wpemojiSettings); </script> <style type="text/css"> img.wp-smiley, img.emoji { display: inline !important; border: none !important; box-shadow: none !important; height: 1em !important; width: 1em !important; margin: 0 .07em !important; vertical-align: -0.1em !important; background: none !important; padding: 0 !important; } </style> <link rel='stylesheet' id='wp-block-library-css' href='https://ncnativebees.org/wp-includes/css/dist/block-library/style.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='wp-block-library-theme-css' href='https://ncnativebees.org/wp-includes/css/dist/block-library/theme.min.css?ver=5.0.22' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-style-css' href='https://ncnativebees.org/wp-content/themes/twentynineteen/style.css?ver=1.1' type='text/css' media='all' /> <link rel='stylesheet' id='twentynineteen-print-style-css' href='https://ncnativebees.org/wp-content/themes/twentynineteen/print.css?ver=1.1' type='text/css' media='print' /> <link rel='https://api.w.org/' href='https://ncnativebees.org/wp-json/' /> <link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://ncnativebees.org/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://ncnativebees.org/wp-includes/wlwmanifest.xml" /> <Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.barrelandbond.com
2024-07-06 08:24
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:24:33 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://barrelandbond.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:24:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Vary: Accept-Encoding X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · hvacunionnj.com
2024-07-06 08:22
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:22:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://hvacunionnj.com/wp-json/>; rel="https://api.w.org/", <https://hvacunionnj.com/wp-json/wp/v2/pages/2>; rel="alternate"; type="application/json", <https://hvacunionnj.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:22:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · worldwidebh.com
2024-07-06 08:21
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:21:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:21:42 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Worldwide Business Holding — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Worldwide Business Holding — Coming Soon</title> <script src="https://worldwidebh.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://worldwidebh.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://worldwidebh.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.pangealds.com
2024-07-06 08:21
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:21:26 GMT Server: Apache X-UA-Compatible: IE=edge Link: <https://pangeafiltech.com/wp-json/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:26:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · dripstl.com
2024-07-06 08:20
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:21:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://dripstl.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:21:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.s3consultingsolutions.com
2024-07-06 08:19
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:19:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://s3consultingsolutions.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:19:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · lakecountryarts.org
2024-07-06 08:16
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:16:06 GMT Server: Apache Link: <https://lakecountryarts.org/wp-json/>; rel="https://api.w.org/", <https://lakecountryarts.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.taleofmylife.com
2024-07-06 08:14
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:14:22 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://taleofmylife.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.athuladassanatemple.org
2024-07-06 08:14
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:14:06 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://athuladassanatemple.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · pangeafiltration.com
2024-07-06 08:09
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:09:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://pangeafiltration.com/wp-json/>; rel="https://api.w.org/", <https://pangeafiltration.com/wp-json/wp/v2/pages/7>; rel="alternate"; type="application/json", <https://pangeafiltration.com/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:14:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.eb5.abctrader.us
2024-07-06 08:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:07:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://eb5.abctrader.us/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:07:51 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.bakerblogger.writeeditcopy.com
2024-07-06 08:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:07:54 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bakerblogger.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:07:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 08:07:52 GMT; Max-Age=315360000; path=/
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · oliviaf17-sg-host-com.cid5280.com
2024-07-06 08:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:07:43 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://oliviaf17.sg-host.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:07:43 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.kaizenmagic.com
2024-07-06 08:07
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:07:35 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://kaizenmagic.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:07:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.sgiusaaustin.org
2024-07-06 08:06
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:06:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://sgiusaaustin.org/wp-json/>; rel="https://api.w.org/", <https://wp.me/747HS>; rel=shortlink X-TEC-API-VERSION: v1 X-TEC-API-ROOT: https://sgiusaaustin.org/wp-json/tribe/events/v1/ X-TEC-API-ORIGIN: https://sgiusaaustin.org Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:06:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tribuinterior.com
2024-07-06 08:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:06:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Referrer-Policy: no-referrer-when-downgrade Location: https://www.tribuinterior.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:06:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.awamanchester.org.uk
2024-07-06 08:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:05:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://awamanchester.org.uk/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:05:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.brainsts.com
2024-07-06 08:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:05:34 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Location: https://brainsts.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.iflextech.co.nz
2024-07-06 08:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:05:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Retry-After: 86400 Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:05:12 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Elite Mortgage is under construction <html lang="en"> <head> <meta charset="utf-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <meta name="viewport" content="width=device-width, initial-scale=1"> <title>Elite Mortgage is under construction</title> <meta name="description" content="" /> <meta name="generator" content="Free UnderConstructionPage plugin for WordPress"> <link rel="stylesheet" href="https://fonts.bunny.net/css?family=Nunito:200,600,900"> <link rel="stylesheet" href="https://elitemortgage.co.nz/wp-content/plugins/under-construction-page/themes/css/bootstrap.min.css?v=3.99" type="text/css"> <link rel="stylesheet" href="https://elitemortgage.co.nz/wp-content/plugins/under-construction-page/themes/css/common.css?v=3.99" type="text/css"> <link rel="stylesheet" href="https://elitemortgage.co.nz/wp-content/plugins/under-construction-page/themes/people_2/style.css?v=3.99" type="text/css"> <link rel="stylesheet" href="https://elitemortgage.co.nz/wp-content/plugins/under-construction-page/themes/css/font-awesome.min.css?v=3.99" type="text/css"> <link rel="icon" href="https://elitemortgage.co.nz/wp-content/plugins/under-construction-page/themes/images/favicon.png" /> </head> <body> <div id="hero-image"> <img src="https://elitemortgage.co.nz/wp-content/plugins/under-construction-page/themes/people_2/people_2.png" alt="People at Work" title="People at Work"> </div> <div class="container"> <div class="row"> <div class="col-xs-12 col-md-12 col-lg-12"> <h1>Sorry, we're doing some work on the site</h1> </div> </div> <div class="row"> <div class="col-xs-12 col-md-8 col-md-offset-2 col-lg-offset-2 col-lg-8"> <p class="content">Thank you for being patient. We are doing some work on the site and will be back shortly.</p> </div> </div> <div class="row" id="social"> <div class="col-xs-12 col-md-12 col-lg-12"> </div> </div> </div> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.flatironsmanagementgroup.com
2024-07-06 08:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:05:11 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://flatironsmanagementgroup.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:10:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.theraisingdad.com
2024-07-06 08:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:05:06 GMT Server: Apache Vary: accept,content-type,Accept-Encoding Link: <https://box5702.temp.domains/~therais1/wp-json/>; rel="https://api.w.org/", <https://wp.me/aq6Bv>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:10:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · rsmrf-org.asndi.org
2024-07-06 08:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:05:04 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://rsmrf.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · dsmalliance.com
2024-07-06 08:04
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:04:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-Pingback: https://dsmalliance.com/xmlrpc.php Link: <https://dsmalliance.com/wp-json/>; rel="https://api.w.org/", <https://dsmalliance.com/wp-json/wp/v2/pages/2>; rel="alternate"; type="application/json", <https://dsmalliance.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.robbinshottubs.com
2024-07-06 08:04
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:04:48 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://robbinshottubs.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:04:48 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.website-593b1361.afreshlifego.com
2024-07-06 08:04
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:04:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:04:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: SunPower ABCTrader.US — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>SunPower ABCTrader.US — Coming Soon</title> <script src="https://sunpower.abctrader.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://sunpower.abctrader.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://sunpower.abctrader.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · abmtahid.com
2024-07-06 08:03
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:03:16 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://abmtahid.com/wp-json/>; rel="https://api.w.org/", <https://abmtahid.com/wp-json/wp/v2/pages/680>; rel="alternate"; type="application/json", <https://abmtahid.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:03:15 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · carlamyoung.com
2024-07-06 08:03
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:03:04 GMT Server: Apache X-UA-Compatible: IE=edge Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Carla M. Young — Coming Soon <!DOCTYPE html> <html> <head> <meta name="viewport" content="width=device-width"> <title> Carla M. Young — Coming Soon </title> <script src="https://box5702.temp.domains/~carlamyo/wp-includes/js/jquery/jquery.js"></script> <link href="https://fonts.googleapis.com/css?family=Open+Sans:400,600" rel="stylesheet"> <style type="text/css"> body { background-color: #fff; background-image: url("https://box5702.temp.domains/~carlamyo/wp-content/plugins/mojo-marketplace-wp-plugin/images/cs-bluehost-bg.jpg"); background-position: top right; background-repeat: no-repeat; font-family: "Open Sans", sans-serif; overflow-x: hidden; } * { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } input { font-family: "Open Sans", sans-serif; } ::-webkit-input-placeholder { color: #9DAFBD; } ::-moz-placeholder { color: #9DAFBD; } :-ms-input-placeholder { color: #9DAFBD; } :-moz-placeholder { color: #9DAFBD; } #wrap { max-width: 560px; margin: 320px auto 120px; color: #444; text-align: center; } #wrap h1 { font-weight: 300; font-size: 28px; } #wrap h2 { font-weight: 300; font-size: 38px; } #wrap p { color: #666; line-height: 1.5; } footer { background-color: #fff; width: 100%; position: fixed; bottom: 0; left: 0; color: #666; } footer p { font-size: 14px; line-height: 22px; color: #5B5B5B; padding: 8px; text-align: center; } footer p a { color: #3575D3; text-decoration: none; } footer p a:hover { text-decoration: underline; } .btn { display: inline-block; font-weight: 400; text-align: center; vertical-align: middle; -ms-touch-action: manipulation; touch-action: manipulation; cursor: pointer; background-image: none; border: 1px solid transparent; white-space: nowrap; -webkit-user-select: none; -moz-user-select: none; -ms-user-select: none; user-select: none; padding: 8px 16px; font-size: 14px; line-height: 1.5; border: 1px solid #2e66ba; background: #2e66ba; color: #fff; box-shadow: none; border-radius: 3px; text-decoration: none; margin-top: 60px; } .btn:hover { border: 1px solid #2e66ba; background-color: #fff; color: #2e66ba; } .bh_subscription_widget { } .bh_subscription_widget h2.widgettitle { color: #5B5B5B; font-size: 38px; letter-spacing: -1px; line-height: 54px; margin-bottom: 10px; } .bh_subscription_widget #subscribe-text p { color: #5B5B5B; font-size: 16px; letter-spacing: 0; line-height: 24px; margin-bottom: 25px; } .bh_subscription_widget #success, .bh_subscription_widget #error { border-radius: 4px; font-size: 14px; line-height: 24px; color: #5B5B5B; margin-bottom: 25px; display: none; padding: 8px 40px; } .bh_subscription_widget #success { background: #CCE9D0; border: 1px solid #009013; } .bh_subscription_widget #error { background: #FFEAE9; border: 1px solid #F72F26; } .bh_subscription_widget form .bh-inputs { display: inline-block; position: relative; vertical-align: middle; -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.active { -webkit-transition: all 0.1s ease-in-out; -moz-transition: all 0.1s ease-in-out; -o-transition: all 0.1s ease-in-out; transition: all 0.1s ease-in-out; } .bh_subscription_widget form .bh-inputs.email.active #bh-subscribe-label { color: #5B5B5B; clip: auto !important; height: auto !important; position: absolute !important; overflow: visible !important; width: auto !important; left: 16px; font-size: 11px; top: 2px;Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.website-52c62bbe.biztechnd.com
2024-07-06 08:03
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:03:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://minotmasoniccenter.org/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:03:05 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.lilliquistforbellingham.taradactyldesign.com
2024-07-06 08:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:02:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://www.lilliquistforbellingham.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:02:40 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.impactfulseo.simplywebseo.com
2024-07-06 08:02
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:02:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://impactfulseo.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:02:35 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.floralite.revsz.com
2024-07-06 08:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:01:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://floralite.revsz.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:01:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.asndi.org
2024-07-06 08:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:01:56 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.asndi.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · socialmedia.tsnpa.org
2024-07-06 08:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:01:49 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://transformativesolutionsnetwork.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:06:49 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.stephanieferrara.com
2024-07-06 08:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:01:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://stephanieferrara.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:01:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Vary: User-Agent X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · sunpower.abctrader.us
2024-07-06 08:01
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:01:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:01:26 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: SunPower ABCTrader.US — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>SunPower ABCTrader.US — Coming Soon</title> <script src="http://sunpower.abctrader.us/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="http://sunpower.abctrader.us/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://sunpower.abctrader.us/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.embracingthesunlight.com
2024-07-06 08:01
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:01:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://embracingthesunlight.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.stoppsychiatricprofiling-org.aka.auj.mybluehost.me
2024-07-06 08:00
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 08:00:38 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: http://www.stoppsychiatricprofiling.org/xmlrpc.php X-Redirect-By: WordPress Location: https://www.stoppsychiatricprofiling.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 08:05:38 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.128path-org.charleskeil.org
2024-07-06 08:00
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:00:02 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Fri, 08 Sep 2017 18:04:33 GMT Accept-Ranges: bytes Content-Length: 9079 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: 12/8 PATH - Brass bands serving dancers and building community spirit <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>12/8 PATH - Brass bands serving dancers and building community spirit</title> <meta content="12/8, path, paths, brass bands, dancers, community spirit, pleasure, playing, mobility, inclusion, funny hats, happiness, joy, musicking, dancing, drumming, music, dance, community, children, spirit, path bands, Path Times, spirituality, pedagogy, poetry, paganism, green politics, species diversity, cultural diversity, movements, reclaiming, demonstrations, performance, street music, horns, drums, festivals, funk, second line, dixieland, swing, samba, salsa, conga, comparsa, partying, mobile, inclusive, grooving, communitas, social change, twelve step, eight fold path, rites, rituals, William Blake, four fold vision, call/response, biocentric, animism, solstice, Malcolm X, biocentric, strolling group, shuffle rhythms, praxis, step program, Gregory Bateson, trumpets, trombones, sousaphone, saxophones, bass drum, snare drum, guiro, agogo, echology, ecology of mind, riffs, triune brain, equinox, full moon, wakes, processions, parades, picnics, weddings, participatory discrepancies, public domain, in the zone, flow, focus, libertarian, socialism, Greenpeace, Human Rights Watch, Cultural Survival, Buffalo, Seattle, Boston, New York, paired instruments, self-determination, self-organization, cultural integrity, species integrity, Brazil, Cuba, New Orleans, dynamic pattern." name="Keywords" /> <meta content="The 12/8 Path is a brass band movement for reclaiming the powers of music-dance performance for all people, but especially children, in their communities" name="Description" /> <script language="JavaScript"> <!-- <!-- hide this script from non-javascript-enabled browsers /* Functions that swaps images. */ // stop hiding --> function MM_preloadImages() { //v3.0 var d=document; if(d.images){ if(!d.MM_p) d.MM_p=new Array(); var i,j=d.MM_p.length,a=MM_preloadImages.arguments; for(i=0; i<a.length; i++) if (a[i].indexOf("#")!=0){ d.MM_p[j]=new Image; d.MM_p[j++].src=a[i];}} } function MM_swapImgRestore() { //v3.0 var i,x,a=document.MM_sr; for(i=0;a&&i<a.length&&(x=a[i])&&x.oSrc;i++) x.src=x.oSrc; } function MM_findObj(n, d) { //v4.01 var p,i,x; if(!d) d=document; if((p=n.indexOf("?"))>0&&parent.frames.length) { d=parent.frames[n.substring(p+1)].document; n=n.substring(0,p);} if(!(x=d[n])&&d.all) x=d.all[n]; for (i=0;!x&&i<d.forms.length;i++) x=d.forms[i][n]; for(i=0;!x&&d.layers&&i<d.layers.length;i++) x=MM_findObj(n,d.layers[i].document); if(!x && d.getElementById) x=d.getElementById(n); return x; } function MM_swapImage() { //v3.0 var i,j=0,x,a=MM_swapImage.arguments; document.MM_sr=new Array; for(i=0;i<(a.length-2);i+=3) if ((x=MM_findObj(a[i]))!=null){document.MM_sr[j++]=x; if(!x.oSrc) x.oSrc=x.src; x.src=a[i+2];} } //--> </script> </head> <body bgcolor="#ee1a1a" onload="MM_preloadImages('indexpath/indexpath_r1_c1_f2.gif','indexpath/indexpath_r2_c1_f2.gif','indexpath/indexpath_r3_c1_f2.gif','indexpath/indexpath_r4_c1_f2.gif','indexpath/indexpath_r5_c1_f2.gif','indexpath/indexpath_r6_c1_f2.gif')"> <div align="center"> <p><img height="48" alt="12/8 Path" width="265" border="0" _wpro_SRC="path.gif" src="path.gif" /> </p> <table cellpadding="5" width="100%" border="0"> <tbody> <tr> <td width="25%"> <table width="50%"> <tbody> <tr valign="center"> <td width="537" height="92"><font face="'Arial Black',Arial,sans-serif">Want to be in a band for dancers that is mobile, inclusive and wears funny hats? Get on the 12/8 path..... </font></td></tr></tbody></table></td> <td width="50%"> <table cellpadding="5" width="100%" border="0"> <tbody> <tr> <td valign="bottom" width="35%"> <div align="right"><a href="http://musicgrooves.org"><img height="144" alt="Music Grooves Book Cover" width="88" border="0" src="MusicGrooves.jpg" /></a></div></td> <td valign="top" width="28%" rowspan="Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ollieonlinemarketing.com
2024-07-06 08:00
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 08:00:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 10:00:03 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Ollie Online Marketing — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Ollie Online Marketing — Coming Soon</title> <script src="https://ollieonlinemarketing.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://ollieonlinemarketing.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.0" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://ollieonlinemarketing.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jmasonassociates.co.uk
2024-07-06 07:57
HTTP/1.1 403 Forbidden Date: Sat, 06 Jul 2024 07:57:22 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress Transfer-Encoding: chunked <div style='height: 98vh;'> <div style='text-align: center; padding: 10% 0; font-family: Arial, Helvetica, sans-serif;'> <div><p>MalCare Firewall</p></div> <p>Blocked because of Malicious Activities</p> <p>Reference ID: 13164728246688f8e1f0f17</p> </div> </div>
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · prostadine.revsz.com
2024-07-06 07:54
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:54:21 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://prostadine.revsz.com/wp-json/>; rel="https://api.w.org/", <https://prostadine.revsz.com/wp-json/wp/v2/pages/9>; rel="alternate"; type="application/json", <https://prostadine.revsz.com/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:54:20 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Astronauts “Pee in 0 Gravity” Protocol is SavingThousands from an Enlarged Prostate <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>Astronauts “Pee in 0 Gravity” Protocol is SavingThousands from an Enlarged Prostate</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://prostadine.revsz.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://prostadine.revsz.com/wp-content/themes/the_deadbeat_theme/js/html5.js" type="text/javascript"></script> <![endif]--> <meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /> <!-- This site is optimized with the Yoast SEO plugin v23.0 - https://yoast.com/wordpress/plugins/seo/ --> <link rel="canonical" href="https://prostadine.revsz.com/" /> <meta property="og:locale" content="en_US" /> <meta property="og:type" content="website" /> <meta property="og:title" content="Astronauts “Pee in 0 Gravity” Protocol is SavingThousands from an Enlarged Prostate - Prostadine" /> <meta property="og:url" content="https://prostadine.revsz.com/" /> <meta property="og:site_name" content="Prostadine" /> <meta property="article:modified_time" content="2023-07-03T14:09:31+00:00" /> <meta property="og:image" content="https://prostadine.revsz.com/wp-content/uploads/2023/07/Sugar-Balance-Sugar-Balance-Reviews.png" /> <meta name="twitter:card" content="summary_large_image" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://prostadine.revsz.com/","url":"https://prostadine.revsz.com/","name":"Astronauts “Pee in 0 Gravity” Protocol is SavingThousands from an Enlarged Prostate - Prostadine","isPartOf":{"@id":"http://prostadine.revsz.com/#website"},"primaryImageOfPage":{"@id":"https://prostadine.revsz.com/#primaryimage"},"image":{"@id":"https://prostadine.revsz.com/#primaryimage"},"thumbnailUrl":"https://prostadine.revsz.com/wp-content/uploads/2023/07/Sugar-Balance-Sugar-Balance-Reviews.png","datePublished":"2023-07-03T14:09:29+00:00","dateModified":"2023-07-03T14:09:31+00:00","breadcrumb":{"@id":"https://prostadine.revsz.com/#breadcrumb"},"inLanguage":"en-US","potentialAction":[{"@type":"ReadAction","target":["https://prostadine.revsz.com/"]}]},{"@type":"ImageObject","inLanguage":"en-US","@id":"https://prostadine.revsz.com/#primaryimage","url":"https://prostadine.revsz.com/wp-content/uploads/2023/07/Sugar-Balance-Sugar-Balance-Reviews.png","contentUrl":"https://prostadine.revsz.com/wp-content/uploads/2023/07/Sugar-Balance-Sugar-Balance-Reviews.png","width":684,"height":387},{"@type":"BreadcrumbList","@id":"https://prostadine.revsz.com/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home"}]},{"@type":"WebSite","@id":"http://prostadine.revsz.com/#website","url":"http://prostadine.revsz.com/","name":"Prostadine","description":"Maintain a Healthy Prostate","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"http://prostadine.revsz.com/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"en-US"}]}</script> <!-- / Yoast SEO plugin. --> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel="alternate" type="application/rss+xml" title="Prostadine » Feed" href="https://prostadine.revsz.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Prostadine » Comments Feed" href="https://prostadine.revsz.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/prostadine.revsz.com\/wp-includes\/js\/wp-emoji-rFound 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.portfoliostyles.com
2024-07-06 07:53
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:53:26 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://portfoliostyles.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · transformativesolutionsnetwork.org
2024-07-06 07:52
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:52:27 GMT Server: Apache Link: <https://transformativesolutionsnetwork.org/wp-json/>; rel="https://api.w.org/", <https://transformativesolutionsnetwork.org/wp-json/wp/v2/pages/479>; rel="alternate"; type="application/json", <https://transformativesolutionsnetwork.org/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:57:27 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · marlodj.obertys.com
2024-07-06 07:52
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:52:22 GMT Server: Apache Link: <https://marlodj.obertys.com/wp-json/>; rel="https://api.w.org/", <https://marlodj.obertys.com/wp-json/wp/v2/pages/10300>; rel="alternate"; type="application/json", <https://marlodj.obertys.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:52:22 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · elisastancillevine.com
2024-07-06 07:52
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:52:13 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://elisastancillevine.com/wp-json/>; rel="https://api.w.org/", <https://elisastancillevine.com/wp-json/wp/v2/pages/1087>; rel="alternate"; type="application/json", <https://elisastancillevine.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:57:10 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=10413c5f5482675e6ab1babeaa9681d0; path=/ Transfer-Encoding: chunked
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.hatvisuals.com
2024-07-06 07:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:51:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hatvisuals.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:51:46 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · missinformed.blog
2024-07-06 07:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:51:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://bellcreativeco.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:51:23 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ncnativebees.org
2024-07-06 07:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:51:19 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Location: https://ncnativebees.org/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 5 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · glamorousbeauty-space.lanternticket.com
2024-07-06 07:51
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:51:08 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://glamorousbeauty.space/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:51:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · bethanychristianchurchofelpaso.com
2024-07-06 07:51
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:51:09 GMT Server: Apache Link: <https://bethanychristianchurchofelpaso.com/index.php?rest_route=/>; rel="https://api.w.org/" Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · myempoweringlife.com
2024-07-06 07:50
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:50:51 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://myempoweringlife.com/wp-json/>; rel="https://api.w.org/", <https://myempoweringlife.com/wp-json/wp/v2/pages/64>; rel="alternate"; type="application/json", <https://myempoweringlife.com/>; rel=shortlink Content-Security-Policy: upgrade-insecure-requests; Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:55:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.wzr.mzi.mybluehost.me
2024-07-06 07:50
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:50:42 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://wzr.mzi.mybluehost.me/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:50:35 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · blog.brooketuckerphotography.com
2024-07-06 07:47
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:47:02 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.blog.brooketuckerphotography.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.whimsyandwander.lauratyephotography.com
2024-07-06 07:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:46:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://whimsyandwander.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:51:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04-Jul-2034 07:46:46 GMT; Max-Age=315360000; path=/
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · guidingpoint.org
2024-07-06 07:46
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:46:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://guidingpoint.org/wp-json/>; rel="https://api.w.org/", <https://guidingpoint.org/wp-json/wp/v2/pages/8>; rel="alternate"; type="application/json", <https://guidingpoint.org/>; rel=shortlink Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:46:41 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.npo-qa.com
2024-07-06 07:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:46:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://npo-qa.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:46:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · records.ncethicalsociety.org
2024-07-06 07:46
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:46:37 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Fri, 14 Jun 2013 13:50:00 GMT Accept-Ranges: bytes Content-Length: 3931 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: bannerlinks.gif <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <!-- saved from url=(0014)about:internet --> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>bannerlinks.gif</title> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <link href="../test.css" rel="stylesheet" type="text/css"> <style type="text/css"> <!-- --> </style> <link href="test.css" rel="stylesheet" type="text/css"> <link href="test2.css" rel="stylesheet" type="text/css"> <link href="stylesheet2.css" rel="stylesheet" type="text/css"><style type="text/css"> td img {display: block;}.blue { color: #004080; } </style> </head> <body bgcolor="#ffffff"> <div align="center"> <table width="853" border="0" align="center" cellpadding="0" cellspacing="0" style="display: inline-table;"> <!-- fwtable fwsrc="bannerlinks.png" fwpage="Page 1" fwbase="bannerlinks.gif" fwstyle="Dreamweaver" fwdocid = "2055971920" fwnested="0" --> <tr> <td><img src="images/spacer.gif" width="323" height="1" border="0" alt="" /></td> <td><img src="images/spacer.gif" width="157" height="1" border="0" alt="" /></td> <td><img src="images/spacer.gif" width="175" height="1" border="0" alt="" /></td> <td><img src="images/spacer.gif" width="198" height="1" border="0" alt="" /></td> <td><img src="images/spacer.gif" width="1" height="1" border="0" alt="" /></td> </tr> <tr> <td colspan="4"><img name="bannerlinks_r1_c1" src="images/bannerlinks_r1_c1.gif" width="853" height="145" border="0" id="bannerlinks_r1_c1" alt="" /></td> <td><img src="images/spacer.gif" width="1" height="145" border="0" alt="" /></td> </tr> <tr> <td><a href="http://www.ncethicalsociety.org" target="_top"><img name="bannerlinks_r2_c1" src="images/bannerlinks_r2_c1.gif" width="323" height="30" border="0" id="bannerlinks_r2_c1" alt="" /></a></td> <td><a href="SpotlightNews.htm"><img name="bannerlinks_r2_c2" src="images/bannerlinks_r2_c2.gif" width="157" height="30" border="0" id="bannerlinks_r2_c2" alt="" /></a></td> <td><a href="Platforms/index.html"><img name="bannerlinks_r2_c3" src="images/bannerlinks_r2_c3.gif" width="175" height="30" border="0" id="bannerlinks_r2_c3" alt="" /></a></td> <td><a href="membersresources.html"><img name="bannerlinks_r2_c4" src="images/bannerlinks_r2_c4.gif" width="198" height="30" border="0" id="bannerlinks_r2_c4" alt="" /></a></td> <td><img src="images/spacer.gif" width="1" height="30" border="0" alt="" /></td> </tr> </table> <br /> <table width="850" border="0" align="center" cellpadding="0" cellspacing="0"> <tr> <td width="91%" align="left" valign="top"><blockquote> <h4><br /> </h4> <p><font color="#804040" size="5" face="Goudy Old Style"><font face="Myriad Pro">EHST Records</font></font></p> <p><br /> This site contains public and private records. Programs and Platforms are for public viewing. Members' Resources are protected and available only to EHST members. </p> <p>There is a summary of platform speaker presentations from 1996 through August 2009. In September of that year, the society began issuing a monthly newsletter covering all programs during that month and these issues replace the platform summaries.These documents can be viewed using the corresponding links.</p> <p> </p> <p align="left"></p> <p align="left"> </p> <p> </p> <p><font color="#000000" size="2"><br /> </font></p> </blockquote></td> <td width="9%" align="right" valign="top"><p><font color="#339900" size="3"><a href="../prior/2010.html"><br /> </a></font></p> <p align="center"> </p> <p align="center"> </p> <p> </p></td> </tr> </table> <p align="center"><img src="images/footer.gif" alt="footer" width="850" height="125" align="middle" /></p> <div align="center"></div> <p> </p> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jlbccommunityalliance.avd.ofm.mybluehost.me
2024-07-06 07:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:46:21 GMT Server: Apache P3P: CP="ALL DSP NID CURa ADMa DEVa HISa OTPa OUR NOR NAV DEM" X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://jlbccommunityalliance.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:46:21 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.cid5280.com
2024-07-06 07:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:46:09 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://cid5280.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:46:08 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · wgv.ehs.mybluehost.me
2024-07-06 07:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:46:05 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://ftcmovement.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:51:05 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · beverlypetclinic.com
2024-07-06 07:46
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:46:07 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://beverlypetclinic.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://beverlypetclinic.com/index.php?rest_route=/wp/v2/pages/13>; rel="alternate"; type="application/json", <https://beverlypetclinic.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.codasocalconference.org
2024-07-06 07:46
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:46:01 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://codasocalconference.org/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:46:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · earthsolutionsinc.com
2024-07-06 07:45
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:45:45 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.earthsolutionsinc.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:45:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: EXPIRED
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.dsmalliance.com
2024-07-06 07:45
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:45:41 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: https://dsmalliance.com/xmlrpc.php X-Redirect-By: WordPress Location: https://dsmalliance.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tangithomas.nbg.ehs.mybluehost.me
2024-07-06 07:45
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:45:27 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tangithomas.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:45:26 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.gracepugetsound.com
2024-07-06 07:43
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:43:46 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Grace Fellowship of Puget Sound <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <title> Grace Fellowship of Puget Sound </title> <LINK REL="StyleSheet" HREF="scripts/mainstyle.css" TYPE="text/css"> </head> <body > <div style="width:640px;padding:30px 50px;text-align:center;margin:30vh auto;background-color: #56636b;opacity: .8; color: white;"> <span style=" font-size: 30px;">Grace Fellowship of Puget Sound<br> has merged with Coram Deo Fellowship<br>to form Crossway Fellowship.</span> <br> <br> <br> <span style="font-size: 18px;"> <a style="color: #ffd055; text-decoration:underline" href="http://cwfellowship.org"> Go to the Crossway Fellowship web site </a> </span> </div> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · workingtheimage-ca.writeeditcopy.com
2024-07-06 07:43
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:43:39 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://workingtheimage.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:43:39 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · website-43b8d4cd.legendinx.com
2024-07-06 07:43
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:43:32 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://sterlinghard1.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:43:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.aguadelavillahn.com
2024-07-06 07:40
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:41:05 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Agua Purificada De La Villa — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Agua Purificada De La Villa — Coming Soon</title> <script src="https://aguadelavillahn.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://aguadelavillahn.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://aguadelavillahn.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · crpdcourse-org.aka.auj.mybluehost.me
2024-07-06 07:39
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:39:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://crpdcourse.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:44:44 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.tetraig.guidingpc.com
2024-07-06 07:37
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:38:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://tetraig.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:37:59 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · ebntrading.com
2024-07-06 07:34
HTTP/1.1 302 Found Date: Sat, 06 Jul 2024 07:35:00 GMT Server: Apache X-Robots-Tag: noindex, nofollow Upgrade: h2,h2c Connection: Upgrade, close Location: /404.html host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Cache-Control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: 0 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.rebornbuild.com
2024-07-06 07:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:33:02 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://rebornbuild.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:38:00 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.jackmanind.j4oilers.com
2024-07-06 07:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:32:59 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://jackmanind.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:37:58 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.resourceinsuranceadvisors.com
2024-07-06 07:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:32:28 GMT Server: Apache Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://resourceinsuranceadvisors.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · unicoach.com
2024-07-06 07:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:32:29 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://www.unicoach.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:32:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · resourcewealthmanagement.com
2024-07-06 07:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:32:28 GMT Server: Apache Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://resourceinsuranceadvisors.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.thephotographybite.wan.vec.mybluehost.me
2024-07-06 07:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:32:29 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://thephotographybite.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:32:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.beeseengear.com
2024-07-06 07:32
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:32:28 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://beeseengear.com/ Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 07:32:27 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · settingsbyheidi.com
2024-07-06 07:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:32:29 GMT Server: Apache Cache-Provider: CLOUDWAYS-CACHE-DE Content-Encoding: gzip Vary: Accept-Encoding Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Thu, 04 Jul 2024 01:03:50 GMT Content-Length: 43752 Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:32:29 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Type: text/html; charset=utf-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.mesllcga.com
2024-07-06 07:32
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:32:05 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://box5702.temp.domains/~mesllcg1/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5702.temp.domains/~mesllcg1/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://box5702.temp.domains/~mesllcg1/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.transformativesolutionsnetwork.org
2024-07-06 07:31
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:31:32 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://transformativesolutionsnetwork.org/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:36:32 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.alttransit.com
2024-07-06 07:31
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:31:23 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Welcome — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Welcome — Coming Soon</title> <script src="https://alttransit.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alttransit.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alttransit.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.ultraomegaburn.revsz.com
2024-07-06 07:31
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:31:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://ultraomegaburn.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.nikolaikleistburkal.art-beats.com
2024-07-06 07:30
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:30:57 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Set-Cookie: nfdbrandname=BlueHost; expires=Tue, 04 Jul 2034 07:30:58 GMT; Max-Age=315360000; path=/ Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:30:57 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Newfold-Cache-Level: 2 X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Nikolai Kleist Burkal — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Nikolai Kleist Burkal — Coming Soon</title> <script src="https://box5702.temp.domains/~artbeat4/nikolaikleistburkal/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://box5702.temp.domains/~artbeat4/nikolaikleistburkal/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.9.4" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://box5702.temp.domains/~artbeat4/nikolaikleistburkal/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · website-d7bb6939.myempoweringlife.com
2024-07-06 07:30
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:30:44 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Content-Security-Policy: upgrade-insecure-requests; Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:30:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: LAURASELLSFLA — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>LAURASELLSFLA — Coming Soon</title> <script src="https://laurasellsfla.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://laurasellsfla.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://laurasellsfla.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · tourismshark.com
2024-07-06 07:30
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:30:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tourismshark.com/wp-json/>; rel="https://api.w.org/", <https://tourismshark.com/wp-json/wp/v2/pages/181>; rel="alternate"; type="application/json", <https://tourismshark.com/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:35:40 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: wp_travel_session=eef977a850c2d9193d0d673340a90b02%7C%7C1720252841%7C%7C1720252481; expires=Sat, 06 Jul 2024 08:00:41 GMT; Max-Age=1800; path=/ Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.womeninminerals.com
2024-07-06 07:30
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:30:39 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Cache-Control: no-store, no-cache, must-revalidate Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: Women in Minerals — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Women in Minerals — Coming Soon</title> <script src="https://womeninminerals.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://womeninminerals.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://womeninminerals.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.pii.abctrader.us
2024-07-06 07:28
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:28:31 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://pii.abctrader.us/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:28:31 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.randytysonphotography.legionofreason.com
2024-07-06 07:28
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:28:18 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://randytysonphotography.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:33:16 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · alohadavecookies.com
2024-07-06 07:25
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:25:03 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Aloha Dave Cookies — Coming Soon <!DOCTYPE html> <html dir="ltr" lang="en-US" prefix="og: https://ogp.me/ns#"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>Aloha Dave Cookies — Coming Soon</title> <script src="https://alohadavecookies.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://alohadavecookies.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.2" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://alohadavecookies.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:80 · www.klorrainesalon.com
2024-07-06 07:21
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:21:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: http://klorrainesalon.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:26:06 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=b529cfc548a1038a50cf086b9a60c589; path=/
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.simplywebseo.com
2024-07-06 07:19
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:20:03 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 X-LiteSpeed-Tag: 43b_HTTP.200,43b_HTTP.301 X-Redirect-By: WordPress Location: https://simplywebseo.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: mailchimp_landing_site=https%3A%2F%2Fsimplywebseo.com%2F; expires=Sat, 03 Aug 2024 07:20:03 GMT; Max-Age=2419200; path=/; secure; SameSite=Strict Set-Cookie: cartflows_session_72=72_065273d89bcdb521fe119dc8ba01c327; expires=Sat, 06 Jul 2024 07:50:03 GMT; Max-Age=1800; path=/; secure
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.nervecontrol911.revsz.com
2024-07-06 07:18
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:18:57 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://nervecontrol911.revsz.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.harborplumbingco.legendinx.com
2024-07-06 07:18
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:18:46 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://harborplumbingco.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:18:45 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · crpdcourse.org
2024-07-06 07:13
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:13:43 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://crpdcourse.org/wp-json/>; rel="https://api.w.org/", <https://crpdcourse.org/wp-json/wp/v2/pages/18>; rel="alternate"; type="application/json", <https://crpdcourse.org/>; rel=shortlink Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:18:43 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.hollyberryherbal.com
2024-07-06 07:13
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:13:40 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: accept,content-type X-Redirect-By: WordPress Location: https://hollyberryherbalco.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:13:37 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: nfdbrandname=bluehost; expires=Tue, 04 Jul 2034 07:13:39 GMT; Max-Age=315360000; path=/
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · thetealcircle.com
2024-07-06 07:12
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:13:00 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-UA-Compatible: IE=edge Link: <https://thetealcircle.com/wp-json/>; rel="https://api.w.org/", <https://thetealcircle.com/wp-json/wp/v2/pages/21>; rel="alternate"; type="application/json", <https://thetealcircle.com/>; rel=shortlink Cache-Control: max-age=0 Expires: Sat, 06 Jul 2024 07:13:00 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 1 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.sheilasinspiredlife.com
2024-07-06 07:12
HTTP/1.1 500 Internal Server Error Date: Sat, 06 Jul 2024 07:12:56 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 Connection: close Transfer-Encoding: chunked Page title: WordPress › Error <!DOCTYPE html> <html lang="en-US"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <meta name="viewport" content="width=device-width"> <meta name='robots' content='max-image-preview:large, noindex, follow' /> <title>WordPress › Error</title> <style type="text/css"> html { background: #f1f1f1; } body { background: #fff; border: 1px solid #ccd0d4; color: #444; font-family: -apple-system, BlinkMacSystemFont, "Segoe UI", Roboto, Oxygen-Sans, Ubuntu, Cantarell, "Helvetica Neue", sans-serif; margin: 2em auto; padding: 1em 2em; max-width: 700px; -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .04); box-shadow: 0 1px 1px rgba(0, 0, 0, .04); } h1 { border-bottom: 1px solid #dadada; clear: both; color: #666; font-size: 24px; margin: 30px 0 0 0; padding: 0; padding-bottom: 7px; } #error-page { margin-top: 50px; } #error-page p, #error-page .wp-die-message { font-size: 14px; line-height: 1.5; margin: 25px 0 20px; } #error-page code { font-family: Consolas, Monaco, monospace; } ul li { margin-bottom: 10px; font-size: 14px ; } a { color: #2271b1; } a:hover, a:active { color: #135e96; } a:focus { color: #043959; box-shadow: 0 0 0 2px #2271b1; outline: 2px solid transparent; } .button { background: #f3f5f6; border: 1px solid #016087; color: #016087; display: inline-block; text-decoration: none; font-size: 13px; line-height: 2; height: 28px; margin: 0; padding: 0 10px 1px; cursor: pointer; -webkit-border-radius: 3px; -webkit-appearance: none; border-radius: 3px; white-space: nowrap; -webkit-box-sizing: border-box; -moz-box-sizing: border-box; box-sizing: border-box; vertical-align: top; } .button.button-large { line-height: 2.30769231; min-height: 32px; padding: 0 12px; } .button:hover, .button:focus { background: #f1f1f1; } .button:focus { background: #f3f5f6; border-color: #007cba; -webkit-box-shadow: 0 0 0 1px #007cba; box-shadow: 0 0 0 1px #007cba; color: #016087; outline: 2px solid transparent; outline-offset: 0; } .button:active { background: #f3f5f6; border-color: #7e8993; -webkit-box-shadow: none; box-shadow: none; } </style> </head> <body id="error-page"> <div class="wp-die-message"><p>There has been a critical error on this website.</p><p><a href="https://wordpress.org/documentation/article/faq-troubleshooting/">Learn more about troubleshooting WordPress.</a></p></div></body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · elsakristen.com
2024-07-06 07:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:05:45 GMT Server: Apache Link: <https://elsakristen.com/wp-json/>; rel="https://api.w.org/", <https://elsakristen.com/wp-json/wp/v2/pages/9>; rel="alternate"; type="application/json", <https://elsakristen.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: Elsa Youngsteadt | Entomology, science writing <!DOCTYPE html> <html lang="en-US"> <head> <meta charset="UTF-8" /> <title> Elsa Youngsteadt | Entomology, science writing </title> <link rel="profile" href="https://gmpg.org/xfn/11" /> <link rel="stylesheet" type="text/css" media="all" href="https://elsakristen.com/wp-content/themes/twentyten/style.css?ver=20230808" /> <link rel="pingback" href="https://elsakristen.com/xmlrpc.php"> <meta name='robots' content='max-image-preview:large' /> <link rel="alternate" type="application/rss+xml" title="Elsa Youngsteadt » Feed" href="https://elsakristen.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Elsa Youngsteadt » Comments Feed" href="https://elsakristen.com/comments/feed/" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/elsakristen.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&!n.supports.flag,n.DOMReady=!1,n.readyCallback=function(){n.DOMReady=!0}}).then(function(){return e}).then(function(){var e;n.supports.everything||(n.readyCallback(),(e=n.source||{}).concatemoji?t(e.concatemoji):e.wpemoji&&e.twemoji&&(t(e.twemoji),t(e.wpemoji)))}))}((window,document),window._wpemojiSettings); /* ]]> */ </script> <style id='wp-emoji-styles-inline-css' type='text/css'> img.wp-smiley, img.emoji {Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.workingtheimage.ca
2024-07-06 07:05
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:05:30 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://workingtheimage.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:05:30 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · flexotone.revsz.com
2024-07-06 07:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:05:19 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://flexotone.revsz.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://flexotone.revsz.com/index.php?rest_route=/wp/v2/pages/9>; rel="alternate"; type="application/json", <https://flexotone.revsz.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Access-Control-Allow-Origin: * Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked Page title: What’s Spilling Inside Your Joints Damaging Them And Causing Excruciating Pain? <!DOCTYPE html> <!--[if IE 7]> <html class="ie ie7" lang="en-US"> <![endif]--> <!--[if IE 8]> <html class="ie ie8" lang="en-US"> <![endif]--> <!--[if !(IE 7) & !(IE 8)]><!--> <html lang="en-US"> <!--<![endif]--> <head> <meta charset="UTF-8" /> <meta name="viewport" content="width=device-width" /> <title>What’s Spilling Inside Your Joints Damaging Them And Causing Excruciating Pain?</title> <link rel="profile" href="http://gmpg.org/xfn/11" /> <link rel="pingback" href="https://flexotone.revsz.com/xmlrpc.php" /> <!--[if lt IE 9]> <script src="https://flexotone.revsz.com/wp-content/themes/the_deadbeat_theme/js/html5.js" type="text/javascript"></script> <![endif]--> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//stats.wp.com' /> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Flexotone » Feed" href="https://flexotone.revsz.com/?feed=rss2" /> <link rel="alternate" type="application/rss+xml" title="Flexotone » Comments Feed" href="https://flexotone.revsz.com/?feed=comments-rss2" /> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/flexotone.revsz.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0f","\ud83c\udff3\ufe0f\u200b\u26a7\ufe0f")?!1:!n(e,"\ud83c\uddfa\ud83c\uddf3","\ud83c\uddfa\u200b\ud83c\uddf3")&&!n(e,"\ud83c\udff4\udb40\udc67\udb40\udc62\udb40\udc65\udb40\udc6e\udb40\udc67\udb40\udc7f","\ud83c\udff4\u200b\udb40\udc67\u200b\udb40\udc62\u200b\udb40\udc65\u200b\udb40\udc6e\u200b\udb40\udc67\u200b\udb40\udc7f");case"emoji":return!n(e,"\ud83d\udc26\u200d\u2b1b","\ud83d\udc26\u200b\u2b1b")}return!1}function f(e,t,n){var r="undefined"!=typeof WorkerGlobalScope&&self instanceof WorkerGlobalScope?new OffscreenCanvas(300,150):i.createElement("canvas"),a=r.getContext("2d",{willReadFrequently:!0}),o=(a.textBaseline="top",a.font="600 32px Arial",{});return e.forEach(function(e){o[e]=t(a,e,n)}),o}function t(e){var t=i.createElement("script");t.src=e,t.defer=!0,i.head.appendChild(t)}"undefined"!=typeof Promise&&(o="wpEmojiSettingsSupports",s=["flag","emoji"],n.supports={everything:!0,everythingExceptFlag:!0},e=new Promise(function(e){i.addEventListener("DOMContentLoaded",e,{once:!0})}),new Promise(function(t){var n=function(){try{var e=JSON.parse(sessionStorage.getItem(o));if("object"==typeof e&&"number"==typeof e.timestamp&&(new Date).valueOf()<e.timestamp+604800&&"object"==typeof e.supportTests)return e.supportTests}catch(e){}return null}();if(!n){if("undefined"!=typeof Worker&&"undefined"!=typeof OffscreenCanvas&&"undefined"!=typeof URL&&URL.createObjectURL&&"undefined"!=typeof Blob)try{var e="postMessage("+f.toString()+"("+[JSON.stringify(s),u.toString(),p.toString()].join(",")+"));",r=new Blob([e],{type:"text/javascript"}),a=new Worker(URL.createObjectURL(r),{name:"wpTestEmojiSupports"});return void(a.onmessage=function(e){c(n=e.data),a.terminate(),t(n)})}catch(e){}c(n=f(s,u,p))}t(n)}).then(function(e){for(var t in e)n.supports[t]=e[t],n.supports.everything=n.supports.everything&&n.supports[t],"flag"!==t&&(n.supports.everythingExceptFlag=n.supports.everythingExceptFlag&&n.supports[t]);n.supporFound 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.musicgrooves.org
2024-07-06 07:05
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:05:09 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Thu, 06 Jul 2017 16:35:18 GMT Accept-Ranges: bytes Content-Length: 5604 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: Music Grooves Home Page <?php require_once('Connections/LinkID.php'); ?> <?php mysql_select_db($database_LinkID, $LinkID); $query_TopicAreas = "SELECT AreaID, ShortName FROM TopicAreas"; $TopicAreas = mysql_query($query_TopicAreas, $LinkID) or die(mysql_error()); $row_TopicAreas = mysql_fetch_assoc($TopicAreas); $totalRows_TopicAreas = mysql_num_rows($TopicAreas); ?> <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1"> <title>Music Grooves Home Page</title> <link href="mg.css" rel="stylesheet" type="text/css"> <script language="JavaScript" type="text/JavaScript"> <!-- function MM_goToURL(area) { //v3.0 document.MM_returnValue = false; parent.location="topics.php?AreaID=" + area; } //--> </script> <meta name="keywords" content="music,groove,grooving,groovology,sound,anthropology,participation,dialogues,dialogic,dialectics,style,culture,African-Americans,musical experience,lift-up-over sounding,mediation,performance,commodification,commodified,communication,participatory discrepancies,iconicity,Kaluli,stereotype,class,speech,natural world,aesthetics,listening experience,hegemony,civilization,jazz,dance,environment,cultural studies,Polish-Americans,records,recordings,rituals,process,copyright,world beat,layered,interacting,interplay,how to study music,bibliography,schizophonia,schismogenesis,practices,male bonding,identity,reflexive discourse,interpretive moves,popular music,models,polka,blues,speech,conversation,interviewing,metaphors,affecting presence,juxtaposed essays,Papua New Guinea,James Brown,Aretha Franklin,Louis Armstrong,Robert Armstrong,Mickey Hart,Tiv,resistance,joy"> <meta name="description" content="Music Grooves is an adventure in scholarly and personal dialogue. We link two thematic preoccupations central to the study of music: the experience of musical participation and the experience of musical mediation. To more personally and vocally unite the essay materials, we recorded and transcribed our own speech about music and playing and listening to it together. We talk about grooving, sound, participation, style, musical experience, culture, mediation, performance, records and recording, lift-up-over sounding, participatory discrepenacies, and the purposes of this site are to make our dialogues easily available and to encourage others to dialogue along with us."> </head> <body> <div align="center"> <table width="700" border="0" cellspacing="0" cellpadding="0"> <tr> <td width="367" height="96" valign="top" background="images/MGHeaderBG.jpg"><div align="left"><a href="index.php"><img src="images/MGText.gif" alt="Music Grooves - Join our dialogues" width="346" height="60" border="0"></a></div> <div align="center"> <!-- <select name="select" size="1" onChange="MM_goToURL(selectedIndex);return document.MM_returnValue"> <option selected value="">Select A Topic Area</option> <?php do { ?> <option value="<?php echo $row_TopicAreas['AreaID']?>"><?php echo $row_TopicAreas['ShortName']?></option> <?php } while ($row_TopicAreas = mysql_fetch_assoc($TopicAreas)); $rows = mysql_num_rows($TopicAreas); if($rows > 0) { mysql_data_seek($TopicAreas, 0); $row_TopicAreas = mysql_fetch_assoc($TopicAreas); } ?> </select> --> </div> </td> <td width="271" height="96" valign="top" background="images/MGHeaderBG.jpg"><div align="right" class="style5"> <div align="left"> <a href="http://musicgrooves.org/">HOME</a><br> <a href="http://musicgrooves.org/photos.html">PHOTOS</a><br> <a href="http://musicgrooves.org/articles.html">ARTICLES</a><br> <a href="http://musicgrooves.org/reviews.html">REVIEWS</a><br> <a href="http://musicgrooves.org/bios.html">BIOS</a> </div> </div></td> <td width="61" height="96" valign="top" background="images/MGHeaderBG.jpg"><div align="right"><img src="imagFound 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.casecashfinancing.com
2024-07-06 07:04
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:04:50 GMT Server: Apache X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://casecashfunding.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:04:50 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 3 X-nginx-cache: WordPress Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.a1-freight.com
2024-07-06 07:02
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:02:24 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://tribalmerch.whoisduck.com/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:02:24 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · brightbalkanmorning.com
2024-07-06 07:02
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 07:02:17 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade, close Last-Modified: Tue, 18 Apr 2023 22:19:17 GMT Accept-Ranges: bytes Content-Length: 2004 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Content-Type: text/html Page title: Bright Balkan Morning <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN""http://www.w3.org/TR/html4/loose.dtd"><html><head><meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1"><meta name="description" content="Romani Lives and the Power of Music in Greek Macedonia"><meta name="keywords" content="music, text book, student, Dick Blau, Charles Keil, Angeliki Vellou Keil, Steven Feld, photographs, pictures, bells, gypsy, gypsies, zourna, daouli, bands, live music"> <title>Bright Balkan Morning</title><link href="bbm.css" rel="stylesheet" type="text/css"></head><body> <div id="headerdiv" class="header"><a href="about.html" class="header">about the book</a> <span id="pipe" class="pipe">|</span> <span class="header"><a href="teachers.html" class="header">teachers</a></span> <span id="pipe" class="pipe">|</span> <a href="music.html" class="header">music</a> <span id="pipe" class="pipe">|</span> <a href="authors.html" class="header"> authors</a> <span id="pipe" class="pipe">|</span> <a href="reviews.html" class="header">reviews</a> <span id="pipe" class="pipe">| </span> <a href="buythebook.html" class="header">buy the book</a> </div> <div id="bgimage" class="bgimage" style="background-image: url(images/introduction.jpg);"> <div id="textdiv" style="position: relative; left: 550px; width: 305px; top: 100px;" > <p>"It's a beautiful and important work recommended <br> to anyone who cares about how ordinary outsiders <br> get by and get over."</p> <p>Robert Christgau, the LA Times</p> <p> </p> <p>"Music , for most of my students, is the only remaining creative activity they can understand, aside from computer graphics and comics. <i>Bright Balkan Morning</i> manages to get past their illiteracy."</p> <p>Robert K. Dentan, Anthropologist </p> </div> </div> <div id="footer" class="footer">Copyright 2023 Bright Balkan Morning. All rights reserved. Site design by Shilpa Singru.</div></body></html>
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.pangeafiltration.com
2024-07-06 07:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:02:14 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-UA-Compatible: IE=edge X-Redirect-By: WordPress Content-Security-Policy: upgrade-insecure-requests Location: https://pangeafiltration.com/ Cache-Control: max-age=300 Expires: Sat, 06 Jul 2024 07:07:13 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.flatbin.com
2024-07-06 07:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:02:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://hatvisuals.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:02:11 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · embracingthesunlight.evangelineamel.com
2024-07-06 07:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:02:12 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Accept-Encoding,Cookie X-Redirect-By: WordPress Location: https://embracingthesunlight.com/ host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.gotogordon.com
2024-07-06 07:02
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:02:09 GMT Server: Apache X-Pingback: https://gotogordoncomputers.com/xmlrpc.php X-Redirect-By: WordPress Upgrade: h2,h2c Connection: Upgrade, close Location: https://gotogordoncomputers.com/ Cache-Control: max-age=3600 Expires: Sat, 06 Jul 2024 08:02:09 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: Content-Length: 0 Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · sim-tel.com.au
2024-07-06 06:59
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 07:00:06 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://www.sim-tel.com.au/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 09:00:01 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.thepumpkinbatch.serenafedor.com
2024-07-06 06:59
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 06:59:09 GMT Server: Apache Cache-Control: no-store, no-cache, must-revalidate Upgrade: h2,h2c Connection: Upgrade, close Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 Page title: The Pumpkin Batch — Coming Soon <!DOCTYPE html> <html lang="en-US"> <head> <meta name="viewport" content="width=device-width"> <meta name="robots" content="noindex, nofollow" /> <title>The Pumpkin Batch — Coming Soon</title> <script src="https://thepumpkinbatch.com/wp-includes/js/jquery/jquery.js"></script> <style type="text/css">* { box-sizing: border-box; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; } body { background-color: white; color: black; overflow-x: hidden; margin: 0; } #wrap { align-items: center; display: flex; justify-content: center; min-height: 100vh; } .content { flex: 1; margin: auto 5%; padding: 0; text-align: center; max-width: 420px; } footer { width: 100%; position: fixed; bottom: 0; left: 0; } footer p { text-align: center; } .btn { background: black; background-image: none; border: 1px solid black; box-shadow: none; color: white; cursor: pointer; display: inline-block; font-size: 14px; font-weight: 400; line-height: 1.5; margin-top: 10px; padding: 6px 30px; text-align: center; text-decoration: none; touch-action: manipulation; transition: all 0.2s ease; user-select: none; vertical-align: middle; white-space: nowrap; } .status-message { display: none; }</style> <link rel="stylesheet" href="https://thepumpkinbatch.com/wp-content/plugins/bluehost-wordpress-plugin/assets/styles/coming-soon.css?v=3.12.1" /> </head> <body> <div id="wrap"> <main class="content"> <div class="subscription_widget"> <h1>Coming Soon!</h1> <h2>A New WordPress Site</h2> <p class="comingsoon_links"><a href="https://www.bluehost.com/blog/how-to-create-a-website-guide/" target="_blank" rel="noopener noreferrer nofollow">How to Build a Website: A Practical Guide to WordPress on Bluehost</a><br /><a href="https://www.bluehost.com/blog/how-to-migrate-a-wordpress-website-to-a-new-server/" target="_blank" rel="noopener noreferrer nofollow">How to Migrate a Website to Bluehost?</a><br /><a href="https://www.bluehost.com/hosting/shared" target="_blank" rel="noopener noreferrer nofollow">Why choose Bluehost for your WordPress site?</a><br /></p> </div> </main> </div> <footer> <p class="text-center"> A <a href="https://bluehost.com?utm_source=coming-soon-template&utm_medium=bluehost_plugin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a> powered website. Is this your website? Log in to <a href="https://thepumpkinbatch.com/wp-login.php">WordPress</a> or <a href="https://my.bluehost.com/web-hosting/cplogin" target="_blank" rel="noopener noreferrer nofollow">Bluehost</a>. </p> </footer> </body> </html>Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.discountbargainmalestrippers.taradactyldesign.com
2024-07-06 06:59
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 06:59:10 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Expires: Wed, 11 Jan 1984 05:00:00 GMT Cache-Control: no-cache, must-revalidate, max-age=0 Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked <!DOCTYPE html> <html class="sp-html sp-is-mobile sp-seedprod sp-h-full" lang="en-US"> <head> <!-- Open Graph --> <meta property="og:url" content="https://www.discountbargainmalestrippers.taradactyldesign.com/" /> <meta property="og:type" content="website" /> <!-- Twitter Card --> <meta name="twitter:card" content="summary" /> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <!-- Default CSS --> <link rel='stylesheet' id='seedprod-css-css' href='https://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/css/tailwind.min.css?ver=6.15.7' type='text/css' media='all' /> <link rel='stylesheet' id='seedprod-fontawesome-css' href='https://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/fontawesome/css/all.min.css?ver=6.15.7' type='text/css' media='all' /> <!-- Google Font --> <link rel="stylesheet" href="https://fonts.googleapis.com/css?family=Averia+Libre:700|Dosis:600|Open+Sans+Condensed:300|Great+Vibes:400&display=swap"> <!-- Global Styles --> <style> #sp-page{color:#FFFFFF} #sp-page .sp-header-tag-h1,#sp-page .sp-header-tag-h2,#sp-page .sp-header-tag-h3,#sp-page .sp-header-tag-h4,#sp-page .sp-header-tag-h5,#sp-page .sp-header-tag-h6{color:#FFFFFF}#sp-page h1,#sp-page h2,#sp-page h3,#sp-page h4,#sp-page h5,#sp-page h6{color:#FFFFFF; font-family:'Great Vibes';font-weight:400;font-style:normal} #sp-page a{color:#5699CC} #sp-page a:hover{color:#3780b8}#sp-page .btn{background-color:#5699CC}body{background-color:#FFFFFF !important; background-image:url('https://discountbargainmalestrippers.com/wp-content/uploads/2023/03/1000D7C9-03A3-4321-B484-22F34D2EF201_1_105_c.jpeg');} @media only screen and (max-width: 480px) { #sp-niijfv {height:60px !important;} #sp-xp7nhn {text-align:center !important;} #sp-jknss8 {height:60px !important;} .sp-headline-block-y0sc75, #sp-y0sc75, #y0sc75 {text-align:center !important;} .sp-headline-block-t95iwn, #sp-t95iwn, #t95iwn {text-align:center !important;} .sp-text-wrapper-p7ef8k, #sp-p7ef8k, #p7ef8k {text-align:left !important;} #sp-d4et4f {height:60px !important;} #sp-button-parent-q09cvl {text-align:center !important;} #sp-qkrns1 {height:60px !important;} } @media only screen and (min-width: 480px) { } </style> <!-- JS --> <script> </script> <script src="https://discountbargainmalestrippers.com/wp-content/plugins/coming-soon/public/js/sp-scripts.min.js" defer></script> <script src="https://discountbargainmalestrippers.com/wp-includes/js/jquery/jquery.min.js"></script> </head> <body class="spBgcover sp-h-full sp-antialiased sp-bg-slideshow"> <div id="sp-page" class="spBgcover sp-content-4" style="background-color: rgb(255, 255, 255); background-image: url('https://discountbargainmalestrippers.com/wp-content/uploads/2023/03/1000D7C9-03A3-4321-B484-22F34D2EF201_1_105_c.jpeg'); font-family: 'Open Sans Condensed', sans-serif; font-weight: 300;"><section id="sp-ks8a8s" class="sp-el-section " style="width: 1024px; max-width: 100%; padding: 10px; border-radius: 10px;"><pre ></pre><div id="sp-vw3kvy" class="sp-el-row sm:sp-flex sp-w-full sp-m-auto sp-justify-between" style="padding: 0px; width: auto; max-width: 1000px; background-color: rgba(0, 0, 0, 0.35);"><pre ></pre><div id="sp-ovbx1s" class="sp-el-col sp-w-full " style="width: calc(100% - 0px);"><pre ></pre><style type="text/css"> #sp-ovbx1s .sp-col-top .seedprod-shape-fill {fill: undefined;} #sp-ovbx1s .sp-col-top svg {width: undefined%;height: undefinedpx;transform: translateX(-50%);} #sp-ovbx1s .sp-col-bottom .seedprod-shape-fill {fill: undefined;} #sp-ovbx1s .sp-col-bottom svg {width: undefined%;height: undefinedpx;transform: translateX(-50%);} </style><div class="sp-col-shape sp-col-top" style="z-index: 0;"><div></div></div><div class="sp-col-shape sp-col-bottom" style="z-index: 0;"><div></div></div><div id="sp-niijfv" class="sp-spacer" style="height: 12px;"></div><figure id="sp-xp7nhn" class="sp-image-wrapper sp-Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · mail.holywaterwashes.com
2024-07-06 06:59
HTTP/1.1 301 Moved Permanently Date: Sat, 06 Jul 2024 06:59:04 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Redirect-By: WordPress Location: https://holywaterwashes.com/ Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 08:59:03 GMT host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== Referrer-Policy: no-referrer-when-downgrade X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.softwarelibre.org.bo
2024-07-06 06:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 06:58:54 GMT Server: Apache Vary: Accept-Encoding,Cookie Link: <https://www.softwarelibre.org.bo/wp-json/>; rel="https://api.w.org/", <https://wp.me/4YSoW>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.summaries-wiki.simplywebseo.com
2024-07-06 06:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 06:58:52 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://summaries.wiki/wp-json/>; rel="https://api.w.org/" Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 08:58:51 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 2 X-nginx-cache: WordPress X-Newfold-Cache-Level: 2 X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · bgsclassof96.com
2024-07-06 06:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 06:58:58 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 X-LiteSpeed-Tag: de6_HTTP.200 X-Pingback: https://bgsclassof96.com/xmlrpc.php Link: <https://bgsclassof96.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://bgsclassof96.com/index.php?rest_route=/wp/v2/pages/2>; rel="alternate"; type="application/json", <https://bgsclassof96.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress X-Server-Cache: true X-Proxy-Cache: MISS Transfer-Encoding: chunked
Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · braunleder.com
2024-07-06 06:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 06:58:47 GMT Server: nginx/1.21.6 Content-Type: text/html; charset=UTF-8 Link: <https://braunleder.com/wp-json/>; rel="https://api.w.org/", <https://braunleder.com/wp-json/wp/v2/pages/2318>; rel="alternate"; type="application/json", <https://braunleder.com/>; rel=shortlink Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Server-Cache: true X-Proxy-Cache: MISS Set-Cookie: PHPSESSID=45dbeece8efa00bc78e2c23e9e6aab9a; path=/ Transfer-Encoding: chunked Page title: Alexander Braunleder – Live a life by design <!DOCTYPE html> <html lang="en-US" class="html_stretched responsive av-preloader-disabled av-default-lightbox html_header_top html_logo_left html_main_nav_header html_menu_right html_slim html_header_sticky html_header_shrinking_disabled html_mobile_menu_phone html_header_searchicon html_content_align_center html_header_unstick_top_disabled html_header_stretch_disabled html_av-overlay-side html_av-overlay-side-classic html_av-submenu-noclone html_entry_id_2318 av-cookies-no-cookie-consent av-no-preview html_text_menu_active "> <head> <meta charset="UTF-8" /> <meta name="robots" content="index, follow" /> <!-- mobile setting --> <meta name="viewport" content="width=device-width, initial-scale=1"> <!-- Scripts/CSS and wp_head hook --> <title>Alexander Braunleder – Live a life by design</title> <meta name='robots' content='max-image-preview:large' /> <link rel='dns-prefetch' href='//i0.wp.com' /> <link rel="alternate" type="application/rss+xml" title="Alexander Braunleder » Feed" href="https://braunleder.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Alexander Braunleder » Comments Feed" href="https://braunleder.com/comments/feed/" /> <!-- This site uses the Google Analytics by MonsterInsights plugin v8.25.0 - Using Analytics tracking - https://www.monsterinsights.com/ --> <!-- Note: MonsterInsights is not currently configured on this site. The site owner needs to authenticate with Google Analytics in the MonsterInsights settings panel. --> <!-- No tracking code set --> <!-- / Google Analytics by MonsterInsights --> <!-- google webfont font replacement --> <script type='text/javascript'> (function() { /* check if webfonts are disabled by user setting via cookie - or user must opt in. */ var html = document.getElementsByTagName('html')[0]; var cookie_check = html.className.indexOf('av-cookies-needs-opt-in') >= 0 || html.className.indexOf('av-cookies-can-opt-out') >= 0; var allow_continue = true; var silent_accept_cookie = html.className.indexOf('av-cookies-user-silent-accept') >= 0; if( cookie_check && ! silent_accept_cookie ) { if( ! document.cookie.match(/aviaCookieConsent/) || html.className.indexOf('av-cookies-session-refused') >= 0 ) { allow_continue = false; } else { if( ! document.cookie.match(/aviaPrivacyRefuseCookiesHideBar/) ) { allow_continue = false; } else if( ! document.cookie.match(/aviaPrivacyEssentialCookiesEnabled/) ) { allow_continue = false; } else if( document.cookie.match(/aviaPrivacyGoogleWebfontsDisabled/) ) { allow_continue = false; } } } if( allow_continue ) { var f = document.createElement('link'); f.type = 'text/css'; f.rel = 'stylesheet'; f.href = '//fonts.googleapis.com/css?family=Lato:300,400,700%7COpen+Sans:400,600'; f.id = 'avia-google-webfont'; document.getElementsByTagName('head')[0].appendChild(f); } })(); </script> <script type="text/javascript"> /* <![CDATA[ */ window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/15.0.3\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/braunleder.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.5.5"}}; /*! This file is auto-generated */ !function(i,n){var o,s,e;function c(e){try{var t={supportTests:e,timestamp:(new Date).valueOf()};sessionStorage.setItem(o,JSON.stringify(t))}catch(e){}}function p(e,t,n){e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(t,0,0);var t=new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data),r=(e.clearRect(0,0,e.canvas.width,e.canvas.height),e.fillText(n,0,0),new Uint32Array(e.getImageData(0,0,e.canvas.width,e.canvas.height).data));return t.every(function(e,t){return e===r[t]})}function u(e,t,n){switch(t){case"flag":return n(e,"\ud83c\udff3\ufe0f\u200d\u26a7\ufe0Found 6 hours ago by HttpPluginCreate report
-
Open service 162.241.252.95:443 · www.fruitfulfoodforestry.artofrv.com
2024-07-06 06:58
HTTP/1.1 200 OK Date: Sat, 06 Jul 2024 06:58:44 GMT Server: Apache Link: <https://fruitfulfoodforestry.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://fruitfulfoodforestry.com/index.php?rest_route=/wp/v2/pages/119>; rel="alternate"; type="application/json", <https://fruitfulfoodforestry.com/>; rel=shortlink Upgrade: h2,h2c Connection: Upgrade, close Cache-Control: max-age=7200 Expires: Sat, 06 Jul 2024 08:58:44 GMT Vary: Accept-Encoding host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ== X-Endurance-Cache-Level: 0 X-nginx-cache: WordPress Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8
Found 6 hours ago by HttpPluginCreate report
andrewformountvernon.comandrewformountvernon.taradactyldesign.comautodiscover.andrewformountvernon.comautodiscover.discountbargainmalestrippers.comcpanel.andrewformountvernon.comcpanel.discountbargainmalestrippers.comcpcalendars.andrewformountvernon.comcpcalendars.discountbargainmalestrippers.comcpcontacts.andrewformountvernon.comcpcontacts.discountbargainmalestrippers.comdiscountbargainmalestrippers.comdiscountbargainmalestrippers.taradactyldesign.commail.andrewformountvernon.commail.discountbargainmalestrippers.comwebdisk.andrewformountvernon.comwebdisk.discountbargainmalestrippers.comwebmail.andrewformountvernon.comwebmail.discountbargainmalestrippers.comwww.andrewformountvernon.comwww.andrewformountvernon.taradactyldesign.comwww.discountbargainmalestrippers.comwww.discountbargainmalestrippers.taradactyldesign.com
autodiscover.taleofmylife.comcpanel.taleofmylife.comcpcalendars.taleofmylife.comcpcontacts.taleofmylife.commail.taleofmylife.comtaleofmylife.comtaleofmylife.davolynindustries.comwebdisk.taleofmylife.comwebmail.taleofmylife.comwww.taleofmylife.comwww.taleofmylife.davolynindustries.com
artofrv.comautodiscover.artofrv.comcpanel.artofrv.comcpcalendars.artofrv.comcpcontacts.artofrv.commail.artofrv.comwebdisk.artofrv.comwebmail.artofrv.comwww.artofrv.com
autodiscover.theveggieguys.netcpanel.theveggieguys.netcpcalendars.theveggieguys.netcpcontacts.theveggieguys.netmail.theveggieguys.nettheveggieguys.netwebdisk.theveggieguys.netwebmail.theveggieguys.netwww.theveggieguys.net
autodiscover.furlanication.comautodiscover.leavingisliving.comcpanel.furlanication.comcpanel.leavingisliving.comcpcalendars.furlanication.comcpcalendars.leavingisliving.comcpcontacts.furlanication.comcpcontacts.leavingisliving.comfurlanication.adaptivebytes.comfurlanication.comleavingisliving.adaptivebytes.comleavingisliving.commail.furlanication.commail.leavingisliving.comwebdisk.furlanication.comwebdisk.leavingisliving.comwebmail.furlanication.comwebmail.leavingisliving.comwww.furlanication.adaptivebytes.comwww.furlanication.comwww.leavingisliving.adaptivebytes.comwww.leavingisliving.com
cpanel.tracerntnwidelog.comcpcalendars.tracerntnwidelog.comcpcontacts.tracerntnwidelog.commail.tracerntnwidelog.comrolenmgtservices.tracerntnwidelog.comtracerntnwidelog.comwebdisk.tracerntnwidelog.comwebmail.tracerntnwidelog.comwww.rolenmgtservices.tracerntnwidelog.comwww.tracerntnwidelog.com
asndi.comasndi.orgautodiscover.asndi.orgautodiscover.rsmrf.comcpanel.asndi.orgcpanel.rsmrf.comcpcalendars.asndi.orgcpcalendars.rsmrf.comcpcontacts.asndi.orgcpcontacts.rsmrf.commail.asndi.commail.asndi.orgmail.rsmrf.comrsmrf.asndi.orgrsmrf.comwebdisk.asndi.orgwebdisk.rsmrf.comwebmail.asndi.orgwebmail.rsmrf.comwww.asndi.comwww.asndi.orgwww.rsmrf.asndi.orgwww.rsmrf.com
ak-fam.ammanetwork.orgak-fam.comammaarquitectura.ammanetwork.orgammaarquitectura.comautodiscover.ak-fam.comautodiscover.ammaarquitectura.comcpanel.ak-fam.comcpanel.ammaarquitectura.comcpcalendars.ak-fam.comcpcalendars.ammaarquitectura.comcpcontacts.ak-fam.comcpcontacts.ammaarquitectura.commail.ak-fam.commail.ammaarquitectura.comwebdisk.ak-fam.comwebdisk.ammaarquitectura.comwebmail.ak-fam.comwebmail.ammaarquitectura.comwww.ak-fam.ammanetwork.orgwww.ak-fam.comwww.ammaarquitectura.ammanetwork.orgwww.ammaarquitectura.com
autodiscover.sim-tel.com.aucpanel.sim-tel.com.aucpcalendars.sim-tel.com.aucpcontacts.sim-tel.com.aumail.sim-tel.com.ausim-tel-com-au.freeautoelectrician.com.ausim-tel.com.auwebdisk.sim-tel.com.auwebmail.sim-tel.com.auwww.sim-tel-com-au.freeautoelectrician.com.auwww.sim-tel.com.au
biovanish.revsz.comclaritoxpro.revsz.comglucofort.revsz.comikariagummies.revsz.comquietplus.revsz.comrevisil.revsz.comsonuvita.revsz.comstrictiond.revsz.comsugarbalance.revsz.comtest.revsz.comwisdomnutrition.revsz.comwisdomsupplement.revsz.comwww.biovanish.revsz.comwww.claritoxpro.revsz.comwww.glucofort.revsz.comwww.ikariagummies.revsz.comwww.quietplus.revsz.comwww.revisil.revsz.comwww.sonuvita.revsz.comwww.strictiond.revsz.comwww.sugarbalance.revsz.comwww.test.revsz.comwww.wisdomnutrition.revsz.comwww.wisdomsupplement.revsz.com
autodiscover.embracingthesunlight.comautodiscover.evangelineamel.comcpanel.embracingthesunlight.comcpanel.evangelineamel.comcpcalendars.embracingthesunlight.comcpcalendars.evangelineamel.comcpcontacts.embracingthesunlight.comcpcontacts.evangelineamel.comembracingthesunlight.comembracingthesunlight.evangelineamel.comevangelineamel.commail.embracingthesunlight.commail.evangelineamel.comwebdisk.embracingthesunlight.comwebdisk.evangelineamel.comwebmail.embracingthesunlight.comwebmail.evangelineamel.comwww.embracingthesunlight.comwww.embracingthesunlight.evangelineamel.comwww.evangelineamel.com
clearsound911.revsz.comjointpainhack.revsz.commarined3.revsz.comultraomegaburn.revsz.comwww.clearsound911.revsz.comwww.jointpainhack.revsz.comwww.marined3.revsz.comwww.ultraomegaburn.revsz.com
cpanel.tetradevelopment.comcpanel.tetrasteelworx.comcpcalendars.tetradevelopment.comcpcalendars.tetrasteelworx.comcpcontacts.tetradevelopment.comcpcontacts.tetrasteelworx.commail.tetrasteelworx.comtetradevelopment.comtetradevelopment.guidingpc.comtetrasteelworx.comtetrasteelworx.guidingpc.comwebdisk.tetradevelopment.comwebdisk.tetrasteelworx.comwebmail.tetradevelopment.comwebmail.tetrasteelworx.comwww.tetradevelopment.comwww.tetradevelopment.guidingpc.comwww.tetrasteelworx.comwww.tetrasteelworx.guidingpc.com
serolean.trefort.netwisdom.trefort.netwww.serolean.trefort.netwww.wisdom.trefort.net
mysilverlinings-me.j4oilers.comwww.mysilverlinings-me.j4oilers.com
test.healthmediapolicy.comwww.test.healthmediapolicy.com
autodiscover.enlitedesign.comcpanel.enlitedesign.comcpcalendars.enlitedesign.comcpcontacts.enlitedesign.comenlitedesign.commail.enlitedesign.commail.nightlightguy.comnightlightguy.comwebdisk.enlitedesign.comwebmail.enlitedesign.comwww.enlitedesign.comwww.nightlightguy.com
mollymarcin.comwww.mollymarcin.com
stallfreepropellers.comwww.stallfreepropellers.com
adventuristmoto.comautodiscover.adventuristmoto.comcpanel.adventuristmoto.comcpcalendars.adventuristmoto.comcpcontacts.adventuristmoto.commail.adventuristmoto.comwebdisk.adventuristmoto.comwebmail.adventuristmoto.comwww.adventuristmoto.com
autodiscover.digitalnomadsasia.netcpanel.digitalnomadsasia.netcpcalendars.digitalnomadsasia.netcpcontacts.digitalnomadsasia.netdigitalnomadsasia.netmail.digitalnomadsasia.netwebdisk.digitalnomadsasia.netwebmail.digitalnomadsasia.netwww.digitalnomadsasia.net
appetitesabroad.comappetitesathome.appetitesabroad.comappetitesathome.comautodiscover.appetitesabroad.comautodiscover.appetitesathome.comcpanel.appetitesabroad.comcpanel.appetitesathome.comcpcalendars.appetitesabroad.comcpcalendars.appetitesathome.comcpcontacts.appetitesabroad.comcpcontacts.appetitesathome.commail.appetitesabroad.commail.appetitesathome.commail.thewanderingdragons.comthewanderingdragons.comwebdisk.appetitesabroad.comwebdisk.appetitesathome.comwebmail.appetitesabroad.comwebmail.appetitesathome.comwww.appetitesabroad.comwww.appetitesathome.appetitesabroad.comwww.appetitesathome.comwww.thewanderingdragons.com
autodiscover.thebrandstand.coautodiscover.wildacornapothecary.comcpanel.thebrandstand.cocpanel.wildacornapothecary.comcpcalendars.thebrandstand.cocpcalendars.wildacornapothecary.comcpcontacts.thebrandstand.cocpcontacts.wildacornapothecary.commail.thebrandstand.comail.thebrndstnd.commail.wildacornapothecary.comthebrandstand.cothebrndstnd.comwebdisk.thebrandstand.cowebdisk.wildacornapothecary.comwebmail.thebrandstand.cowebmail.wildacornapothecary.comwildacornapothecary.comwildacornapothecary.thebrandstand.cowww.thebrandstand.cowww.thebrndstnd.comwww.wildacornapothecary.comwww.wildacornapothecary.thebrandstand.co
art-beats.comcpanel.art-beats.comcpcalendars.art-beats.comcpcontacts.art-beats.commail.art-beats.comwebdisk.art-beats.comwebmail.art-beats.comwww.art-beats.com
autodiscover.christiansthatparty.comchristiansthatparty.comcpanel.christiansthatparty.comcpcalendars.christiansthatparty.comcpcontacts.christiansthatparty.commail.christiansthatparty.comwebdisk.christiansthatparty.comwebmail.christiansthatparty.comwww.christiansthatparty.com
abbybell-org.bellcreativeco.comabbybell.orgautodiscover.abbybell.orgcpanel.abbybell.orgcpcalendars.abbybell.orgcpcontacts.abbybell.orgmail.abbybell.orgwebdisk.abbybell.orgwebmail.abbybell.orgwww.abbybell-org.bellcreativeco.comwww.abbybell.org
autodiscover.phillylicensedcontractor.comautodiscover.switchcraftelectric.comcpanel.phillylicensedcontractor.comcpanel.switchcraftelectric.comcpcalendars.phillylicensedcontractor.comcpcalendars.switchcraftelectric.comcpcontacts.phillylicensedcontractor.comcpcontacts.switchcraftelectric.comelectrical.phillylicensedcontractor.comfuturewidgets.phillylicensedcontractor.commail.phillylicensedcontractor.commail.switchcraftelectric.comphillylicensedcontractor.comswitchcraftelectric.comswitchcraftelectric.phillylicensedcontractor.comwebdisk.phillylicensedcontractor.comwebdisk.switchcraftelectric.comwebmail.phillylicensedcontractor.comwebmail.switchcraftelectric.comwww.electrical.phillylicensedcontractor.comwww.futurewidgets.phillylicensedcontractor.comwww.phillylicensedcontractor.comwww.switchcraftelectric.comwww.switchcraftelectric.phillylicensedcontractor.com
autodiscover.transformativesolutionsnetwork.orgcpanel.transformativesolutionsnetwork.orgcpcalendars.transformativesolutionsnetwork.orgcpcontacts.transformativesolutionsnetwork.orgmail.transformativesolutionsnetwork.orgtransformativesolutionsnetwork-org.tsnpa.infotransformativesolutionsnetwork.orgwebdisk.transformativesolutionsnetwork.orgwebmail.transformativesolutionsnetwork.orgwww.transformativesolutionsnetwork-org.tsnpa.infowww.transformativesolutionsnetwork.org
airphones.revsz.comcoolhandle.revsz.comdiabacore.revsz.comdivinevision12.revsz.comgaiasprotocol.revsz.comherpesyl.revsz.comhidemyass.revsz.comlightsanitizer.revsz.commeticore.revsz.comneurocalmpro.revsz.comsilencil.revsz.comsynapsext.revsz.comwww.airphones.revsz.comwww.coolhandle.revsz.comwww.diabacore.revsz.comwww.divinevision12.revsz.comwww.gaiasprotocol.revsz.comwww.herpesyl.revsz.comwww.hidemyass.revsz.comwww.lightsanitizer.revsz.comwww.meticore.revsz.comwww.neurocalmpro.revsz.comwww.silencil.revsz.comwww.synapsext.revsz.com
autodiscover.beautyandhairtips.comautodiscover.koinoniabs.combeautyandhairtips.combeautyandhairtips.revsz.comcpanel.beautyandhairtips.comcpanel.koinoniabs.comcpcalendars.beautyandhairtips.comcpcalendars.koinoniabs.comcpcontacts.beautyandhairtips.comcpcontacts.koinoniabs.comkeragenis.revsz.comkoinoniabs.commail.beautyandhairtips.commail.koinoniabs.comwebdisk.beautyandhairtips.comwebdisk.koinoniabs.comwebmail.beautyandhairtips.comwebmail.koinoniabs.comwebsite-02680b9d.revsz.comwww.beautyandhairtips.comwww.beautyandhairtips.revsz.comwww.keragenis.revsz.comwww.koinoniabs.comwww.website-02680b9d.revsz.com
alimeliah.alisonmeliahphotography.comalimeliah.comalisonmeliahphotography.comautodiscover.alimeliah.comautodiscover.alisonmeliahphotography.comcpanel.alimeliah.comcpanel.alisonmeliahphotography.comcpcalendars.alimeliah.comcpcalendars.alisonmeliahphotography.comcpcontacts.alimeliah.comcpcontacts.alisonmeliahphotography.commail.alimeliah.commail.alisonmeliahphotography.comwebdisk.alimeliah.comwebdisk.alisonmeliahphotography.comwebmail.alimeliah.comwebmail.alisonmeliahphotography.comwww.alimeliah.alisonmeliahphotography.comwww.alimeliah.comwww.alisonmeliahphotography.com
autodiscover.elsakristen.comautodiscover.protectingpollinators.orgcpanel.elsakristen.comcpanel.protectingpollinators.orgcpcalendars.elsakristen.comcpcalendars.protectingpollinators.orgcpcontacts.elsakristen.comcpcontacts.protectingpollinators.orgelsakristen.comelsakristen.rda.ruz.mybluehost.memail.elsakristen.commail.protectingpollinators.orgprotectingpollinators-org.rda.ruz.mybluehost.meprotectingpollinators.orgwebdisk.elsakristen.comwebdisk.protectingpollinators.orgwebmail.elsakristen.comwebmail.protectingpollinators.orgwww.elsakristen.comwww.elsakristen.rda.ruz.mybluehost.mewww.protectingpollinators-org.rda.ruz.mybluehost.mewww.protectingpollinators.org
4irmicrogrid.com4irmicrogrid.whcapitalleasing.comautodiscover.4irmicrogrid.comautodiscover.whcapitalleasing.comcpanel.4irmicrogrid.comcpanel.whcapitalleasing.comcpcalendars.4irmicrogrid.comcpcalendars.whcapitalleasing.comcpcontacts.4irmicrogrid.comcpcontacts.whcapitalleasing.commail.4irmicrogrid.commail.whcapitalleasing.comwebdisk.4irmicrogrid.comwebdisk.whcapitalleasing.comwebmail.4irmicrogrid.comwebmail.whcapitalleasing.comwhcapitalleasing.comwww.4irmicrogrid.comwww.4irmicrogrid.whcapitalleasing.comwww.whcapitalleasing.com
autodiscover.stevenkleindds.comcpanel.stevenkleindds.comcpcalendars.stevenkleindds.comcpcontacts.stevenkleindds.commail.stevenkleindds.comstevenkleindds.comstevenkleindds.madsenadvertising.comwebdisk.stevenkleindds.comwebmail.stevenkleindds.comwww.stevenkleindds.comwww.stevenkleindds.madsenadvertising.com
altaibalance.revsz.combrainsavior.revsz.comglucodyn.revsz.commellitox.revsz.comringhush.revsz.comvitalflow.revsz.comwww.altaibalance.revsz.comwww.brainsavior.revsz.comwww.glucodyn.revsz.comwww.mellitox.revsz.comwww.ringhush.revsz.comwww.vitalflow.revsz.com
autodiscover.foc.ehs.mybluehost.mecpanel.foc.ehs.mybluehost.mecpcalendars.foc.ehs.mybluehost.mecpcontacts.foc.ehs.mybluehost.mefoc.ehs.mybluehost.memail.foc.ehs.mybluehost.mewebdisk.foc.ehs.mybluehost.mewebmail.foc.ehs.mybluehost.mewww.foc.ehs.mybluehost.me
cpanel.justsmokinbarbecue.comcpcalendars.justsmokinbarbecue.comcpcontacts.justsmokinbarbecue.comjustsmokinbarbecue.commail.justsmokinbarbecue.comwebdisk.justsmokinbarbecue.comwebmail.justsmokinbarbecue.comwww.justsmokinbarbecue.com
autodiscover.nbg.ehs.mybluehost.meautodiscover.tangithomas.comcpanel.nbg.ehs.mybluehost.mecpanel.tangithomas.comcpcalendars.nbg.ehs.mybluehost.mecpcalendars.tangithomas.comcpcontacts.nbg.ehs.mybluehost.mecpcontacts.tangithomas.commail.nbg.ehs.mybluehost.memail.tangithomas.comnbg.ehs.mybluehost.metangithomas.comtangithomas.nbg.ehs.mybluehost.mewebdisk.nbg.ehs.mybluehost.mewebdisk.tangithomas.comwebmail.nbg.ehs.mybluehost.mewebmail.tangithomas.comwww.nbg.ehs.mybluehost.mewww.tangithomas.comwww.tangithomas.nbg.ehs.mybluehost.me
autodiscover.hsgfarm.combakersfieldplumbingco.legendinx.comcpanel.hsgfarm.comcpanel.legendinx.comcpcalendars.hsgfarm.comcpcalendars.legendinx.comcpcontacts.hsgfarm.comcpcontacts.legendinx.comhsgfarm.comhsgfarm.legendinx.comlegendinx.commail.legendinx.commail.znb.ddq.mybluehost.mewebdisk.hsgfarm.comwebdisk.legendinx.comwebmail.hsgfarm.comwebmail.legendinx.comwww.bakersfieldplumbingco.legendinx.comwww.hsgfarm.comwww.hsgfarm.legendinx.comwww.legendinx.comwww.znb.ddq.mybluehost.meznb.ddq.mybluehost.me
jmghomeservices.soulsojourner.comwww.jmghomeservices.soulsojourner.com
autodiscover.stevensweldingnd.comcpanel.stevensweldingnd.comcpcalendars.stevensweldingnd.comcpcontacts.stevensweldingnd.commail.stevensweldingnd.comstevensweldingnd.biztechnd.comstevensweldingnd.comwebdisk.stevensweldingnd.comwebmail.stevensweldingnd.comwww.stevensweldingnd.biztechnd.comwww.stevensweldingnd.com
autodiscover.legionofreason.comautodiscover.randytysonphotography.comcpanel.legionofreason.comcpanel.randytysonphotography.comcpcalendars.legionofreason.comcpcalendars.randytysonphotography.comcpcontacts.legionofreason.comcpcontacts.randytysonphotography.comlegionofreason.commail.legionofreason.commail.randytysonphotography.comrandytysonphotography.comrandytysonphotography.legionofreason.comwebdisk.legionofreason.comwebdisk.randytysonphotography.comwebmail.legionofreason.comwebmail.randytysonphotography.comwww.legionofreason.comwww.randytysonphotography.comwww.randytysonphotography.legionofreason.com
meisinhardware.chuagh.netwww.meisinhardware.chuagh.net
alttransit.comalttransit.edianecapital.comautodiscover.alttransit.comcpanel.alttransit.comcpcalendars.alttransit.comcpcontacts.alttransit.commail.alttransit.comportal.edianecapital.comwebdisk.alttransit.comwebmail.alttransit.comwww.alttransit.comwww.alttransit.edianecapital.comwww.portal.edianecapital.com
cpanel.mothercluckincoops.comcpcalendars.mothercluckincoops.comcpcontacts.mothercluckincoops.comlongislandchickencoops.commail.longislandchickencoops.commail.mothercluckincoops.commothercluckincoops.comwebdisk.mothercluckincoops.comwebmail.mothercluckincoops.comwww.longislandchickencoops.comwww.mothercluckincoops.com
autodiscover.therealestatesharks.comcpanel.therealestatesharks.comcpcalendars.therealestatesharks.comcpcontacts.therealestatesharks.commail.therealestatesharks.comtherealestatesharks.comtherealestatesharks.lob.hnq.mybluehost.mewebdisk.therealestatesharks.comwebmail.therealestatesharks.comwww.therealestatesharks.comwww.therealestatesharks.lob.hnq.mybluehost.me
autodiscover.knightwaylimited.comcpanel.knightwaylimited.comcpcalendars.knightwaylimited.comcpcontacts.knightwaylimited.comknightwaylimited.commail.knightwaylimited.comwebdisk.knightwaylimited.comwebmail.knightwaylimited.comwww.knightwaylimited.com
autodiscover.pacificrimdoods.comcpanel.pacificrimdoods.comcpcalendars.pacificrimdoods.comcpcontacts.pacificrimdoods.commail.pacificrimdoods.compacificrimdoods.comwebdisk.pacificrimdoods.comwebmail.pacificrimdoods.comwebsite-b72e7fc9.pacificrimlabradoodles.comwww.pacificrimdoods.comwww.website-b72e7fc9.pacificrimlabradoodles.com
autodiscover.rochlinlc.comcpanel.rochlinlc.comcpcalendars.rochlinlc.comcpcontacts.rochlinlc.commail.rochlinlc.comrochlinlc.comwebdisk.rochlinlc.comwebmail.rochlinlc.comwww.rochlinlc.com
autodiscover.collectivesafety.comcollectivesafety.comcpanel.collectivesafety.comcpcalendars.collectivesafety.comcpcontacts.collectivesafety.commail.collectivesafety.comwebdisk.collectivesafety.comwebmail.collectivesafety.comwww.collectivesafety.com
greenwayoffice.comwww.greenwayoffice.com
autodiscover.marmabotanica.comcpanel.marmabotanica.comcpcalendars.marmabotanica.comcpcontacts.marmabotanica.commail.marmabotanica.commarmabotanica.commarmabotanica.sc-hosts.comwebdisk.marmabotanica.comwebmail.marmabotanica.comwww.marmabotanica.comwww.marmabotanica.sc-hosts.com
autodiscover.pianoclinic.comcpanel.pianoclinic.comcpcalendars.pianoclinic.comcpcontacts.pianoclinic.commail.pianoclinic.compianoclinic.comwebdisk.pianoclinic.comwebmail.pianoclinic.comwww.pianoclinic.com
cpanel.soyemi.comcpcalendars.soyemi.comcpcontacts.soyemi.commail.soyemi.comsoyemi.comthesoyemigroup.soyemi.comwebdisk.soyemi.comwebmail.soyemi.comwww.soyemi.comwww.thesoyemigroup.soyemi.com
autodiscover.summaries.wikicpanel.summaries.wikicpcalendars.summaries.wikicpcontacts.summaries.wikimail.summaries.wikisummaries-wiki.simplywebseo.comsummaries.wikiwebdisk.summaries.wikiwebmail.summaries.wikiwww.summaries-wiki.simplywebseo.comwww.summaries.wiki
cpanel.credicefi.com.docpcalendars.credicefi.com.docpcontacts.credicefi.com.docredicefi.com.domail.rnx.qiv.mybluehost.mernx.qiv.mybluehost.mewebdisk.credicefi.com.dowww.credicefi.com.dowww.rnx.qiv.mybluehost.me
autodiscover.farafaralosparceros.comautodiscover.meri-usa.comcpanel.farafaralosparceros.comcpanel.meri-usa.comcpcalendars.farafaralosparceros.comcpcalendars.meri-usa.comcpcontacts.farafaralosparceros.comcpcontacts.meri-usa.comfarafaralosparceros.comfarafaralosparceros.lno.rln.mybluehost.memail.farafaralosparceros.commail.meri-usa.commeri-usa.commeri-usa.lno.rln.mybluehost.mewebdisk.farafaralosparceros.comwebdisk.meri-usa.comwebmail.farafaralosparceros.comwebmail.meri-usa.comwww.farafaralosparceros.comwww.farafaralosparceros.lno.rln.mybluehost.mewww.meri-usa.comwww.meri-usa.lno.rln.mybluehost.me
autodiscover.dripstl.comcpanel.dripstl.comcpcalendars.dripstl.comcpcontacts.dripstl.comdripstl.addicteddopeness.netdripstl.commail.dripstl.comwebdisk.dripstl.comwebmail.dripstl.comwww.dripstl.addicteddopeness.netwww.dripstl.com
veryelderberry.artofrv.comwww.veryelderberry.artofrv.com
autodiscover.neweratreeservice.comautodiscover.thekicc.comcpanel.neweratreeservice.comcpanel.thekicc.comcpcalendars.neweratreeservice.comcpcalendars.thekicc.comcpcontacts.neweratreeservice.comcpcontacts.thekicc.commail.neweratreeservice.commail.thekicc.comneweratreeservice.comthekicc.comthekicc.legendinx.comwebdisk.neweratreeservice.comwebdisk.thekicc.comwebmail.neweratreeservice.comwebmail.thekicc.comwebsite-75ff82e5.legendinx.comwww.neweratreeservice.comwww.thekicc.comwww.thekicc.legendinx.comwww.website-75ff82e5.legendinx.com
autodiscover.estonishingevenings.comcpanel.estonishingevenings.comcpcalendars.estonishingevenings.comcpcontacts.estonishingevenings.comestonishingevenings.commail.estonishingevenings.comwebdisk.estonishingevenings.comwebmail.estonishingevenings.comwww.estonishingevenings.com
tienda.guatech.onlinewww.tienda.guatech.online
autodiscover.segurisk.com.bocpanel.segurisk.com.bocpcalendars.segurisk.com.bocpcontacts.segurisk.com.bomail.segurisk.com.bos.estebanlima.comsegurisk.com.bowebdisk.segurisk.com.bowebmail.segurisk.com.bowww.s.estebanlima.comwww.segurisk.com.bo
autodiscover.jackmanind.comcpanel.jackmanind.comcpcalendars.jackmanind.comcpcontacts.jackmanind.comjackmanind.comjackmanind.j4oilers.commail.jackmanind.commaster-flash.j4oilers.compipeflashing.j4oilers.comwebdisk.jackmanind.comwebmail.jackmanind.comwww.jackmanind.comwww.jackmanind.j4oilers.comwww.master-flash.j4oilers.comwww.pipeflashing.j4oilers.com
progenifix.trefort.netwww.progenifix.trefort.net
autodiscover.keativity.comcpanel.keativity.comcpcalendars.keativity.comcpcontacts.keativity.comkeativity.comkeativity.sc-hosts.commail.keativity.comwebdisk.keativity.comwebmail.keativity.comwww.keativity.comwww.keativity.sc-hosts.com
autodiscover.dialdelivers.comcpanel.dialdelivers.comcpcalendars.dialdelivers.comcpcontacts.dialdelivers.comdialdelivers.cedarwoodfarmstead.comdialdelivers.commail.dialdelivers.comwebdisk.dialdelivers.comwebmail.dialdelivers.comwww.dialdelivers.cedarwoodfarmstead.comwww.dialdelivers.com
cpanel.photographybysri.comcpcalendars.photographybysri.comcpcontacts.photographybysri.commail.photographybysri.comphotographybysri.comwebdisk.photographybysri.comwebmail.photographybysri.comwww.photographybysri.com
autodiscover.stereoinnovations.comcpanel.stereoinnovations.comcpcalendars.stereoinnovations.comcpcontacts.stereoinnovations.commail.stereoinnovations.comstereoinnovations.comwebdisk.stereoinnovations.comwebmail.stereoinnovations.comwww.stereoinnovations.com
autodiscover.sbo88m.comcpanel.sbo88m.comcpcalendars.sbo88m.comcpcontacts.sbo88m.commail.sbo88m.comsbo88m.comwebdisk.sbo88m.comwebmail.sbo88m.comwww.sbo88m.com
autodiscover.stuffwedo.blogcpanel.stuffwedo.blogcpcalendars.stuffwedo.blogcpcontacts.stuffwedo.blogmail.stuffwedo.blogstuffwedo.blogwebdisk.stuffwedo.blogwebmail.stuffwedo.blogwww.stuffwedo.blog
cpanel.tomfastrealty.comcpcalendars.tomfastrealty.comcpcontacts.tomfastrealty.commail.tomfastrealty.comtomfastrealty.comwebdisk.tomfastrealty.comwebmail.tomfastrealty.comwww.tomfastrealty.com
teamworkcares.comwww.teamworkcares.com
autodiscover.medinetone.comautodiscover.synapsesmedicals.comcpanel.medinetone.comcpanel.synapsesmedicals.comcpcalendars.medinetone.comcpcalendars.synapsesmedicals.comcpcontacts.medinetone.comcpcontacts.synapsesmedicals.comhealthfinance-ng.medinetone.commail.medinetone.commail.synapsesmedicals.commedinetone.comsynapsesmedicals.comsynapsesmedicals.medinetone.comwebdisk.medinetone.comwebdisk.synapsesmedicals.comwebmail.medinetone.comwebmail.synapsesmedicals.comwww.healthfinance-ng.medinetone.comwww.medinetone.comwww.synapsesmedicals.comwww.synapsesmedicals.medinetone.com
autodiscover.mclaincounseling.comcpanel.mclaincounseling.comcpcalendars.mclaincounseling.comcpcontacts.mclaincounseling.commail.mclaincounseling.commclaincounseling.comwebdisk.mclaincounseling.comwebmail.mclaincounseling.comwww.mclaincounseling.com
100k-crowd.co.ukcpanel.100k-crowd.co.ukcpcalendars.100k-crowd.co.ukcpcontacts.100k-crowd.co.ukmail.100k-crowd.co.ukwebdisk.100k-crowd.co.ukwebmail.100k-crowd.co.ukwww.100k-crowd.co.uk
autodiscover.lawanalysis.netcpcalendars.lawanalysis.netcpcontacts.lawanalysis.netmail.lawanalysis.netwebdisk.lawanalysis.net
autodiscover.momgiggles.comcpanel.momgiggles.comcpcalendars.momgiggles.comcpcontacts.momgiggles.commail.momgiggles.commomgiggles.comwebdisk.momgiggles.comwebmail.momgiggles.comwww.momgiggles.com
autodiscover.kneesaverpooltool.comcpanel.kneesaverpooltool.comcpcalendars.kneesaverpooltool.comcpcontacts.kneesaverpooltool.comkneesaverpooltool.comkneesaverpooltool.davolynindustries.commail.kneesaverpooltool.comwebdisk.kneesaverpooltool.comwebmail.kneesaverpooltool.comwww.kneesaverpooltool.comwww.kneesaverpooltool.davolynindustries.com
autodiscover.sgiusaaustin.orgcpanel.sgiusaaustin.orgcpcalendars.sgiusaaustin.orgcpcontacts.sgiusaaustin.orgmail.sgiusaaustin.orgsgiusaaustin.orgwebdisk.sgiusaaustin.orgwebmail.sgiusaaustin.orgwww.sgiusaaustin.org
autodiscover.wgv.ehs.mybluehost.mecpanel.wgv.ehs.mybluehost.mecpcalendars.wgv.ehs.mybluehost.mecpcontacts.wgv.ehs.mybluehost.memail.wgv.ehs.mybluehost.mewebdisk.wgv.ehs.mybluehost.mewebmail.wgv.ehs.mybluehost.mewgv.ehs.mybluehost.mewww.wgv.ehs.mybluehost.me
autodiscover.rmv.psw.mybluehost.mecpanel.rmv.psw.mybluehost.mecpcalendars.rmv.psw.mybluehost.mecpcontacts.rmv.psw.mybluehost.memail.rmv.psw.mybluehost.mermv.psw.mybluehost.mewebdisk.rmv.psw.mybluehost.mewebmail.rmv.psw.mybluehost.mewww.rmv.psw.mybluehost.me
autodiscover.bakingforcompliments.combakingforcompliments.combakingforcompliments.writeeditcopy.comcpanel.bakingforcompliments.comcpanel.writeeditcopy.comcpcalendars.bakingforcompliments.comcpcontacts.bakingforcompliments.commail.bakingforcompliments.commail.writeeditcopy.camail.writeeditcopy.comwebdisk.bakingforcompliments.comwebmail.bakingforcompliments.comwebmail.writeeditcopy.comwriteeditcopy.cawriteeditcopy.comwww.bakingforcompliments.comwww.bakingforcompliments.writeeditcopy.comwww.writeeditcopy.cawww.writeeditcopy.com
autodiscover.caldasyrios.comcaldasyrios.comcpanel.caldasyrios.comcpcalendars.caldasyrios.comcpcontacts.caldasyrios.commail.caldasyrios.comwebdisk.caldasyrios.comwebmail.caldasyrios.comwww.caldasyrios.com
autodiscover.hatvisuals.comcpanel.hatvisuals.comcpcalendars.hatvisuals.comcpcontacts.hatvisuals.comflatbin.comhatvisuals.comhelperinnovations.commail.flatbin.commail.hatvisuals.commail.helperinnovations.comwebdisk.hatvisuals.comwebmail.hatvisuals.comwww.flatbin.comwww.hatvisuals.comwww.helperinnovations.com
autodiscover.cid5280.comautodiscover.cleaningcompanydenverco.comcid5280.comcleaningcompanydenverco.cid5280.comcleaningcompanydenverco.comcpanel.cid5280.comcpanel.cleaningcompanydenverco.comcpcalendars.cid5280.comcpcalendars.cleaningcompanydenverco.comcpcontacts.cid5280.comcpcontacts.cleaningcompanydenverco.comhiy.ddq.mybluehost.memail.cid5280.commail.cleaningcompanydenverco.commail.hiy.ddq.mybluehost.mewebdisk.cid5280.comwebdisk.cleaningcompanydenverco.comwebmail.cid5280.comwebmail.cleaningcompanydenverco.comwww.cid5280.comwww.cleaningcompanydenverco.cid5280.comwww.cleaningcompanydenverco.comwww.hiy.ddq.mybluehost.me
autodiscover.pirate.coursescpanel.pirate.coursescpcalendars.pirate.coursescpcontacts.pirate.coursesmail.pirate.coursespirate-courses.simplywebseo.compirate.courseswebdisk.pirate.courseswebmail.pirate.courseswww.pirate-courses.simplywebseo.comwww.pirate.courses
autodiscover.dallengilman.comcpanel.dallengilman.comcpcalendars.dallengilman.comcpcontacts.dallengilman.comdallengilman.commail.dallengilman.comwebdisk.dallengilman.comwebmail.dallengilman.comwww.dallengilman.com
hvacunionnj.simplywebseo.comwww.hvacunionnj.simplywebseo.com
autodiscover.pragmate.comcpanel.pragmate.comcpcalendars.pragmate.comcpcontacts.pragmate.commail.pragmate.commail.vum.kdq.mybluehost.mepragmate.comvum.kdq.mybluehost.mewebdisk.pragmate.comwebmail.pragmate.comwww.pragmate.comwww.vum.kdq.mybluehost.me
cpanel.tetraig.comcpcalendars.tetraig.comcpcontacts.tetraig.commail.tetraig.comtetraig.comtetraig.guidingpc.comwebdisk.tetraig.comwebmail.tetraig.comwww.tetraig.comwww.tetraig.guidingpc.com
gkoled.comwww.gkoled.com
autodiscover.sterlinghard1.comcpanel.sterlinghard1.comcpcalendars.sterlinghard1.comcpcontacts.sterlinghard1.commail.sterlinghard1.comsterlinghard1.comwebdisk.sterlinghard1.comwebmail.sterlinghard1.comwebsite-43b8d4cd.legendinx.comwww.sterlinghard1.comwww.website-43b8d4cd.legendinx.com
alphavisage.revsz.combrainc-13.revsz.comc26booster.revsz.comcyabags.revsz.comdermacorrect.revsz.comgrowultra.revsz.comkratom.revsz.comlumaslim.revsz.comnutrisystem.revsz.complushbeds.revsz.comsmarttranslator.revsz.comtheramine.revsz.comwww.alphavisage.revsz.comwww.brainc-13.revsz.comwww.c26booster.revsz.comwww.cyabags.revsz.comwww.dermacorrect.revsz.comwww.growultra.revsz.comwww.kratom.revsz.comwww.lumaslim.revsz.comwww.nutrisystem.revsz.comwww.plushbeds.revsz.comwww.smarttranslator.revsz.comwww.theramine.revsz.com
resveratone.revsz.comwww.resveratone.revsz.com
5gmale.reviewz.orgautodiscover.reviewz.orgcla.reviewz.orgcpanel.reviewz.orgcpcalendars.reviewz.orgcpcontacts.reviewz.orgmail.reviewz.orgreviewz.orgwebdisk.reviewz.orgwebmail.reviewz.orgwebsite-46cf2538.revsz.comwww.5gmale.reviewz.orgwww.cla.reviewz.orgwww.reviewz.orgwww.website-46cf2538.revsz.com
autodiscover.ncnativebees.orgcpanel.ncnativebees.orgcpcalendars.ncnativebees.orgcpcontacts.ncnativebees.orgmail.ncnativebees.orgncnativebees-org.rda.ruz.mybluehost.mencnativebees.orgwebdisk.ncnativebees.orgwebmail.ncnativebees.orgwww.ncnativebees-org.rda.ruz.mybluehost.mewww.ncnativebees.org
autodiscover.mishkasocialservices.orgcpanel.mishkasocialservices.orgcpcalendars.mishkasocialservices.orgcpcontacts.mishkasocialservices.orgmail.mishkasocialservices.orgmishkasocialservices.orgwebdisk.mishkasocialservices.orgwebmail.mishkasocialservices.orgwww.mishkasocialservices.org
autodiscover.estebanlima.comcpanel.estebanlima.comcpcalendars.estebanlima.comcpcontacts.estebanlima.comestebanlima.commail.estebanlima.commail.uqk.fnp.mybluehost.meuqk.fnp.mybluehost.mewebdisk.estebanlima.comwebmail.estebanlima.comwww.estebanlima.comwww.uqk.fnp.mybluehost.me
autodiscover.klickzbysri.comcpanel.klickzbysri.comcpcalendars.klickzbysri.comcpcontacts.klickzbysri.comklickzbysri.comklickzbysri.photographybysri.commail.klickzbysri.comwebdisk.klickzbysri.comwebmail.klickzbysri.comwww.klickzbysri.comwww.klickzbysri.photographybysri.com
bethanychristianchurchofelpaso.comcpanel.bethanychristianchurchofelpaso.comcpcalendars.bethanychristianchurchofelpaso.comcpcontacts.bethanychristianchurchofelpaso.commail.bethanychristianchurchofelpaso.comwebdisk.bethanychristianchurchofelpaso.comwebmail.bethanychristianchurchofelpaso.comwww.bethanychristianchurchofelpaso.com
autodiscover.twoguyswithguitars.comcpanel.twoguyswithguitars.comcpcalendars.twoguyswithguitars.comcpcontacts.twoguyswithguitars.commail.twoguyswithguitars.comtwoguyswithguitars.comwebdisk.twoguyswithguitars.comwebmail.twoguyswithguitars.comwww.twoguyswithguitars.com
athuladassanatemple-org.dgg.jya.mybluehost.meathuladassanatemple.orgautodiscover.athuladassanatemple.orgcpanel.athuladassanatemple.orgcpcalendars.athuladassanatemple.orgcpcontacts.athuladassanatemple.orgmail.athuladassanatemple.orgwebdisk.athuladassanatemple.orgwebmail.athuladassanatemple.orgwww.athuladassanatemple-org.dgg.jya.mybluehost.mewww.athuladassanatemple.org
autodiscover.openit.com.boautodiscover.softwarelibre.org.bocpanel.openit.com.bocpanel.softwarelibre.org.bocpcalendars.openit.com.bocpcalendars.softwarelibre.org.bocpcontacts.openit.com.bocpcontacts.softwarelibre.org.bomail.softwarelibre.org.boopenit-com-bo.estebanlima.comopenit.com.bosoftwarelibre-org-bo.estebanlima.comsoftwarelibre.org.bowebdisk.openit.com.bowebdisk.softwarelibre.org.bowebmail.openit.com.bowebmail.softwarelibre.org.bowww.openit-com-bo.estebanlima.comwww.openit.com.bowww.softwarelibre-org-bo.estebanlima.comwww.softwarelibre.org.bo
autodiscover.borntogroove.comautodiscover.brightbalkanmorning.comborntogroove.charleskeil.orgborntogroove.combrightbalkanmorning.charleskeil.orgbrightbalkanmorning.comcpanel.borntogroove.comcpanel.brightbalkanmorning.comcpcalendars.borntogroove.comcpcalendars.brightbalkanmorning.comcpcontacts.borntogroove.comcpcontacts.brightbalkanmorning.commail.borntogroove.commail.brightbalkanmorning.comwebdisk.borntogroove.comwebdisk.brightbalkanmorning.comwebmail.borntogroove.comwebmail.brightbalkanmorning.comwww.borntogroove.charleskeil.orgwww.borntogroove.comwww.brightbalkanmorning.charleskeil.orgwww.brightbalkanmorning.com
autodiscover.centralsolarincor.comautodiscover.harborplumbingco.comcentralsolarincor.comcentralsolarincor.legendinx.comcpanel.centralsolarincor.comcpanel.harborplumbingco.comcpcalendars.centralsolarincor.comcpcalendars.harborplumbingco.comcpcontacts.centralsolarincor.comcpcontacts.harborplumbingco.comforsitesolar.legendinx.comharborplumbingco.comharborplumbingco.legendinx.commail.centralsolarincor.commail.harborplumbingco.comwebdisk.centralsolarincor.comwebdisk.harborplumbingco.comwebmail.centralsolarincor.comwebmail.harborplumbingco.comwww.centralsolarincor.comwww.centralsolarincor.legendinx.comwww.forsitesolar.legendinx.comwww.harborplumbingco.comwww.harborplumbingco.legendinx.com
bakerblogger.writeeditcopy.comwww.bakerblogger.writeeditcopy.com
tropislim.trefort.netwww.tropislim.trefort.net
autodiscover.ryrimportadora.clcpanel.ryrimportadora.clcpcalendars.ryrimportadora.clcpcontacts.ryrimportadora.clmail.ryrimportadora.clryrimportadora.clwebdisk.ryrimportadora.clwebmail.ryrimportadora.clwww.ryrimportadora.cl
featherstonepoetry.znt.nmp.mybluehost.mefocustaxresolutions.znt.nmp.mybluehost.mejenchanmassage.znt.nmp.mybluehost.meopenwithallysha.znt.nmp.mybluehost.mewww.featherstonepoetry.znt.nmp.mybluehost.mewww.focustaxresolutions.znt.nmp.mybluehost.mewww.jenchanmassage.znt.nmp.mybluehost.mewww.openwithallysha.znt.nmp.mybluehost.me
autodiscover.still-pointfocus.comcpanel.still-pointfocus.comcpcalendars.still-pointfocus.comcpcontacts.still-pointfocus.commail.still-pointfocus.comstill-pointfocus.comwebdisk.still-pointfocus.comwebmail.still-pointfocus.comwww.still-pointfocus.com
autodiscover.ugr.vwp.mybluehost.mecpanel.ugr.vwp.mybluehost.mecpcalendars.ugr.vwp.mybluehost.mecpcontacts.ugr.vwp.mybluehost.meessencehealthagency.co.nzmail.ugr.vwp.mybluehost.meugr.vwp.mybluehost.mewebdisk.ugr.vwp.mybluehost.mewebmail.ugr.vwp.mybluehost.mewww.essencehealthagency.co.nzwww.ugr.vwp.mybluehost.me
autodiscover.loveinclakecounty.orgcpanel.loveinclakecounty.orgcpcalendars.loveinclakecounty.orgcpcontacts.loveinclakecounty.orgloveinclakecounty.comloveinclakecty.netmail.loveinclakecounty.commail.loveinclakecounty.orgmail.loveinclakecty.netwebdisk.loveinclakecounty.orgwebmail.loveinclakecounty.orgwww.loveinclakecounty.comwww.loveinclakecty.net
autodiscover.outreachhospitals.comcpanel.outreachhospitals.comcpcalendars.outreachhospitals.comcpcontacts.outreachhospitals.commail.outreachhospitals.comoutreachhospitals.comoutreachhospitals.medinetone.comwebdisk.outreachhospitals.comwebmail.outreachhospitals.comwww.outreachhospitals.comwww.outreachhospitals.medinetone.com
autodiscover.benitezramirez.combenitezramirez.comcpanel.benitezramirez.comcpcalendars.benitezramirez.comcpcontacts.benitezramirez.comdog.rzk.mybluehost.memail.benitezramirez.commail.dog.rzk.mybluehost.mewebdisk.benitezramirez.comwebmail.benitezramirez.comwww.benitezramirez.comwww.dog.rzk.mybluehost.me
autodiscover.gloryartglass.netcpanel.gloryartglass.netcpcalendars.gloryartglass.netcpcontacts.gloryartglass.netgloryartglass.comgloryartglass.netmail.gloryartglass.commail.gloryartglass.netwebdisk.gloryartglass.netwebmail.gloryartglass.netwww.gloryartglass.comwww.gloryartglass.net
autodiscover.dsmalliance.comcpanel.dsmalliance.comcpcalendars.dsmalliance.comcpcontacts.dsmalliance.comdsmalliance.commail.dsmalliance.comwebdisk.dsmalliance.comwebmail.dsmalliance.comwww.dsmalliance.com
abctrader-us.afreshlifego.comabctrader.usautodiscover.abctrader.usautodiscover.pknoodle.comcpanel.abctrader.uscpanel.pknoodle.comcpcalendars.abctrader.uscpcalendars.pknoodle.comcpcontacts.abctrader.uscpcontacts.pknoodle.commail.abctrader.usmail.pknoodle.compknoodle.afreshlifego.compknoodle.comwebdisk.abctrader.uswebdisk.pknoodle.comwebmail.abctrader.uswebmail.pknoodle.comwww.abctrader-us.afreshlifego.comwww.abctrader.uswww.pknoodle.afreshlifego.comwww.pknoodle.com
anderson4bellingham.comanderson4bellingham.taradactyldesign.comautodiscover.anderson4bellingham.comautodiscover.lilliquistforbellingham.comcpanel.anderson4bellingham.comcpanel.lilliquistforbellingham.comcpcalendars.anderson4bellingham.comcpcalendars.lilliquistforbellingham.comcpcontacts.anderson4bellingham.comcpcontacts.lilliquistforbellingham.comlilliquistforbellingham.comlilliquistforbellingham.taradactyldesign.commail.anderson4bellingham.commail.lilliquistforbellingham.comnorthsoundmarineconstruction.taradactyldesign.comwebdisk.anderson4bellingham.comwebdisk.lilliquistforbellingham.comwebmail.anderson4bellingham.comwebmail.lilliquistforbellingham.comwww.anderson4bellingham.comwww.anderson4bellingham.taradactyldesign.comwww.lilliquistforbellingham.comwww.lilliquistforbellingham.taradactyldesign.comwww.northsoundmarineconstruction.taradactyldesign.com
autodiscover.bakingforcompliments.cabakingforcompliments-ca.writeeditcopy.combakingforcompliments.cacpanel.bakingforcompliments.cacpcalendars.bakingforcompliments.cacpcontacts.bakingforcompliments.camail.bakingforcompliments.cawebdisk.bakingforcompliments.cawebmail.bakingforcompliments.cawww.bakingforcompliments-ca.writeeditcopy.comwww.bakingforcompliments.ca
autodiscover.idealinversiones.comcpanel.idealinversiones.comcpcalendars.idealinversiones.comcpcontacts.idealinversiones.comidealinversiones.commail.idealinversiones.comwebdisk.idealinversiones.comwebmail.idealinversiones.comwww.idealinversiones.com
aerc.abctrader.usautodiscover.aerc.abctrader.usautodiscover.sunpower.abctrader.uscpanel.aerc.abctrader.uscpanel.sunpower.abctrader.uscpcalendars.aerc.abctrader.uscpcalendars.sunpower.abctrader.uscpcontacts.aerc.abctrader.uscpcontacts.sunpower.abctrader.usmail.aerc.abctrader.usmail.sunpower.abctrader.ussunpower.abctrader.uswebdisk.aerc.abctrader.uswebdisk.sunpower.abctrader.uswebmail.aerc.abctrader.uswebmail.sunpower.abctrader.uswebsite-28c84341.afreshlifego.comwebsite-593b1361.afreshlifego.comwww.aerc.abctrader.uswww.sunpower.abctrader.uswww.website-28c84341.afreshlifego.comwww.website-593b1361.afreshlifego.com
autodiscover.simplywebseo.comcpanel.simplywebseo.comcpcalendars.simplywebseo.comcpcontacts.simplywebseo.comjas.ccw.mybluehost.memail.jas.ccw.mybluehost.memail.simplywebseo.comsimplywebseo.comwebdisk.simplywebseo.comwebmail.simplywebseo.comwww.jas.ccw.mybluehost.mewww.simplywebseo.com
autodiscover.minotshriners.orgcpanel.minotshriners.orgcpcalendars.minotshriners.orgcpcontacts.minotshriners.orgmail.minotshriners.orgminotshriners-org.biztechnd.comminotshriners.orgwebdisk.minotshriners.orgwebmail.minotshriners.orgwww.minotshriners-org.biztechnd.comwww.minotshriners.org
aka.auj.mybluehost.meautodiscover.aka.auj.mybluehost.meautodiscover.stoppsychiatricprofiling.orgcpanel.aka.auj.mybluehost.mecpanel.stoppsychiatricprofiling.orgcpcalendars.aka.auj.mybluehost.mecpcalendars.stoppsychiatricprofiling.orgcpcontacts.aka.auj.mybluehost.mecpcontacts.stoppsychiatricprofiling.orgmail.aka.auj.mybluehost.memail.stoppsychiatricprofiling.orgstoppsychiatricprofiling-org.aka.auj.mybluehost.mestoppsychiatricprofiling.orgwebdisk.aka.auj.mybluehost.mewebdisk.stoppsychiatricprofiling.orgwebmail.aka.auj.mybluehost.mewebmail.stoppsychiatricprofiling.orgwww.aka.auj.mybluehost.mewww.stoppsychiatricprofiling-org.aka.auj.mybluehost.mewww.stoppsychiatricprofiling.org
faithlivesnow.sailsinthewind.comorigenre.sailsinthewind.comthoughtfestivals.sailsinthewind.comwww.faithlivesnow.sailsinthewind.comwww.origenre.sailsinthewind.comwww.thoughtfestivals.sailsinthewind.com
ammanetwork.orgautodiscover.ammanetwork.orgautodiscover.umustudio.comcpanel.ammanetwork.orgcpanel.umustudio.comcpcalendars.ammanetwork.orgcpcalendars.umustudio.comcpcontacts.ammanetwork.orgcpcontacts.umustudio.commail.ammanetwork.orgmail.umustudio.comumustudio.ammanetwork.orgumustudio.comwebdisk.ammanetwork.orgwebdisk.umustudio.comwebmail.ammanetwork.orgwebmail.umustudio.comwww.ammanetwork.orgwww.umustudio.ammanetwork.orgwww.umustudio.com
private.hannamcompany.comwww.private.hannamcompany.com
autodiscover.biztechnd.combiztechnd.comcpanel.biztechnd.comcpcalendars.biztechnd.comcpcontacts.biztechnd.comfardenconstruction.biztechnd.comgrz.wyd.mybluehost.memail.biztechnd.commail.grz.wyd.mybluehost.mewebdisk.biztechnd.comwebmail.biztechnd.comwww.biztechnd.comwww.fardenconstruction.biztechnd.comwww.grz.wyd.mybluehost.me
autodiscover.ebw.ehs.mybluehost.mecpanel.ebw.ehs.mybluehost.mecpcalendars.ebw.ehs.mybluehost.mecpcontacts.ebw.ehs.mybluehost.meebw.ehs.mybluehost.memail.ebw.ehs.mybluehost.mewebdisk.ebw.ehs.mybluehost.mewebmail.ebw.ehs.mybluehost.mewww.ebw.ehs.mybluehost.me
autodiscover.cyberspacepromotions.comautodiscover.twosistersdesignsnd.comcpanel.cyberspacepromotions.comcpanel.twosistersdesignsnd.comcpcalendars.cyberspacepromotions.comcpcalendars.twosistersdesignsnd.comcpcontacts.cyberspacepromotions.comcpcontacts.twosistersdesignsnd.comcyberspacepromotions.biztechnd.comcyberspacepromotions.commail.cyberspacepromotions.commail.twosistersdesignsnd.comtwosistersdesignsnd.biztechnd.comtwosistersdesignsnd.comwebdisk.cyberspacepromotions.comwebdisk.twosistersdesignsnd.comwebmail.cyberspacepromotions.comwebmail.twosistersdesignsnd.comwww.cyberspacepromotions.biztechnd.comwww.cyberspacepromotions.comwww.twosistersdesignsnd.biztechnd.comwww.twosistersdesignsnd.com
adventuresinadhd.comautodiscover.adventuresinadhd.comcpanel.adventuresinadhd.comcpcalendars.adventuresinadhd.comcpcontacts.adventuresinadhd.commail.adventuresinadhd.comwebdisk.adventuresinadhd.comwebmail.adventuresinadhd.comwww.adventuresinadhd.com
autodiscover.hablemosdefolklore.comcpanel.hablemosdefolklore.comcpcalendars.hablemosdefolklore.comcpcontacts.hablemosdefolklore.comhablemosdefolklore.comhablemosdefolklore.estebanlima.commail.hablemosdefolklore.comwebdisk.hablemosdefolklore.comwebmail.hablemosdefolklore.comwww.hablemosdefolklore.comwww.hablemosdefolklore.estebanlima.com
autodiscover.codasocalconference.comcodasocalconference.comcpanel.codasocalconference.comcpcalendars.codasocalconference.comcpcontacts.codasocalconference.commail.codasocalconference.comwebdisk.codasocalconference.comwebmail.codasocalconference.comwww.codasocalconference.com
autodiscover.hymmedicalsa.comcpanel.hymmedicalsa.comcpcalendars.hymmedicalsa.comcpcontacts.hymmedicalsa.comhymmedicalsa.commail.hymmedicalsa.comwebdisk.hymmedicalsa.comwebmail.hymmedicalsa.comwww.hymmedicalsa.com
autodiscover.glamorousbeauty.spacecpanel.glamorousbeauty.spacecpcalendars.glamorousbeauty.spacecpcontacts.glamorousbeauty.spaceglamorousbeauty-space.lanternticket.comglamorousbeauty.spacemail.glamorousbeauty.spacewebdisk.glamorousbeauty.spacewebmail.glamorousbeauty.spacewww.glamorousbeauty-space.lanternticket.comwww.glamorousbeauty.space
autodiscover.bitcomplianceassurance.comautodiscover.essentialrenovations661.comautodiscover.tlcestatesaleladies.combitcomplianceassurance.combitcomplianceassurance.legendinx.comcpanel.bitcomplianceassurance.comcpcalendars.bitcomplianceassurance.comcpcontacts.bitcomplianceassurance.comcpcontacts.essentialrenovations661.comcpcontacts.tlcestatesaleladies.commail.bitcomplianceassurance.commail.tlcestatesaleladies.comtitantech-llc.legendinx.comwebdisk.bitcomplianceassurance.comwebmail.bitcomplianceassurance.comwebmail.tlcestatesaleladies.comwebsite-d456113a.legendinx.comwebsite-ff38ffad.legendinx.comwww.bitcomplianceassurance.comwww.bitcomplianceassurance.legendinx.comwww.titantech-llc.legendinx.comwww.tlcestatesaleladies.comwww.website-d456113a.legendinx.comwww.website-ff38ffad.legendinx.com
hannamcompany.commail.hannamcompany.comwww.hannamcompany.com
marlodj.obertys.comwww.marlodj.obertys.com
autodiscover.fishfacepublishing.comcpanel.fishfacepublishing.comcpcalendars.fishfacepublishing.comcpcontacts.fishfacepublishing.comfishfacepublishing.commail.fishfacepublishing.commail.nen.jgp.mybluehost.menen.jgp.mybluehost.mewebdisk.fishfacepublishing.comwebmail.fishfacepublishing.comwww.fishfacepublishing.comwww.nen.jgp.mybluehost.me
alternativehousecarehome.comautodiscover.alternativehousecarehome.comcpanel.alternativehousecarehome.comcpcalendars.alternativehousecarehome.comcpcontacts.alternativehousecarehome.commail.alternativehousecarehome.comwebdisk.alternativehousecarehome.comwebmail.alternativehousecarehome.comwww.alternativehousecarehome.com
*.bluehost.combluehost.com
autodiscover.ravagolawgroup.comautodiscover.tetradevelopment.netcpanel.tetradevelopment.netcpcalendars.ravagolawgroup.comcpcalendars.tetradevelopment.netcpcontacts.ravagolawgroup.comcpcontacts.tetradevelopment.netmail.ravagolawgroup.commail.tetradevelopment.netravagolawgroup.guidingpc.comtetradevelopment-net.guidingpc.comtetradevelopment.netwebdisk.ravagolawgroup.comwebdisk.tetradevelopment.netwebmail.tetradevelopment.netwww.ravagolawgroup.guidingpc.comwww.tetradevelopment-net.guidingpc.comwww.tetradevelopment.net
autodiscover.portfoliostyles.comcpanel.portfoliostyles.comcpcalendars.portfoliostyles.comcpcontacts.portfoliostyles.commail.portfoliostyles.comportfoliostyles.comportfoliostyles.donswpbox.comwebdisk.portfoliostyles.comwebmail.portfoliostyles.comwww.portfoliostyles.comwww.portfoliostyles.donswpbox.com
ameybusiness.comautodiscover.ameybusiness.comcpanel.ameybusiness.comcpcalendars.ameybusiness.comcpcontacts.ameybusiness.commail.ameybusiness.comwebdisk.ameybusiness.comwebmail.ameybusiness.comwww.ameybusiness.com
mail.visawebs.comvisawebs.comwww.visawebs.com
autodiscover.checkenginemobilerepair.comcheckenginemobilerepair.comcpanel.checkenginemobilerepair.comcpcalendars.checkenginemobilerepair.comcpcontacts.checkenginemobilerepair.commail.checkenginemobilerepair.comwebdisk.checkenginemobilerepair.comwebmail.checkenginemobilerepair.comwww.checkenginemobilerepair.com
cpanel.sempermd.comcpcalendars.sempermd.commail.sempermd.comsempermd.comwebmail.sempermd.comwww.sempermd.com
cpanel.flatironsmanagementgroup.comcpcalendars.flatironsmanagementgroup.comcpcontacts.flatironsmanagementgroup.comflatironsmanagementgroup.comflatironsmanagementgroup.zbx.hnq.mybluehost.memail.flatironsmanagementgroup.comwebdisk.flatironsmanagementgroup.comwebmail.flatironsmanagementgroup.comwww.flatironsmanagementgroup.comwww.flatironsmanagementgroup.zbx.hnq.mybluehost.me
autodiscover.gonzalezfamilyfarm.comautodiscover.seasonedconversations.orgcpanel.gonzalezfamilyfarm.comcpanel.seasonedconversations.orgcpcalendars.gonzalezfamilyfarm.comcpcalendars.seasonedconversations.orgcpcontacts.gonzalezfamilyfarm.comcpcontacts.seasonedconversations.orggonzalezfamilyfarm.cid5280.comgonzalezfamilyfarm.commail.gonzalezfamilyfarm.commail.seasonedconversations.orgseasonedconversations-org.cid5280.comseasonedconversations.orgwebdisk.gonzalezfamilyfarm.comwebdisk.seasonedconversations.orgwebmail.gonzalezfamilyfarm.comwebmail.seasonedconversations.orgwww.gonzalezfamilyfarm.cid5280.comwww.gonzalezfamilyfarm.comwww.seasonedconversations-org.cid5280.comwww.seasonedconversations.org
curiousmeow.davolynindustries.comwww.curiousmeow.davolynindustries.com
anguyengrowsinbrooklyn.brashandcrass.comanguyengrowsinbrooklyn.comautodiscover.anguyengrowsinbrooklyn.comautodiscover.susanfoxmd.comcpanel.anguyengrowsinbrooklyn.comcpanel.susanfoxmd.comcpcalendars.anguyengrowsinbrooklyn.comcpcalendars.susanfoxmd.comcpcontacts.anguyengrowsinbrooklyn.comcpcontacts.susanfoxmd.commail.anguyengrowsinbrooklyn.commail.susanfoxmd.comsusanfoxmd.brashandcrass.comsusanfoxmd.comwebdisk.anguyengrowsinbrooklyn.comwebdisk.susanfoxmd.comwebmail.anguyengrowsinbrooklyn.comwebmail.susanfoxmd.comwww.anguyengrowsinbrooklyn.brashandcrass.comwww.anguyengrowsinbrooklyn.comwww.susanfoxmd.brashandcrass.comwww.susanfoxmd.com
autodiscover.mosmanvillagecommunity.orgcpanel.mosmanvillagecommunity.orgcpcalendars.mosmanvillagecommunity.orgcpcontacts.mosmanvillagecommunity.orgmail.mosmanvillagecommunity.orgmosmanvillagecommunity.orgwebdisk.mosmanvillagecommunity.orgwebmail.mosmanvillagecommunity.orgwww.mosmanvillagecommunity.org
autodiscover.coinhardwareglobal.comcoinhardwareglobal.comcoinhardwareglobal.simplywebseo.comcpanel.coinhardwareglobal.comcpcalendars.coinhardwareglobal.comcpcontacts.coinhardwareglobal.commail.coinhardwareglobal.comsimplywebseo-online.simplywebseo.comwebdisk.coinhardwareglobal.comwebmail.coinhardwareglobal.comwww.coinhardwareglobal.comwww.coinhardwareglobal.simplywebseo.comwww.simplywebseo-online.simplywebseo.com
autodiscover.mynewkentuckyhome.comcpanel.mynewkentuckyhome.comcpcalendars.mynewkentuckyhome.comcpcontacts.mynewkentuckyhome.commail.mynewkentuckyhome.commynewkentuckyhome.comwebdisk.mynewkentuckyhome.comwebmail.mynewkentuckyhome.comwww.mynewkentuckyhome.com
autodiscover.lno.rln.mybluehost.mecpanel.lno.rln.mybluehost.mecpcalendars.lno.rln.mybluehost.mecpcontacts.lno.rln.mybluehost.melno.rln.mybluehost.memail.lno.rln.mybluehost.metractopartesyrefacciones.lno.rln.mybluehost.mewebdisk.lno.rln.mybluehost.mewebmail.lno.rln.mybluehost.mewww.lno.rln.mybluehost.mewww.tractopartesyrefacciones.lno.rln.mybluehost.me
autodiscover.eb5.abctrader.usautodiscover.pii.abctrader.uscpanel.eb5.abctrader.uscpanel.pii.abctrader.uscpcalendars.eb5.abctrader.uscpcalendars.pii.abctrader.uscpcontacts.eb5.abctrader.uscpcontacts.pii.abctrader.useb5.abctrader.usmail.eb5.abctrader.usmail.pii.abctrader.uspii.abctrader.uswebdisk.eb5.abctrader.uswebdisk.pii.abctrader.uswebmail.eb5.abctrader.uswebmail.pii.abctrader.uswebsite-c2d5f655.afreshlifego.comwebsite-cb4d0989.afreshlifego.comwww.eb5.abctrader.uswww.pii.abctrader.uswww.website-c2d5f655.afreshlifego.comwww.website-cb4d0989.afreshlifego.com
glutenfree-mimi.commail.glutenfree-mimi.comwww.glutenfree-mimi.com
128path-org.charleskeil.org128path.orgautodiscover.128path.orgautodiscover.borntogroove.orgborn.charleskeil.orgborntogroove.orgcpanel.128path.orgcpanel.borntogroove.orgcpcalendars.128path.orgcpcalendars.borntogroove.orgcpcontacts.128path.orgcpcontacts.borntogroove.orgmail.128path.orgmail.borntogroove.orgwebdisk.128path.orgwebdisk.borntogroove.orgwebmail.128path.orgwebmail.borntogroove.orgwww.128path-org.charleskeil.orgwww.128path.orgwww.born.charleskeil.orgwww.borntogroove.org
autaphagene.revsz.comautodiscover.thejagroup.orgconsti-slim.revsz.comcpanel.thejagroup.orgcpcalendars.thejagroup.orgcpcontacts.thejagroup.orgeyesightmax.revsz.cominteligen.revsz.commail.thejagroup.orgolivine.revsz.compinealxt.revsz.comthejagroup.orgwebdisk.thejagroup.orgwebmail.thejagroup.orgwebsite-385bfe7c.revsz.comwww.autaphagene.revsz.comwww.consti-slim.revsz.comwww.eyesightmax.revsz.comwww.inteligen.revsz.comwww.olivine.revsz.comwww.pinealxt.revsz.comwww.thejagroup.orgwww.website-385bfe7c.revsz.com
autodiscover.charleskeil.orgautodiscover.musicgrooves.orgcharleskeil.orgcpanel.charleskeil.orgcpanel.musicgrooves.orgcpcalendars.charleskeil.orgcpcalendars.musicgrooves.orgcpcontacts.charleskeil.orgcpcontacts.musicgrooves.orgmail.charleskeil.orgmail.musicgrooves.orgmusicgrooves-org.charleskeil.orgmusicgrooves.orgwebdisk.charleskeil.orgwebdisk.musicgrooves.orgwebmail.charleskeil.orgwebmail.musicgrooves.orgwww.charleskeil.orgwww.musicgrooves-org.charleskeil.orgwww.musicgrooves.org
autodiscover.epcmconsultores.com.bocpanel.epcmconsultores.com.bocpcalendars.epcmconsultores.com.bocpcontacts.epcmconsultores.com.boepcmconsultores-com-bo.estebanlima.comepcmconsultores.com.bomail.epcmconsultores.com.bowebdisk.epcmconsultores.com.bowebmail.epcmconsultores.com.bowww.epcmconsultores-com-bo.estebanlima.comwww.epcmconsultores.com.bo
autodiscover.lakecountryarts.orgautodiscover.theartisansvillage.orgcpanel.lakecountryarts.orgcpanel.theartisansvillage.orgcpcalendars.lakecountryarts.orgcpcalendars.theartisansvillage.orgcpcontacts.lakecountryarts.orgcpcontacts.theartisansvillage.orglakecountryarts.orgmail.lakecountryarts.orgmail.theartisansvillage.orgtheartisansvillage-org.lakecountryarts.orgtheartisansvillage.orgwebdisk.lakecountryarts.orgwebdisk.theartisansvillage.orgwebmail.lakecountryarts.orgwebmail.theartisansvillage.orgwww.lakecountryarts.orgwww.theartisansvillage-org.lakecountryarts.orgwww.theartisansvillage.org
anitalahey.caanitalahey.comautodiscover.anitalahey.comcpanel.anitalahey.comcpcalendars.anitalahey.comcpcontacts.anitalahey.commail.anitalahey.camail.anitalahey.comwebdisk.anitalahey.comwebmail.anitalahey.comwww.anitalahey.cawww.anitalahey.com
thepartycatalog.comwww.thepartycatalog.com
autodiscover.loversclubfilms.comcpanel.loversclubfilms.comcpcalendars.loversclubfilms.comcpcontacts.loversclubfilms.comloversclubfilms.commail.loversclubfilms.comwebdisk.loversclubfilms.comwebmail.loversclubfilms.comwww.loversclubfilms.com
autodiscover.jacynthedurochermedia.comcpanel.jacynthedurochermedia.comcpcalendars.jacynthedurochermedia.comcpcontacts.jacynthedurochermedia.comjacynthedurochermedia.commail.jacynthedurochermedia.comwebdisk.jacynthedurochermedia.comwebmail.jacynthedurochermedia.comwww.jacynthedurochermedia.com
autodiscover.jlbccommunityalliance.comcpanel.jlbccommunityalliance.comcpcalendars.jlbccommunityalliance.comcpcontacts.jlbccommunityalliance.comjlbccommunityalliance.avd.ofm.mybluehost.mejlbccommunityalliance.commail.jlbccommunityalliance.comwebdisk.jlbccommunityalliance.comwebmail.jlbccommunityalliance.comwww.jlbccommunityalliance.avd.ofm.mybluehost.mewww.jlbccommunityalliance.com
autodiscover.ecmi-eg.orgcpanel.ecmi-eg.orgcpcalendars.ecmi-eg.orgcpcontacts.ecmi-eg.orgecmi-eg.orgmail.ecmi-eg.orgwebdisk.ecmi-eg.orgwebmail.ecmi-eg.orgwww.ecmi-eg.org
autodiscover.caravanaperubolivia.comcaravanaperubolivia.camaraperubolivia.org.pecaravanaperubolivia.comcpanel.caravanaperubolivia.comcpcalendars.caravanaperubolivia.comcpcontacts.caravanaperubolivia.commail.caravanaperubolivia.comwebdisk.caravanaperubolivia.comwebmail.caravanaperubolivia.comwww.caravanaperubolivia.camaraperubolivia.org.pewww.caravanaperubolivia.com
autodiscover.csr1online.comcpanel.csr1online.comcpcalendars.csr1online.comcpcontacts.csr1online.commail.csr1online.comwebdisk.csr1online.comwebmail.csr1online.com
autodiscover.icapcanada.comcpanel.icapcanada.comcpcalendars.icapcanada.comcpcontacts.icapcanada.comicapcanada.comicapproducts.commail.icapcanada.commail.icapproducts.comwebdisk.icapcanada.comwebmail.icapcanada.comwww.icapcanada.comwww.icapproducts.com
cpanel.iacvt.comcpcalendars.iacvt.comcpcontacts.iacvt.comiacvt.commail.iacvt.comwebdisk.iacvt.comwebmail.iacvt.comwww.iacvt.com
autodiscover.mediwiserx.comcpanel.mediwiserx.comcpcalendars.mediwiserx.comcpcontacts.mediwiserx.commail.mediwiserx.commediwiserx.comwebdisk.mediwiserx.comwebmail.mediwiserx.comwww.mediwiserx.com
autodiscover.kseducationsolutions.comautodiscover.tabuinc.netcpanel.kseducationsolutions.comcpanel.tabuinc.netcpcalendars.kseducationsolutions.comcpcalendars.tabuinc.netcpcontacts.kseducationsolutions.comcpcontacts.tabuinc.netkseducationsolutions.comkseducationsolutions.ntdesignsolutions.commail.kseducationsolutions.commail.tabuinc.nettabuinc.nettabuinc.ntdesignsolutions.comwebdisk.kseducationsolutions.comwebdisk.tabuinc.netwebmail.kseducationsolutions.comwebmail.tabuinc.netwww.kseducationsolutions.comwww.kseducationsolutions.ntdesignsolutions.comwww.tabuinc.netwww.tabuinc.ntdesignsolutions.com
autodiscover.careaidafrica.orgautodiscover.evc.rzk.mybluehost.mecareaidafrica-org.evc.rzk.mybluehost.mecareaidafrica.orgcpanel.careaidafrica.orgcpanel.evc.rzk.mybluehost.mecpcalendars.careaidafrica.orgcpcalendars.evc.rzk.mybluehost.mecpcontacts.careaidafrica.orgcpcontacts.evc.rzk.mybluehost.meevc.rzk.mybluehost.memail.careaidafrica.orgmail.evc.rzk.mybluehost.mewebdisk.careaidafrica.orgwebdisk.evc.rzk.mybluehost.mewebmail.careaidafrica.orgwebmail.evc.rzk.mybluehost.mewww.careaidafrica-org.evc.rzk.mybluehost.mewww.careaidafrica.orgwww.evc.rzk.mybluehost.me
autodiscover.curatedtouring.comcpanel.curatedtouring.comcpcalendars.curatedtouring.comcpcontacts.curatedtouring.comcuratedtouring.commail.curatedtouring.comwebdisk.curatedtouring.comwebmail.curatedtouring.comwww.curatedtouring.com
autodiscover.primalcreationsllc.comcpanel.primalcreationsllc.comcpcalendars.primalcreationsllc.comcpcontacts.primalcreationsllc.commail.primalcreationsllc.comprimalcreationsllc.comwebdisk.primalcreationsllc.comwebmail.primalcreationsllc.comwww.primalcreationsllc.com
autodiscover.likeagencyofficial.comautodiscover.studiomao.comcpanel.likeagencyofficial.comcpanel.studiomao.comcpcalendars.likeagencyofficial.comcpcalendars.studiomao.comcpcontacts.likeagencyofficial.comcpcontacts.studiomao.comlikeagencyofficial.comlikeagencyofficial.studiomao.commail.likeagencyofficial.commail.studiomao.comstudiomao.comwebdisk.likeagencyofficial.comwebdisk.studiomao.comwebmail.likeagencyofficial.comwebmail.studiomao.comwww.likeagencyofficial.comwww.likeagencyofficial.studiomao.comwww.studiomao.com
autodiscover.gunshop-ooki.jpautodiscover.jdesign-office.comcpanel.gunshop-ooki.jpcpanel.jdesign-office.comcpcalendars.gunshop-ooki.jpcpcalendars.jdesign-office.comcpcontacts.gunshop-ooki.jpcpcontacts.jdesign-office.comgunshop-ooki-jp.publishersjapan.comgunshop-ooki.jpjdesign-office.comjdesign-office.publishersjapan.commail.gunshop-ooki.jpmail.jdesign-office.comwebdisk.gunshop-ooki.jpwebdisk.jdesign-office.comwebmail.gunshop-ooki.jpwebmail.jdesign-office.comwww.gunshop-ooki-jp.publishersjapan.comwww.gunshop-ooki.jpwww.jdesign-office.comwww.jdesign-office.publishersjapan.com
autodiscover.jointgenesis.revsz.comcpanel.jointgenesis.revsz.comcpcalendars.jointgenesis.revsz.comcpcontacts.jointgenesis.revsz.comjointgenesis.revsz.comlivpure.revsz.commail.jointgenesis.revsz.comneurorise.revsz.comserolean.revsz.comwebdisk.jointgenesis.revsz.comwebmail.jointgenesis.revsz.comwebsite-173ca08e.revsz.comwebsite-5ebcdd07.revsz.comwebsite-79a94692.revsz.comwww.jointgenesis.revsz.comwww.livpure.revsz.comwww.neurorise.revsz.comwww.serolean.revsz.comwww.website-173ca08e.revsz.comwww.website-5ebcdd07.revsz.comwww.website-79a94692.revsz.com
autodiscover.stephenmoorespeaks.comcpanel.stephenmoorespeaks.comcpcalendars.stephenmoorespeaks.comcpcontacts.stephenmoorespeaks.commail.stephenmoorespeaks.comstephenmoorespeaks.comwebdisk.stephenmoorespeaks.comwebmail.stephenmoorespeaks.comwww.stephenmoorespeaks.com
autodiscover.snytile.comcpanel.snytile.comcpcalendars.snytile.comcpcontacts.snytile.commail.snytile.comsnytile.comwebdisk.snytile.comwebmail.snytile.comwww.snytile.com
autodiscover.kattswestsidestories.comautodiscover.supportyourlocaltaco.comcpanel.kattswestsidestories.comcpanel.supportyourlocaltaco.comcpcalendars.kattswestsidestories.comcpcalendars.supportyourlocaltaco.comcpcontacts.kattswestsidestories.comcpcontacts.supportyourlocaltaco.comfull-of-shirt.taradactyldesign.comkattswestsidestories.comkattswestsidestories.taradactyldesign.commail.kattswestsidestories.commail.supportyourlocaltaco.comsupportyourlocaltaco.comsupportyourlocaltaco.taradactyldesign.comwebdisk.kattswestsidestories.comwebdisk.supportyourlocaltaco.comwebmail.kattswestsidestories.comwebmail.supportyourlocaltaco.comwww.full-of-shirt.taradactyldesign.comwww.kattswestsidestories.comwww.kattswestsidestories.taradactyldesign.comwww.supportyourlocaltaco.comwww.supportyourlocaltaco.taradactyldesign.com
autodiscover.futuristparty.orgautodiscover.thefuturistparty.comcpanel.futuristparty.orgcpanel.thefuturistparty.comcpcalendars.futuristparty.orgcpcalendars.thefuturistparty.comcpcontacts.futuristparty.orgcpcontacts.thefuturistparty.comfuturistparty-org.tentaclekitty.comfuturistparty.orgmail.futuristparty.orgmail.thefuturistparty.comthefuturistparty.comthefuturistparty.tentaclekitty.comwebdisk.futuristparty.orgwebdisk.thefuturistparty.comwebmail.futuristparty.orgwebmail.thefuturistparty.comwww.futuristparty-org.tentaclekitty.comwww.futuristparty.orgwww.thefuturistparty.comwww.thefuturistparty.tentaclekitty.com
autodiscover.jpb.dmo.mybluehost.mecpanel.jpb.dmo.mybluehost.mecpcalendars.jpb.dmo.mybluehost.mecpcontacts.jpb.dmo.mybluehost.mejpb.dmo.mybluehost.memail.jpb.dmo.mybluehost.mewebdisk.jpb.dmo.mybluehost.mewebmail.jpb.dmo.mybluehost.mewww.jpb.dmo.mybluehost.me
autodiscover.licentiousnovelties.comcpanel.licentiousnovelties.comcpcalendars.licentiousnovelties.comcpcontacts.licentiousnovelties.comlicentiousnovelties.addicteddopeness.netlicentiousnovelties.commail.licentiousnovelties.comwebdisk.licentiousnovelties.comwebmail.licentiousnovelties.comwww.licentiousnovelties.addicteddopeness.netwww.licentiousnovelties.com
aclinnovations.comaclinnovations.patricandrew.comautodiscover.aclinnovations.comcpanel.aclinnovations.comcpcalendars.aclinnovations.comcpcontacts.aclinnovations.commail.aclinnovations.comwebdisk.aclinnovations.comwebmail.aclinnovations.comwww.aclinnovations.comwww.aclinnovations.patricandrew.com
autodiscover.tourismshark.comcpanel.tourismshark.comcpcalendars.tourismshark.comcpcontacts.tourismshark.commail.tourismshark.comtourismshark.comtourismshark.lob.hnq.mybluehost.mewebdisk.tourismshark.comwebmail.tourismshark.comwww.tourismshark.comwww.tourismshark.lob.hnq.mybluehost.me
autodiscover.labellesince1919.comcpcalendars.labellesince1919.comcpcontacts.labellesince1919.commail.labellesince1919.comwebdisk.labellesince1919.com
autodiscover.elisastancillevine.comcpanel.elisastancillevine.comcpcalendars.elisastancillevine.comcpcontacts.elisastancillevine.comelisastancil.comelisastancillevine.commail.elisastancil.commail.elisastancillevine.comwebdisk.elisastancillevine.comwebmail.elisastancillevine.comwww.elisastancil.comwww.elisastancillevine.com
autodiscover.booksbydennis.combooksbydennis.comcpanel.booksbydennis.comcpcalendars.booksbydennis.comcpcontacts.booksbydennis.commail.booksbydennis.comwebdisk.booksbydennis.comwebmail.booksbydennis.comwww.booksbydennis.com
cpanel.s3consultingsolutions.comcpcalendars.s3consultingsolutions.comcpcontacts.s3consultingsolutions.commail.s3consultingsolutions.coms3consultingsolutions.coms3consultingsolutions.legendinx.comwebdisk.s3consultingsolutions.comwebmail.s3consultingsolutions.comwww.s3consultingsolutions.comwww.s3consultingsolutions.legendinx.com
autodiscover.tsnpa.infocpanel.tsnpa.infocpcalendars.tsnpa.infocpcontacts.tsnpa.infomail.tsnpa.infotsnpa.infowebdisk.tsnpa.infowebmail.tsnpa.infowww.tsnpa.info
aprendix-online.ja-developments.comaprendix.onlineautodiscover.aprendix.onlineautodiscover.stdbfs.comcpanel.aprendix.onlinecpanel.stdbfs.comcpcalendars.aprendix.onlinecpcalendars.stdbfs.comcpcontacts.aprendix.onlinecpcontacts.stdbfs.commail.aprendix.onlinemail.stdbfs.comstdbfs.comstdbfs.ja-developments.comwebdisk.aprendix.onlinewebdisk.stdbfs.comwebmail.aprendix.onlinewebmail.stdbfs.comwww.aprendix-online.ja-developments.comwww.aprendix.onlinewww.stdbfs.comwww.stdbfs.ja-developments.com
0ec.ammanetwork.org0ec.esautodiscover.0ec.escpanel.0ec.escpcalendars.0ec.escpcontacts.0ec.esmail.0ec.eswebdisk.0ec.eswebmail.0ec.eswww.0ec.ammanetwork.orgwww.0ec.es
cpanel.estoagroup.comcpcalendars.estoagroup.comcpcontacts.estoagroup.comestoagroup.commail.estoagroup.comwebdisk.estoagroup.comwebmail.estoagroup.comwww.estoagroup.com
autodiscover.jerryspizza.comautodiscover.superiorhvc.comcpanel.jerryspizza.comcpanel.superiorhvc.comcpcalendars.jerryspizza.comcpcalendars.superiorhvc.comcpcontacts.jerryspizza.comcpcontacts.superiorhvc.comjerryspizza.comjerryspizza.legendinx.commail.jerryspizza.commail.superiorhvc.comsuperiorhvc.comsuperiorhvc.legendinx.comwebdisk.jerryspizza.comwebdisk.superiorhvc.comwebmail.jerryspizza.comwebmail.superiorhvc.comwww.jerryspizza.comwww.jerryspizza.legendinx.comwww.superiorhvc.comwww.superiorhvc.legendinx.com
autodiscover.softwarelibre.org.bocpanel.softwarelibre.org.bocpcalendars.softwarelibre.org.bocpcontacts.softwarelibre.org.bomail.softwarelibre.org.bosoftwarelibre-org-bo.estebanlima.comsoftwarelibre.org.bowebdisk.softwarelibre.org.bowebmail.softwarelibre.org.bowww.softwarelibre-org-bo.estebanlima.comwww.softwarelibre.org.bo
autodiscover.pastpresentpurple.comcpanel.pastpresentpurple.comcpcalendars.pastpresentpurple.comcpcontacts.pastpresentpurple.commail.pastpresentpurple.compastpresentpurple.comwebdisk.pastpresentpurple.comwebmail.pastpresentpurple.comwww.pastpresentpurple.com
cpanel.gtpham.comcpcalendars.gtpham.comgtpham.commail.gtpham.comwebmail.gtpham.comwww.gtpham.com
autodiscover.cltaerialproductions.comcltaerialproductions.comcpanel.cltaerialproductions.comcpcalendars.cltaerialproductions.comcpcontacts.cltaerialproductions.commail.cltaerialproductions.comwebdisk.cltaerialproductions.comwebmail.cltaerialproductions.comwww.cltaerialproductions.com
autodiscover.barrelandbond.combarrelandbond.comcpanel.barrelandbond.comcpcalendars.barrelandbond.comcpcontacts.barrelandbond.commail.barrelandbond.comwebdisk.barrelandbond.comwebmail.barrelandbond.comwww.barrelandbond.com
autodiscover.bellcreativeco.combellcreativeco.comcpanel.bellcreativeco.comcpcalendars.bellcreativeco.comcpcontacts.bellcreativeco.commail.bellcreativeco.commail.missinformed.blogmissinformed-com.bellcreativeco.commissinformed.blogwebdisk.bellcreativeco.comwebmail.bellcreativeco.comwww.bellcreativeco.comwww.missinformed-com.bellcreativeco.comwww.missinformed.blog
autodiscover.cedarwoodfarmstead.comcedarwoodfarmstead.comcpanel.cedarwoodfarmstead.comcpcalendars.cedarwoodfarmstead.comcpcontacts.cedarwoodfarmstead.commail.cedarwoodfarmstead.comwebdisk.cedarwoodfarmstead.comwebmail.cedarwoodfarmstead.comwww.cedarwoodfarmstead.com
autodiscover.eruns.cocpanel.eruns.cocpcalendars.eruns.cocpcontacts.eruns.coeruns.comail.eruns.cowebdisk.eruns.cowebmail.eruns.cowww.eruns.co
autodiscover.myrealtormonica.comcpanel.myrealtormonica.comcpcalendars.myrealtormonica.comcpcontacts.myrealtormonica.commail.myrealtormonica.commyrealtormonica-com.cid5280.commyrealtormonica.comwebdisk.myrealtormonica.comwebmail.myrealtormonica.comwww.myrealtormonica-com.cid5280.comwww.myrealtormonica.com
allfeedbackcounts.comallfeedbackcounts.davolynindustries.comautodiscover.allfeedbackcounts.comautodiscover.davolynindustries.comcarolynsheriff-me.davolynindustries.comcpanel.allfeedbackcounts.comcpanel.davolynindustries.comcpcalendars.allfeedbackcounts.comcpcalendars.davolynindustries.comcpcontacts.allfeedbackcounts.comcpcontacts.davolynindustries.comdavolynindustries.commail.allfeedbackcounts.commail.davolynindustries.comwebdisk.allfeedbackcounts.comwebdisk.davolynindustries.comwebmail.allfeedbackcounts.comwebmail.davolynindustries.comwww.allfeedbackcounts.comwww.allfeedbackcounts.davolynindustries.comwww.carolynsheriff-me.davolynindustries.comwww.davolynindustries.com
autodiscover.rtrdumpsters.comcpanel.rtrdumpsters.comcpcalendars.rtrdumpsters.comcpcontacts.rtrdumpsters.commail.rtrdumpsters.comrtrdumpsters.comrtrdumpsters.legendinx.comwebdisk.rtrdumpsters.comwebmail.rtrdumpsters.comwww.rtrdumpsters.comwww.rtrdumpsters.legendinx.com
autodiscover.perfectioncleaningnc.comcpanel.perfectioncleaningnc.comcpcalendars.perfectioncleaningnc.comcpcontacts.perfectioncleaningnc.commail.perfectioncleaningnc.comperfectioncleaningnc.comperfectioncleaningnc.whcapitalleasing.comwebdisk.perfectioncleaningnc.comwebmail.perfectioncleaningnc.comwww.perfectioncleaningnc.comwww.perfectioncleaningnc.whcapitalleasing.com
autodiscover.thephotographybite.comcpanel.thephotographybite.comcpcalendars.thephotographybite.comcpcontacts.thephotographybite.commail.thephotographybite.comthephotographybite.comthephotographybite.wan.vec.mybluehost.mewebdisk.thephotographybite.comwebmail.thephotographybite.comwww.thephotographybite.comwww.thephotographybite.wan.vec.mybluehost.me
autodiscover.cbrimprovementstrategies.comcbrimprovementstrategies.comcpanel.cbrimprovementstrategies.comcpcalendars.cbrimprovementstrategies.comcpcontacts.cbrimprovementstrategies.commail.cbrimprovementstrategies.comwebdisk.cbrimprovementstrategies.comwebmail.cbrimprovementstrategies.comwww.cbrimprovementstrategies.com
cpanel.settingsbyheidi.comcpcalendars.settingsbyheidi.comcpcontacts.settingsbyheidi.commail.settingsbyheidi.comsettingsbyheidi.comwebdisk.settingsbyheidi.comwebmail.settingsbyheidi.comwww.settingsbyheidi.com
beeseengear.comcpanel.beeseengear.comcpcalendars.beeseengear.comcpcontacts.beeseengear.commail.beeseengear.commail.beeseengearpromo.comwebdisk.beeseengear.comwebmail.beeseengear.comwww.beeseengear.com
addicteddopeness.addicteddopeness.netaddicteddopeness.comaddicteddopeness.netautodiscover.addicteddopeness.comautodiscover.addicteddopeness.netcpanel.addicteddopeness.comcpanel.addicteddopeness.netcpcalendars.addicteddopeness.comcpcalendars.addicteddopeness.netcpcontacts.addicteddopeness.comcpcontacts.addicteddopeness.netmail.addicteddopeness.commail.addicteddopeness.netwebdisk.addicteddopeness.comwebdisk.addicteddopeness.netwebmail.addicteddopeness.comwebmail.addicteddopeness.netwww.addicteddopeness.addicteddopeness.netwww.addicteddopeness.comwww.addicteddopeness.net
autodiscover.octometal.comcpanel.octometal.comcpcalendars.octometal.comcpcontacts.octometal.commail.octometal.comoctometal.comwebdisk.octometal.comwebmail.octometal.comwww.octometal.com
autodiscover.ipr.org.pkcpcalendars.ipr.org.pkcpcontacts.ipr.org.pkipr.org.pkmail.ipr.org.pkwebdisk.ipr.org.pkwww.ipr.org.pk
autodiscover.npo-qa.comcpanel.npo-qa.comcpcalendars.npo-qa.comcpcontacts.npo-qa.commail.npo-qa.commail.riq.mrn.mybluehost.menpo-qa.comriq.mrn.mybluehost.mewebdisk.npo-qa.comwebmail.npo-qa.comwebsite-6959964d.npo-qa.comwww.npo-qa.comwww.riq.mrn.mybluehost.mewww.website-6959964d.npo-qa.com
autodiscover.westernlottoandbet.comcpanel.westernlottoandbet.comcpcalendars.westernlottoandbet.comcpcontacts.westernlottoandbet.commail.westernlottoandbet.comwebdisk.westernlottoandbet.comwebmail.westernlottoandbet.comwesternlottoandbet.comwesternlottoandbet.nep.hnq.mybluehost.mewww.westernlottoandbet.comwww.westernlottoandbet.nep.hnq.mybluehost.me
calmingwavesofbakersfield.legendinx.comwww.calmingwavesofbakersfield.legendinx.com
autodiscover.guidingpc.comcpanel.guidingpc.comcpcalendars.guidingpc.comcpcontacts.guidingpc.comguidingpc.commail.guidingpc.comwebdisk.guidingpc.comwebmail.guidingpc.comwww.guidingpc.com
autodiscover.janacharvat.comcpanel.janacharvat.comcpcalendars.janacharvat.comcpcontacts.janacharvat.comjanacharvat.commail.janacharvat.comwebdisk.janacharvat.comwebmail.janacharvat.comwww.janacharvat.com
cpanel.kinseycre.comcpcalendars.kinseycre.comcpcontacts.kinseycre.comkinseycre.commail.kinseycre.comwebdisk.kinseycre.comwebmail.kinseycre.comwww.kinseycre.com
5gmale.revsz.combitcoin.revsz.comherpagreens.revsz.comimmunity911.revsz.cominternal911.revsz.comkeravitapro.revsz.comnervecontrol911.revsz.comreversirol.revsz.comsnowteethwhitening.revsz.comultrafx10.revsz.comvolumil.revsz.comwww.5gmale.revsz.comwww.bitcoin.revsz.comwww.herpagreens.revsz.comwww.immunity911.revsz.comwww.internal911.revsz.comwww.keravitapro.revsz.comwww.nervecontrol911.revsz.comwww.reversirol.revsz.comwww.snowteethwhitening.revsz.comwww.ultrafx10.revsz.comwww.volumil.revsz.comwww.xterilizerrobot.revsz.comxterilizerrobot.revsz.com
autodiscover.handstoheartcpr.netcpanel.handstoheartcpr.netcpcalendars.handstoheartcpr.netcpcontacts.handstoheartcpr.nethandstoheartcpr-net.legendinx.comhandstoheartcpr.netmail.handstoheartcpr.netwebdisk.handstoheartcpr.netwebmail.handstoheartcpr.netwww.handstoheartcpr-net.legendinx.comwww.handstoheartcpr.net
autodiscover.stephanieferrara.combrandbuilderintensive.empoweredcreativitycoach.comcpanel.stephanieferrara.comcpcalendars.stephanieferrara.comcpcontacts.stephanieferrara.commail.stephanieferrara.comstephanieferrara.comstephanieferrara.empoweredcreativitycoach.comwebdisk.stephanieferrara.comwebmail.stephanieferrara.comwww.brandbuilderintensive.empoweredcreativitycoach.comwww.stephanieferrara.comwww.stephanieferrara.empoweredcreativitycoach.com
mail.nsx.zgu.mybluehost.menaturaljunkie.comnsx.zgu.mybluehost.mewww.naturaljunkie.comwww.nsx.zgu.mybluehost.me
autodiscover.fuerzapublishinghouse.blogcpanel.fuerzapublishinghouse.blogcpcalendars.fuerzapublishinghouse.blogcpcontacts.fuerzapublishinghouse.blogfuerzapublishinghouse.blogmail.fuerzapublishinghouse.blogwebdisk.fuerzapublishinghouse.blogwebmail.fuerzapublishinghouse.blogwww.fuerzapublishinghouse.blog
cpanel.therealandthereckoned.commail.therealandthereckoned.comwebmail.therealandthereckoned.com
childfundpoliticas.elaticogt.comwww.childfundpoliticas.elaticogt.com
autodiscover.laurauzun.comautodiscover.myempoweringlife.comcpanel.laurauzun.comcpanel.myempoweringlife.comcpcalendars.laurauzun.comcpcalendars.myempoweringlife.comcpcontacts.laurauzun.comcpcontacts.myempoweringlife.comlaurauzun.commail.laurauzun.commail.mwl.lgu.mybluehost.memail.myempoweringlife.commwl.lgu.mybluehost.memyempoweringlife.comwebdisk.laurauzun.comwebdisk.myempoweringlife.comwebmail.laurauzun.comwebmail.myempoweringlife.comwebsite-3da24e9e.myempoweringlife.comwww.laurauzun.comwww.mwl.lgu.mybluehost.mewww.myempoweringlife.comwww.website-3da24e9e.myempoweringlife.com
autodiscover.workingtheimage.caautodiscover.workingtheimage.comcpanel.workingtheimage.cacpanel.workingtheimage.comcpcalendars.workingtheimage.cacpcalendars.workingtheimage.comcpcontacts.workingtheimage.cacpcontacts.workingtheimage.commail.workingtheimage.camail.workingtheimage.comwebdisk.workingtheimage.cawebdisk.workingtheimage.comwebmail.workingtheimage.cawebmail.workingtheimage.comworkingtheimage-ca.writeeditcopy.comworkingtheimage.caworkingtheimage.comworkingtheimage.writeeditcopy.comwww.workingtheimage-ca.writeeditcopy.comwww.workingtheimage.cawww.workingtheimage.comwww.workingtheimage.writeeditcopy.com
nervedefend.revsz.comwww.nervedefend.revsz.com
autodiscover.chinesecolorcode.comchinesecolorcode.comcpanel.chinesecolorcode.comcpcalendars.chinesecolorcode.comcpcontacts.chinesecolorcode.commail.chinesecolorcode.comwebdisk.chinesecolorcode.comwebmail.chinesecolorcode.comwww.chinesecolorcode.com
picare-ai.jcq.gxm.mybluehost.mepicare.aiwww.picare-ai.jcq.gxm.mybluehost.mewww.picare.ai
abmtahid.comautodiscover.abmtahid.comcpanel.abmtahid.comcpcalendars.abmtahid.comcpcontacts.abmtahid.commail.abmtahid.comwebdisk.abmtahid.comwebmail.abmtahid.comwww.abmtahid.com
autodiscover.countrywidecoffee.comcountrywidecoffee.comcpanel.countrywidecoffee.comcpcalendars.countrywidecoffee.comcpcontacts.countrywidecoffee.commail.countrywidecoffee.comwebdisk.countrywidecoffee.comwebmail.countrywidecoffee.comwebsite-da3768b8.legendinx.comwww.countrywidecoffee.comwww.website-da3768b8.legendinx.com
prodentim.revsz.comprostadine.revsz.comsynogut.revsz.comwww.prodentim.revsz.comwww.prostadine.revsz.comwww.synogut.revsz.com
autodiscover.guatech.onlinecpanel.guatech.onlinecpcalendars.guatech.onlinecpcontacts.guatech.onlineguatech.onlinemail.guatech.onlinewebdisk.guatech.onlinewebmail.guatech.onlinewww.guatech.online
autodiscover.omargonzalezphotography.comcpanel.omargonzalezphotography.comcpcalendars.omargonzalezphotography.comcpcontacts.omargonzalezphotography.commail.omargonzalezphotography.comomargonzalezphotography.comwebdisk.omargonzalezphotography.comwebmail.omargonzalezphotography.comwww.omargonzalezphotography.com
autodiscover.marchostetter.comcpanel.marchostetter.comcpcalendars.marchostetter.comcpcontacts.marchostetter.commail.marchostetter.commarchostetter.comwebdisk.marchostetter.comwebmail.marchostetter.comwww.marchostetter.com
carvengineering.comcarvengineering.legendinx.comcpanel.carvengineering.comcpcalendars.carvengineering.comcpcontacts.carvengineering.commail.carvengineering.comwebdisk.carvengineering.comwebmail.carvengineering.comwww.carvengineering.comwww.carvengineering.legendinx.com
davolynindustries.davolynindustries.comwww.davolynindustries.davolynindustries.com
autodiscover.ocd5280.comcpanel.ocd5280.comcpcalendars.ocd5280.comcpcontacts.ocd5280.commail.ocd5280.comocd5280.cid5280.comocd5280.comwebdisk.ocd5280.comwebmail.ocd5280.comwww.ocd5280.cid5280.comwww.ocd5280.com
autodiscover.pinmeuputah.comcpanel.pinmeuputah.comcpcalendars.pinmeuputah.comcpcontacts.pinmeuputah.commail.pinmeuputah.compinmeuputah.comwebdisk.pinmeuputah.comwebmail.pinmeuputah.comwww.pinmeuputah.com
autodiscover.originaldemolition.combikebakersfield-org.legendinx.combikebakersfield.orgcpanel.bikebakersfield.orgcpanel.originaldemolition.comcpcalendars.bikebakersfield.orgcpcalendars.originaldemolition.comcpcontacts.bikebakersfield.orgcpcontacts.originaldemolition.commail.bikebakersfield.orgmail.originaldemolition.comoriginaldemolition.comoriginaldemolition.legendinx.comwebdisk.bikebakersfield.orgwebdisk.originaldemolition.comwebmail.bikebakersfield.orgwebmail.originaldemolition.comwww.bikebakersfield-org.legendinx.comwww.bikebakersfield.orgwww.originaldemolition.comwww.originaldemolition.legendinx.com
flexorol.revsz.comflexotone.revsz.comwww.flexorol.revsz.comwww.flexotone.revsz.com
cpanel.unicoach.comcpcalendars.unicoach.comcpcontacts.unicoach.commail.unicoach.comunicoach.comwebdisk.unicoach.comwebmail.unicoach.comwww.unicoach.com
autodiscover.neufeldmissions.comcpanel.neufeldmissions.comcpcalendars.neufeldmissions.comcpcontacts.neufeldmissions.commail.neufeldmissions.comneufeldmissions.comwebdisk.neufeldmissions.comwebmail.neufeldmissions.comwww.neufeldmissions.com
cpanel.oneflymama.comcpcalendars.oneflymama.comcpcontacts.oneflymama.commail.oneflymama.commail.xlt.ddq.mybluehost.meoneflymama.comwebdisk.oneflymama.comwebmail.oneflymama.comwww.oneflymama.comwww.xlt.ddq.mybluehost.mexlt.ddq.mybluehost.me
autodiscover.sheilasinspiredlife.comcpanel.sheilasinspiredlife.comcpcalendars.sheilasinspiredlife.comcpcontacts.sheilasinspiredlife.commail.sheilasinspiredlife.comsheilasinspiredlife.comwebdisk.sheilasinspiredlife.comwebmail.sheilasinspiredlife.comwww.sheilasinspiredlife.com
autodiscover.stefanieharrington.comcpanel.stefanieharrington.comcpcalendars.stefanieharrington.comcpcontacts.stefanieharrington.commail.stefanieharrington.comstefanieharrington.comwebdisk.stefanieharrington.comwebmail.stefanieharrington.comwww.stefanieharrington.com
autodiscover.promedverify.comcpanel.promedverify.comcpcalendars.promedverify.comcpcontacts.promedverify.commail.promedverify.compromedverify.comwebdisk.promedverify.comwebmail.promedverify.comwww.promedverify.com
cbdiemorganics.comwww.cbdiemorganics.com
autodiscover.gotogordoncomputers.comcpanel.gotogordoncomputers.comcpcalendars.gotogordoncomputers.comcpcontacts.gotogordoncomputers.comgotogordon.comgotogordoncomputers.commail.gotogordon.commail.gotogordoncomputers.comwebdisk.gotogordoncomputers.comwebmail.gotogordoncomputers.comwww.gotogordon.comwww.gotogordoncomputers.com
autodiscover.gnx.ubp.mybluehost.mecpanel.gnx.ubp.mybluehost.mecpcalendars.gnx.ubp.mybluehost.mecpcontacts.gnx.ubp.mybluehost.megnx.ubp.mybluehost.memail.gnx.ubp.mybluehost.mewebdisk.gnx.ubp.mybluehost.mewebmail.gnx.ubp.mybluehost.mewww.gnx.ubp.mybluehost.me
autodiscover.kaizenmagic.comcpanel.kaizenmagic.comcpcalendars.kaizenmagic.comcpcontacts.kaizenmagic.comkaizenmagic.commail.kaizenmagic.comwebdisk.kaizenmagic.comwebmail.kaizenmagic.comwebsite-ee7bbefa.wan.vec.mybluehost.mewww.kaizenmagic.comwww.website-ee7bbefa.wan.vec.mybluehost.me
a1-freight.comautodiscover.a1-freight.comcpanel.a1-freight.comcpcalendars.a1-freight.comcpcontacts.a1-freight.commail.a1-freight.comtribalmerch.whoisduck.comwebdisk.a1-freight.comwebmail.a1-freight.comwww.a1-freight.comwww.tribalmerch.whoisduck.com
binkleystore.binkleystore.comwww.binkleystore.binkleystore.com
autodiscover.karelwalle.comcpanel.karelwalle.comcpcalendars.karelwalle.comcpcontacts.karelwalle.comkarelwalle.commail.karelwalle.comwebdisk.karelwalle.comwebmail.karelwalle.comwww.karelwalle.com
foliforce.revsz.comocutamin.revsz.comprimaslim.revsz.comspinalforce.revsz.comwww.foliforce.revsz.comwww.ocutamin.revsz.comwww.primaslim.revsz.comwww.spinalforce.revsz.com
cpanel.theheartofbehavior.comcpcalendars.theheartofbehavior.comcpcontacts.theheartofbehavior.commail.theheartofbehavior.comtheheartofbehavior.comwebdisk.theheartofbehavior.comwebmail.theheartofbehavior.comwww.theheartofbehavior.com
autodiscover.sincerelymemoona.comcpanel.sincerelymemoona.comcpcalendars.sincerelymemoona.comcpcontacts.sincerelymemoona.commail.sincerelymemoona.comsincerelymemoona.comwebdisk.sincerelymemoona.comwebmail.sincerelymemoona.comwww.sincerelymemoona.com
autodiscover.bmwdiys.comautodiscover.uzunrealestate.combmwdiys.combmwdiys.myempoweringlife.comcpanel.bmwdiys.comcpanel.uzunrealestate.comcpcalendars.bmwdiys.comcpcalendars.uzunrealestate.comcpcontacts.bmwdiys.comcpcontacts.uzunrealestate.commail.bmwdiys.comuzunrealestate.comuzunrealestate.myempoweringlife.comwebdisk.bmwdiys.comwebdisk.uzunrealestate.comwebmail.bmwdiys.comwebmail.uzunrealestate.comwww.bmwdiys.comwww.bmwdiys.myempoweringlife.comwww.uzunrealestate.comwww.uzunrealestate.myempoweringlife.com
autodiscover.familyburton.comcpanel.familyburton.comcpcalendars.familyburton.comcpcontacts.familyburton.comfamilyburton.commail.familyburton.comwebdisk.familyburton.comwebmail.familyburton.comwww.familyburton.com
autodiscover.socialpri.mecpanel.socialpri.mecpcalendars.socialpri.mecpcontacts.socialpri.memail.socialpri.mesocialpri.mewebdisk.socialpri.mewebmail.socialpri.mewww.socialpri.me
autodiscover.kingsklosetny.comcpanel.kingsklosetny.comcpcalendars.kingsklosetny.comcpcontacts.kingsklosetny.comkingsklosetny.commail.kingsklosetny.comwebdisk.kingsklosetny.comwebmail.kingsklosetny.comwww.kingsklosetny.com
autodiscover.p23.orgcpanel.p23.orgcpcalendars.p23.orgcpcontacts.p23.orgmail.p23.orgp23.orgwebdisk.p23.orgwebmail.p23.orgwww.p23.org
texasstylerv.comtexasstylerv.heatherandthedogs.comwww.texasstylerv.heatherandthedogs.com
klorrainesalon.commail.klorrainesalon.comwww.klorrainesalon.com
autodiscover.healthmediapolicy.comcpanel.healthmediapolicy.comcpcalendars.healthmediapolicy.comcpcontacts.healthmediapolicy.comhealthmediapolicy.comhealthmediapolicy.orgmail.healthmediapolicy.commail.healthmediapolicy.orgwebdisk.healthmediapolicy.comwebmail.healthmediapolicy.comwww.healthmediapolicy.comwww.healthmediapolicy.org
curafen.revsz.comskincellpr.revsz.comwisdom.revsz.comwww.curafen.revsz.comwww.skincellpr.revsz.comwww.wisdom.revsz.com
autodiscover.kyu.bxt.mybluehost.mecpanel.kyu.bxt.mybluehost.mecpcalendars.kyu.bxt.mybluehost.mecpcontacts.kyu.bxt.mybluehost.meinnersherpa.lifekyu.bxt.mybluehost.memail.innersherpa.lifemail.kyu.bxt.mybluehost.mewebdisk.kyu.bxt.mybluehost.mewebmail.kyu.bxt.mybluehost.mewww.innersherpa.lifewww.kyu.bxt.mybluehost.me
autodiscover.ladowellphotography.comcpanel.ladowellphotography.comcpcalendars.ladowellphotography.comcpcontacts.ladowellphotography.comladowellphotography.commail.ladowellphotography.comwebdisk.ladowellphotography.comwebmail.ladowellphotography.comwww.ladowellphotography.com
autodiscover.virtuallykari.comcpanel.virtuallykari.comcpcalendars.virtuallykari.comcpcontacts.virtuallykari.commail.virtuallykari.comvirtuallykari.comwebdisk.virtuallykari.comwebmail.virtuallykari.comwww.virtuallykari.com
absoluteprohibition-org.aka.auj.mybluehost.meabsoluteprohibition.orgautodiscover.absoluteprohibition.orgcpanel.absoluteprohibition.orgcpcalendars.absoluteprohibition.orgcpcontacts.absoluteprohibition.orgmail.absoluteprohibition.orgwebdisk.absoluteprohibition.orgwebmail.absoluteprohibition.orgwww.absoluteprohibition-org.aka.auj.mybluehost.mewww.absoluteprohibition.org
autodiscover.empoweredcreativitycoach.comcpanel.empoweredcreativitycoach.comcpcalendars.empoweredcreativitycoach.comcpcontacts.empoweredcreativitycoach.comempoweredcreativitycoach.comferraralimited.comkingdombizincubator.commail.empoweredcreativitycoach.commail.ferraralimited.commail.kingdombizincubator.comwebdisk.empoweredcreativitycoach.comwebmail.empoweredcreativitycoach.comwww.empoweredcreativitycoach.comwww.ferraralimited.comwww.kingdombizincubator.com
mosaiclanguageservices.znt.nmp.mybluehost.mewww.mosaiclanguageservices.znt.nmp.mybluehost.me
aguadelavillahn.comautodiscover.aguadelavillahn.comcpanel.aguadelavillahn.comcpcalendars.aguadelavillahn.comcpcontacts.aguadelavillahn.commail.aguadelavillahn.comwebdisk.aguadelavillahn.comwebmail.aguadelavillahn.comwww.aguadelavillahn.com
autodiscover.eurekalearning.cacpanel.eurekalearning.cacpcalendars.eurekalearning.cacpcontacts.eurekalearning.caeurekalearning-ca.oiv.qwy.mybluehost.meeurekalearning.camail.eurekalearning.cawebdisk.eurekalearning.cawebmail.eurekalearning.cawww.eurekalearning-ca.oiv.qwy.mybluehost.mewww.eurekalearning.ca
autodiscover.megapowerantigua.comcpanel.megapowerantigua.comcpcalendars.megapowerantigua.comcpcontacts.megapowerantigua.commegapowerantigua.comwebdisk.megapowerantigua.comwebmail.megapowerantigua.comwww.megapowerantigua.com
autodiscover.prldood.comcpanel.prldood.comcpcalendars.prldood.comcpcontacts.prldood.commail.prldood.comprldood.comprldood.pacificrimlabradoodles.comwebdisk.prldood.comwebmail.prldood.comwww.prldood.comwww.prldood.pacificrimlabradoodles.com
autodiscover.rsmrf.orgcpanel.rsmrf.orgcpcalendars.rsmrf.orgcpcontacts.rsmrf.orgmail.rsmrf.orgrsmrf-org.asndi.orgrsmrf.orgwebdisk.rsmrf.orgwebmail.rsmrf.orgwww.rsmrf-org.asndi.orgwww.rsmrf.org
testing.careaidafrica.orgwww.testing.careaidafrica.org
autodiscover.zuj.nxb.mybluehost.mecpanel.zuj.nxb.mybluehost.mecpcalendars.zuj.nxb.mybluehost.mecpcontacts.zuj.nxb.mybluehost.memail.zuj.nxb.mybluehost.mewebdisk.zuj.nxb.mybluehost.mewebmail.zuj.nxb.mybluehost.mewww.zuj.nxb.mybluehost.mezuj.nxb.mybluehost.me
autodiscover.torchpodcast.comcpanel.torchpodcast.comcpcalendars.torchpodcast.comcpcontacts.torchpodcast.commail.tianamadera.commail.torchpodcast.comtianamadera.comtorchpodcast.comwebdisk.torchpodcast.comwebmail.torchpodcast.comwww.tianamadera.comwww.torchpodcast.com
autodiscover.unsbet365.comcpanel.unsbet365.comcpcalendars.unsbet365.comcpcontacts.unsbet365.commail.unsbet365.comunsbet365.comwebdisk.unsbet365.comwebmail.unsbet365.comwww.unsbet365.com
autodiscover.drumair.comcpanel.drumair.comcpcalendars.drumair.comcpcontacts.drumair.comdrumair.commail.drumair.comphotos.drumair.comwebdisk.drumair.comwebmail.drumair.comwww.drumair.comwww.photos.drumair.com
autodiscover.youngsteadtlab.orgcpanel.youngsteadtlab.orgcpcalendars.youngsteadtlab.orgcpcontacts.youngsteadtlab.orgmail.youngsteadtlab.orgwebdisk.youngsteadtlab.orgwebmail.youngsteadtlab.orgwww.youngsteadtlab-org.rda.ruz.mybluehost.mewww.youngsteadtlab.orgyoungsteadtlab-org.rda.ruz.mybluehost.meyoungsteadtlab.org
autodiscover.stdgbfs.comautodiscover.worldwidebh.comcpanel.stdgbfs.comcpanel.worldwidebh.comcpcalendars.stdgbfs.comcpcalendars.worldwidebh.comcpcontacts.stdgbfs.comcpcontacts.worldwidebh.commail.stdgbfs.commail.worldwidebh.comstdgbfs.comstdgbfs.ja-developments.comwebdisk.stdgbfs.comwebdisk.worldwidebh.comwebmail.stdgbfs.comwebmail.worldwidebh.comworldwidebh.comworldwidebh.ja-developments.comwww.stdgbfs.comwww.stdgbfs.ja-developments.comwww.worldwidebh.comwww.worldwidebh.ja-developments.com
autodiscover.pangealds.comcpanel.pangealds.comcpcalendars.pangealds.comcpcontacts.pangealds.commail.pangealds.compangealds.compangealds.whcapitalleasing.comwebdisk.pangealds.comwebmail.pangealds.comwww.pangealds.comwww.pangealds.whcapitalleasing.com
autodiscover.pangeafiltration.comcpanel.pangeafiltration.comcpcalendars.pangeafiltration.comcpcontacts.pangeafiltration.commail.pangeafiltration.compangeafiltration.compangeafiltration.whcapitalleasing.comwebdisk.pangeafiltration.comwebmail.pangeafiltration.comwww.pangeafiltration.comwww.pangeafiltration.whcapitalleasing.com
oliviaf17-sg-host-com.cid5280.comwww.oliviaf17-sg-host-com.cid5280.com
cpanel.tribuinterior.comtribuinterior.comwebmail.tribuinterior.comwww.tribuinterior.com
autodiscover.awamanchester.org.ukawamanchester.org.ukcpanel.awamanchester.org.ukcpcalendars.awamanchester.org.ukcpcontacts.awamanchester.org.ukmail.awamanchester.org.ukwebdisk.awamanchester.org.ukwebmail.awamanchester.org.ukwww.awamanchester.org.uk
autodiscover.brainsts.combrainsts.comcpanel.brainsts.comcpcalendars.brainsts.comcpcontacts.brainsts.commail.brainsts.comsupport.brainsts.comwebdisk.brainsts.comwebmail.brainsts.comwww.brainsts.comwww.support.brainsts.com
cpcontacts.elitemortgage.co.nzelitemortgage.co.nziflextech.co.nzwebdisk.elitemortgage.co.nzwww.elitemortgage.co.nzwww.iflextech.co.nz
autodiscover.theraisingdad.comcpanel.theraisingdad.comcpcalendars.theraisingdad.comcpcontacts.theraisingdad.commail.theraisingdad.comtheraisingdad.comwebdisk.theraisingdad.comwebmail.theraisingdad.comwww.theraisingdad.com
autodiscover.carv-design.comautodiscover.robbinshottubs.comcarv-design.comcarv-design.legendinx.comcpanel.carv-design.comcpanel.robbinshottubs.comcpcalendars.carv-design.comcpcalendars.robbinshottubs.comcpcontacts.carv-design.comcpcontacts.robbinshottubs.commail.carv-design.commail.robbinshottubs.comrobbinshottubs.comrobbinshottubs.legendinx.comwebdisk.carv-design.comwebdisk.robbinshottubs.comwebmail.carv-design.comwebmail.robbinshottubs.comwww.carv-design.comwww.carv-design.legendinx.comwww.robbinshottubs.comwww.robbinshottubs.legendinx.com
autodiscover.carlamyoung.comcarlamyoung.comcpanel.carlamyoung.comcpcalendars.carlamyoung.comcpcontacts.carlamyoung.commail.carlamyoung.comtailoredcivilianlife.carlamyoung.comwebdisk.carlamyoung.comwebmail.carlamyoung.comwww.carlamyoung.comwww.tailoredcivilianlife.carlamyoung.com
autodiscover.minotmasoniccenter.orgcpanel.minotmasoniccenter.orgcpcalendars.minotmasoniccenter.orgcpcontacts.minotmasoniccenter.orgmail.minotmasoniccenter.orgminotmasoniccenter.orgwebdisk.minotmasoniccenter.orgwebmail.minotmasoniccenter.orgwebsite-52c62bbe.biztechnd.comwww.minotmasoniccenter.orgwww.website-52c62bbe.biztechnd.com
impactfulseo.simplywebseo.comkakyn.simplywebseo.comwww.impactfulseo.simplywebseo.comwww.kakyn.simplywebseo.com
floralite.revsz.comwww.floralite.revsz.com
socialmedia.tsnpa.orgwww.socialmedia.tsnpa.org
ollieonlinemarketing.olivemoondancewear.comwww.ollieonlinemarketing.olivemoondancewear.com
autodiscover.jmasonassociates.co.ukcpanel.jmasonassociates.co.ukcpcalendars.jmasonassociates.co.ukcpcontacts.jmasonassociates.co.ukjmasonassociates.co.ukmail.jmasonassociates.co.ukwebdisk.jmasonassociates.co.ukwebmail.jmasonassociates.co.ukwww.jmasonassociates.co.uk
autodiscover.wzr.mzi.mybluehost.mecpanel.wzr.mzi.mybluehost.mecpcalendars.wzr.mzi.mybluehost.mecpcontacts.wzr.mzi.mybluehost.memail.wzr.mzi.mybluehost.mewebdisk.wzr.mzi.mybluehost.mewebmail.wzr.mzi.mybluehost.mewww.wzr.mzi.mybluehost.mewzr.mzi.mybluehost.me
blog.brooketuckerphotography.comwww.blog.brooketuckerphotography.com
autodiscover.lauratyephotography.comcpanel.lauratyephotography.comcpcalendars.lauratyephotography.comcpcontacts.lauratyephotography.commail.lauratyephotography.commail.mckinneynewbornphotographer.commckinneynewbornphotographer.comwebdisk.lauratyephotography.comwebmail.lauratyephotography.comwhimsyandwander.lauratyephotography.comwww.mckinneynewbornphotographer.comwww.whimsyandwander.lauratyephotography.com
guidingpoint.orgwww.guidingpoint.org
records.ncethicalsociety.orgwww.records.ncethicalsociety.org
autodiscover.beverlypetclinic.combeverlypetclinic.comcpanel.beverlypetclinic.comcpcalendars.beverlypetclinic.comcpcontacts.beverlypetclinic.commail.beverlypetclinic.comwebdisk.beverlypetclinic.comwebmail.beverlypetclinic.comwww.beverlypetclinic.com
autodiscover.earthsolutionsinc.comcpanel.earthsolutionsinc.comcpcalendars.earthsolutionsinc.comcpcontacts.earthsolutionsinc.comearthsolutionsinc.commail.earthsolutionsinc.comwebdisk.earthsolutionsinc.comwebmail.earthsolutionsinc.comwww.earthsolutionsinc.com
autodiscover.gracepugetsound.comcpanel.gracepugetsound.comcpcalendars.gracepugetsound.comcpcontacts.gracepugetsound.comgracepugetsound.comwebdisk.gracepugetsound.comwebmail.gracepugetsound.comwww.gracepugetsound.com
autodiscover.crpdcourse.orgcpanel.crpdcourse.orgcpcalendars.crpdcourse.orgcpcontacts.crpdcourse.orgcrpdcourse-org.aka.auj.mybluehost.mecrpdcourse.orgmail.crpdcourse.orgwebdisk.crpdcourse.orgwebmail.crpdcourse.orgwww.crpdcourse-org.aka.auj.mybluehost.mewww.crpdcourse.org
autodiscover.rebornbuild.comcpanel.rebornbuild.comcpcalendars.rebornbuild.comcpcontacts.rebornbuild.commail.rebornbuild.comrebornbuild.cid5280.comrebornbuild.comwebdisk.rebornbuild.comwebmail.rebornbuild.comwww.rebornbuild.cid5280.comwww.rebornbuild.com
mail.resourcewealthmanagement.comresourceinsuranceadvisors.comresourcewealthmanagement.comwww.resourceinsuranceadvisors.comwww.resourcewealthmanagement.com
autodiscover.mesllcga.comcpanel.mesllcga.comcpcalendars.mesllcga.comcpcontacts.mesllcga.commail.mesllcga.commesllcga.comwebdisk.mesllcga.comwebmail.mesllcga.comwww.mesllcga.com
nikolaikleistburkal.art-beats.comwww.nikolaikleistburkal.art-beats.com
autodiscover.laurasellsfla.comcpanel.laurasellsfla.comcpcalendars.laurasellsfla.comcpcontacts.laurasellsfla.comlaurasellsfla.commail.laurasellsfla.comwebdisk.laurasellsfla.comwebmail.laurasellsfla.comwebsite-d7bb6939.myempoweringlife.comwww.laurasellsfla.comwww.website-d7bb6939.myempoweringlife.com
autodiscover.womeninminerals.comcpanel.womeninminerals.comcpcalendars.womeninminerals.comcpcontacts.womeninminerals.commail.womeninminerals.comwebdisk.womeninminerals.comwebmail.womeninminerals.comwomeninminerals.comwww.womeninminerals.com
alohadavecookies.comautodiscover.alohadavecookies.comcpanel.alohadavecookies.comcpcalendars.alohadavecookies.comcpcontacts.alohadavecookies.commail.alohadavecookies.comwebdisk.alohadavecookies.comwebmail.alohadavecookies.comwww.alohadavecookies.com
hollyberryherbal.commail.hollyberryherbal.comwww.hollyberryherbal.com
positivevibes.sailsinthewind.comthetealcircle.comthetealcircle.sailsinthewind.comwww.positivevibes.sailsinthewind.comwww.thetealcircle.comwww.thetealcircle.sailsinthewind.com
casecashfinancing.comcasecashfinancing.jcq.gxm.mybluehost.mecpanel.casecashfinancing.comwww.casecashfinancing.comwww.casecashfinancing.jcq.gxm.mybluehost.me
autodiscover.thepumpkinbatch.comcpanel.thepumpkinbatch.comcpcalendars.thepumpkinbatch.comcpcontacts.thepumpkinbatch.commail.thepumpkinbatch.comthepumpkinbatch.comthepumpkinbatch.serenafedor.comwebdisk.thepumpkinbatch.comwebmail.thepumpkinbatch.comwww.thepumpkinbatch.comwww.thepumpkinbatch.serenafedor.com
autodiscover.donutdevdesign.comautodiscover.holywaterwashes.comcpanel.donutdevdesign.comcpanel.holywaterwashes.comcpcalendars.donutdevdesign.comcpcalendars.holywaterwashes.comcpcontacts.donutdevdesign.comcpcontacts.holywaterwashes.comdonutdevdesign.comdonutdevdesign.legendinx.comholywaterwashes.comholywaterwashes.legendinx.commail.donutdevdesign.commail.holywaterwashes.comwebdisk.donutdevdesign.comwebdisk.holywaterwashes.comwebmail.donutdevdesign.comwebmail.holywaterwashes.comwww.donutdevdesign.comwww.donutdevdesign.legendinx.comwww.holywaterwashes.comwww.holywaterwashes.legendinx.com
autodiscover.bgsclassof96.combgsclassof96.combgsclassof96.novajetservices.comcpanel.bgsclassof96.comcpcalendars.bgsclassof96.comcpcontacts.bgsclassof96.commail.bgsclassof96.comwebdisk.bgsclassof96.comwebmail.bgsclassof96.comwww.bgsclassof96.comwww.bgsclassof96.novajetservices.com
braunleder.com
autodiscover.fruitfulfoodforestry.comcpanel.fruitfulfoodforestry.comcpcalendars.fruitfulfoodforestry.comcpcontacts.fruitfulfoodforestry.comfruitfulfoodforestry.artofrv.comfruitfulfoodforestry.commail.fruitfulfoodforestry.comwebdisk.fruitfulfoodforestry.comwebmail.fruitfulfoodforestry.comwww.fruitfulfoodforestry.artofrv.comwww.fruitfulfoodforestry.com
Domain summary
ehstrecords-info.ncethicalsociety.org 14 www.records.ncethicalsociety.org 11 www.ehstrecords-info.ncethicalsociety.org 11 records.ncethicalsociety.org 10 www.128path-org.charleskeil.org 9 128path.org 8 mail.128path.org 8 128path-org.charleskeil.org 8 www.128path.org 7 mail.0ec.es 5 mail.musicgrooves.org 4 www.musicgrooves.org 4 www.0ec.ammanetwork.org 4 www.0ec.es 4 0ec.es 4 www.musicgrooves-org.charleskeil.org 4 0ec.ammanetwork.org 4 musicgrooves-org.charleskeil.org 3 musicgrooves.org 3 whoisduck.com 2 4irmicrogrid.com 2 www.committeetoendslavery.com 2 mail.committeetoendslavery.com 2 www.leeolsonforsenate.com 2 leeolsonforsenate.com 2 committeetoendslavery.com 2 newcenturyleadership.musicbeginnersguide.com 2 www.newcenturyleadership.musicbeginnersguide.com 2 www.newcenturyleadership-net.musicbeginnersguide.com 2 newcenturyleadership-org.musicbeginnersguide.com 2 www.newcenturyleadership-org.musicbeginnersguide.com 2 newcenturyleadership-net.musicbeginnersguide.com 2 www.valdrada.ammanetwork.org 2 valdrada.ammanetwork.org 2 rapecrisiscounseling-org.expatbackup.com 2 www.estonishingevenings.com 2 alejandrobosqued.ammanetwork.org 2 mail.anderson4bellingham.com 2 mail.reliancemachinecompany.com 2 mail.rapecrisiscounseling.org 2 mail.chuagh.net 2 www.anderson4bellingham.taradactyldesign.com 2 mail.whoisduck.com 2 alejandrobosqued.com 2 www.wildacornapothecary.com 2 4ir-microgrid.com 2 chuagh.net 2 gracepugetsound.com 2 www.rapecrisiscounseling-org.expatbackup.com 2 4ir-microgrid.whcapitalleasing.com 2 www.reliancemachinecompany.com 2 www.alejandrobosqued.ammanetwork.org 2 www.4irmicrogrid.whcapitalleasing.com 2 www.4irmicrogrid.com 2 www.4ir-microgrid.com 2 www.wildacornapothecary.thebrandstand.co 2 www.alejandrobosqued.com 2 mail.4irmicrogrid.com 2 mail.leeolsonforsenate.com 2 wildacornapothecary.com 2 reliancemachinecompany.com 2 mail.wildacornapothecary.com 2 www.radiantheartmedia.expatbackup.com 2 mail.4ir-microgrid.com 2 www.4ir-microgrid.whcapitalleasing.com 2 radiantheartmedia.expatbackup.com 2 mail.estonishingevenings.com 2 anderson4bellingham.taradactyldesign.com 3 4irmicrogrid.whcapitalleasing.com 2 estonishingevenings.com 3 wildacornapothecary.thebrandstand.co 2 www.shows.truesole.net 2 brightbalkanmorning.charleskeil.org 2 committeetoendslavery.bestexpertpicks.com 2 mail.radiantheartmedia.com 2 www.brightbalkanmorning.charleskeil.org 2 shows.truesole.net 2 mail.gracepugetsound.com 2 www.whoisduck.com 2 www.leeolsonforsenate.bestexpertpicks.com 2 anderson4bellingham.com 2 www.committeetoendslavery.bestexpertpicks.com 2 www.chuagh.net 2 www.anderson4bellingham.com 2 www.gracepugetsound.com 2 leeolsonforsenate.bestexpertpicks.com 2 brightbalkanmorning.com 1 mail.brightbalkanmorning.com 1 www.stdbfs.com 1 stdbfs.ja-developments.com 1 mail.stdbfs.com 1 stdbfs.com 1 www.brightbalkanmorning.com 1 www.tube.dianaeftaiha.com 1 www.stdbfs.ja-developments.com 1 tube.dianaeftaiha.com 1 www.radiantheartmedia.com 1 mail.jpb.dmo.mybluehost.me 0 sheilasinspiredlife.com 0 mail.writeeditcopy.ca 0 www.caldasyrios.com 0 mail.helperinnovations.com 0 www.hiy.ddq.mybluehost.me 0 tetrasteelworx.guidingpc.com 0 www.pirate.courses 0 mail.dallengilman.com 0 mail.hvacunionnj.com 0 www.vum.kdq.mybluehost.me 0 www.healthfinance.ng 0 tetraig.com 0 gkoled.com 0 mail.sterlinghard1.com 0 smarttranslator.revsz.com 0 mlaibvestments.com 0 www.flatbin.com 0 resveratone.revsz.com 0 quietplus.revsz.com 0 www.website-46cf2538.revsz.com 0 ncnativebees-org.rda.ruz.mybluehost.me 0 www.mishkasocialservices.org 0 www.uqk.fnp.mybluehost.me 0 ncnativebees.org 1 www.klickzbysri.com 0 mail.bethanychristianchurchofelpaso.com 0 twoguyswithguitars.com 0 www.brainsavior.revsz.com 0 mail.athuladassanatemple.org 0 mail.tetraig.com 0 www.quietplus.revsz.com 0 www.openit.com.bo 0 www.harborplumbingco.com 0 bakerblogger.com 0 tropislim.trefort.net 0 ryrimportadora.cl 0 featherstonepoetry.znt.nmp.mybluehost.me 0 mail.still-pointfocus.com 0 www.essencehealthagency.co.nz 0 mail.loveinclakecounty.com 0 www.alttransit.edianecapital.com 0 outreachhospitals.com 0 mail.benitezramirez.com 0 gloryartglass.com 0 mail.protectingpollinators.org 0 www.dsmalliance.com 0 www.pknoodle.afreshlifego.com 0 djclimate.com 0 s3consultingsolutions.com 0 atomy.abctrader.us 0 transformativesolutionsnetwork-org.tsnpa.info 0 mail.bakingforcompliments.ca 0 mail.idealinversiones.com 0 www.sunpower.abctrader.us 0 simplywebseo.com 0 www.minotshriners-org.biztechnd.com 0 www.stoppsychiatricprofiling-org.aka.auj.mybluehost.me 1 origenre.sailsinthewind.com 0 www.dialdelivers.com 0 www.estebanlima.com 0 mail.umustudio.com 0 vitalflow.revsz.com 0 www.private.hannamcompany.com 0 www.grz.wyd.mybluehost.me 0 www.ebw.ehs.mybluehost.me 0 twosistersdesignsnd.com 0 www.adventuresinadhd.com 0 www.hablemosdefolklore.estebanlima.com 0 website-caee3af4.legendinx.com 0 mail.codasocalconference.com 0 hymmedicalsa.com 0 www.glamorousbeauty.space 0 andrewformountvernon.com 0 www.meri-usa.lno.rln.mybluehost.me 0 www.bitcomplianceassurance.com 0 www.hannamcompany.com 0 mishkasocialservices.org 0 www.marlodj.obertys.com 0 www.hvacunionnj.simplywebseo.com 0 www.nen.jgp.mybluehost.me 0 www.alternativehousecarehome.com 0 www.myhappyhealthyhome.madsenadvertising.com 0 www.stallfreepropellers.com 0 www.tetradevelopment-net.guidingpc.com 0 www.portfoliostyles.donswpbox.com 0 mail.pirate.courses 0 ameybusiness.com 0 www.visawebs.com 0 www.checkenginemobilerepair.com 0 mail.sempermd.com 0 www.flatironsmanagementgroup.zbx.hnq.mybluehost.me 0 gonzalezfamilyfarm.com 0 www.umustudio.com 0 marmabotanica.sc-hosts.com 0 www.curiousmeow.davolynindustries.com 0 curiousmeow.davolynindustries.com 0 www.resveratone.revsz.com 0 kneesaverpooltool.com 0 www.mosmanvillagecommunity.org 0 healthfinance-ng.medinetone.com 0 mail.aerc.abctrader.us 0 simplywebseo-online.simplywebseo.com 0 www.mynewkentuckyhome.com 0 alternativehousecarehome.com 0 coinhardwareglobal.simplywebseo.com 0 www.lno.rln.mybluehost.me 0 mail.eb5.abctrader.us 0 openit.com.bo 0 mail.glutenfree-mimi.com 0 rmv.psw.mybluehost.me 0 caldasyrios.com 0 www.website-385bfe7c.revsz.com 0 bakingforcompliments.com 0 www.kneesaverpooltool.davolynindustries.com 0 mail.wgv.ehs.mybluehost.me 0 epcmconsultores-com-bo.estebanlima.com 0 mail.lakecountryarts.org 0 mail.anitalahey.ca 0 www.jmghomeservices.com 0 website-64e0a88e.oneflymama.com 0 website-b44a4054.aka.auj.mybluehost.me 0 dallengilman.com 0 addict502.com 0 www.tangithomas.nbg.ehs.mybluehost.me 0 www.worldwidebh.ja-developments.com 0 loversclubfilms.com 0 glutenfree-mimi.com 1 mail.jacynthedurochermedia.com 0 jlbccommunityalliance.com 0 www.gonzalezfamilyfarm.cid5280.com 0 mosmanvillagecommunity.org 0 www.ecmi-eg.org 0 www.caravanaperubolivia.camaraperubolivia.org.pe 0 www.glutenfree-mimi.com 1 mail.csr1online.com 0 www.ocd5280.com 0 dsmalliance.com 1 myhappyhealthyhome.madsenadvertising.com 1 www.icapproducts.com 0 mail.iacvt.com 0 mail.mediwiserx.com 0 kseducationsolutions.com 0 evc.rzk.mybluehost.me 0 mail.gonzalezfamilyfarm.com 0 mail.curatedtouring.com 0 primalcreationsllc.com 0 www.likeagencyofficial.com 0 www.jdesign-office.publishersjapan.com 0 mail.jointgenesis.revsz.com 0 mail.stephenmoorespeaks.com 0 snytile.com 0 mail.kattswestsidestories.com 0 www.kseducationsolutions.com 0 thefuturistparty.tentaclekitty.com 0 www.jpb.dmo.mybluehost.me 0 mail.licentiousnovelties.com 0 www.aclinnovations.com 0 www.tourismshark.lob.hnq.mybluehost.me 0 www.asndi.org 0 www.aerc.abctrader.us 0 www.collectivesafety.com 0 jmghomeservices.com 0 mail.jackmanind.com 0 www.tourismshark.com 0 mail.labellesince1919.com 0 mail.elisastancil.com 0 www.loveinclakecty.net 0 website-46cf2538.revsz.com 0 booksbydennis.com 0 www.cid5280.com 0 www.s3consultingsolutions.legendinx.com 0 mail.tsnpa.info 0 sgiusaaustin.org 0 mail.kneesaverpooltool.com 1 www.estoagroup.com 0 pacificrimdoods.com 0 www.jerryspizza.com 0 grz.wyd.mybluehost.me 0 softwarelibre.org.bo 0 pastpresentpurple.com 0 mail.pastpresentpurple.com 0 www.altaibalance.revsz.com 0 mail.discountbargainmalestrippers.com 0 gtpham.com 0 cltaerialproductions.com 0 mail.loveinclakecty.net 0 mail.seasonedconversations.org 0 mail.barrelandbond.com 0 www.stevensweldingnd.biztechnd.com 0 theveggieguys.net 0 medinetone.com 0 mail.missinformed.blog 0 www.pii.abctrader.us 1 cedarwoodfarmstead.com 0 mail.eruns.co 0 tetradevelopment.guidingpc.com 0 myrealtormonica.com 0 www.seasonedconversations.org 0 mail.davolynindustries.com 0 www.marmabotanica.sc-hosts.com 0 rtrdumpsters.com 0 mail.jlbccommunityalliance.com 0 perfectioncleaningnc.com 0 mail.perfectioncleaningnc.com 0 thephotographybite.com 0 thephotographybite.wan.vec.mybluehost.me 0 mail.cbrimprovementstrategies.com 0 www.settingsbyheidi.com 0 mail.beeseengearpromo.com 0 addicteddopeness.com 0 mail.octometal.com 0 www.ipr.org.pk 0 mail.riq.mrn.mybluehost.me 0 mail.stevensweldingnd.com 0 mail.westernlottoandbet.com 0 www.glucodyn.revsz.com 0 calmingwavesofbakersfield.legendinx.com 0 s3consultingsolutions.legendinx.com 0 barrelandbond.com 0 www.lakecountryarts.org 0 mail.guidingpc.com 0 bakingforcompliments.writeeditcopy.com 0 www.janacharvat.com 0 www.kinseycre.com 0 snowteethwhitening.revsz.com 0 www.jlbccommunityalliance.com 0 synapsesmedicals.medinetone.com 0 www.website-c2d5f655.afreshlifego.com 0 handstoheartcpr.net 0 mail.stephanieferrara.com 0 mail.nen.jgp.mybluehost.me 0 mail.nsx.zgu.mybluehost.me 0 www.airphones.revsz.com 0 mail.fuerzapublishinghouse.blog 0 lilliquistforbellingham.taradactyldesign.com 0 marmabotanica.com 0 therealandthereckoned-com.alisonmeliahphotography.com 0 coinhardwareglobal.com 0 www.vitalflow.revsz.com 0 www.childfundpoliticas.elaticogt.com 0 www.myempoweringlife.com 0 www.licentiousnovelties.com 0 mail.workingtheimage.com 0 www.nervedefend.revsz.com 0 tourismshark.lob.hnq.mybluehost.me 0 mail.summaries.wiki 0 www.chinesecolorcode.com 0 www.picare-ai.jcq.gxm.mybluehost.me 0 www.sempermd.com 0 mail.thekicc.com 0 mail.bakerblogger.com 0 www.abmtahid.com 0 countrywidecoffee.com 0 www.website-4c610ce3.revsz.com 0 www.prodentim.revsz.com 0 mail.reviewz.org 0 mail.gloryartglass.net 0 guatech.online 0 mail.omargonzalezphotography.com 0 www.website-43b8d4cd.legendinx.com 0 mail.marchostetter.com 0 mail.carvengineering.com 0 www.olivine.revsz.com 0 davolynindustries.davolynindustries.com 0 ocd5280.cid5280.com 0 pinmeuputah.com 0 mail.originaldemolition.com 0 keravitapro.revsz.com 0 www.reviewz.org 0 www.herpesyl.revsz.com 0 website-8e250bc2.legendinx.com 0 www.flexotone.revsz.com 0 www.anitalahey.com 0 www.discountbargainmalestrippers.com 0 www.oliviaf17-sg-host-com.cid5280.com 0 mail.unicoach.com 0 www.thephotographybite.com 0 www.perfectioncleaningnc.com 0 idealinversiones.com 0 sim-tel-com-au.freeautoelectrician.com.au 0 neufeldmissions.com 0 xlt.ddq.mybluehost.me 0 klorrainesalon.com 0 mail.stefanieharrington.com 0 mail.rsmrf.com 0 teamworkcares.com 0 mail.promedverify.com 0 alttransit.edianecapital.com 0 myhappyhealthyhome.com 0 cbdiemorganics.com 0 stoppsychiatricprofiling.org 0 hvacunionnj.simplywebseo.com 0 workingtheimage.writeeditcopy.com 0 mail.gotogordoncomputers.com 0 mail.ravagolawgroup.com 0 www.cbdiemorganics.com 0 davolynindustries.com 0 glucofort.revsz.com 0 mail.gnx.ubp.mybluehost.me 0 kaizenmagic.com 1 www.thesoyemigroup.soyemi.com 0 crpdcourse-org.aka.auj.mybluehost.me 1 www.tribalmerch.whoisduck.com 0 binkleystore.binkleystore.com 0 www.alimeliah.com 0 mail.kseducationsolutions.com 0 www.bakingforcompliments.writeeditcopy.com 0 spinalforce.revsz.com 0 flatbin.com 0 discountbargainmalestrippers.taradactyldesign.com 0 www.theheartofbehavior.com 0 abserv.com 0 mail.sincerelymemoona.com 0 tetrasteelworx.com 0 www.bmwdiys.myempoweringlife.com 0 www.familyburton.com 0 www.tetrasteelworx.guidingpc.com 0 socialpri.me 0 www.kingsklosetny.com 0 nervecontrol911.revsz.com 0 www.p23.org 0 texasstylerv.heatherandthedogs.com 0 www.klorrainesalon.com 1 www.healthmediapolicy.com 0 curafen.revsz.com 0 jerryspizza.com 0 mail.innersherpa.life 0 greenwayoffice.com 0 mail.momgiggles.com 0 mail.lilliquistforbellingham.com 0 mail.ladowellphotography.com 0 www.virtuallykari.com 0 www.absoluteprohibition-org.aka.auj.mybluehost.me 0 ferraralimited.com 0 www.mosaiclanguageservices.znt.nmp.mybluehost.me 0 www.aguadelavillahn.com 0 eurekalearning-ca.oiv.qwy.mybluehost.me 0 mail.eurekalearning.ca 0 www.eurekalearning.ca 0 mail.crpdcourse.org 0 www.switchcraftelectric.com 0 stephanieferrara.empoweredcreativitycoach.com 0 mail.settingsbyheidi.com 0 megapowerantigua.com 0 ammaarquitectura.com 0 omargonzalezphotography.com 0 www.prldood.pacificrimlabradoodles.com 0 prldood.pacificrimlabradoodles.com 0 www.iacvt.com 0 mail.rsmrf.org 0 www.testing.careaidafrica.org 0 www.ammaarquitectura.ammanetwork.org 0 volumil.revsz.com 0 mail.a1-freight.com 0 mail.zuj.nxb.mybluehost.me 0 mail.torchpodcast.com 0 mail.rnx.qiv.mybluehost.me 0 mail.thejagroup.org 0 www.photographybysri.com 0 www.twosistersdesignsnd.com 0 mail.twosistersdesignsnd.com 0 www.seasonedconversations-org.cid5280.com 0 unsbet365.com 0 mail.abbybell.org 0 thejagroup.org 0 essencehealthagency.co.nz 0 www.drumair.com 0 gotogordoncomputers.com 0 youngsteadtlab-org.rda.ruz.mybluehost.me 0 mail.ncnativebees.org 0 www.barrelandbond.com 0 hvacunionnj.com 0 worldwidebh.com 0 www.pangealds.com 0 dripstl.com 0 mail.s3consultingsolutions.com 0 lakecountryarts.org 0 www.taleofmylife.com 0 www.athuladassanatemple.org 0 pangeafiltration.com 0 www.eb5.abctrader.us 0 www.bakerblogger.writeeditcopy.com 0 oliviaf17-sg-host-com.cid5280.com 0 mail.kaizenmagic.com 0 mail.sgiusaaustin.org 0 tribuinterior.com 0 www.awamanchester.org.uk 0 www.brainsts.com 0 www.iflextech.co.nz 0 www.flatironsmanagementgroup.com 0 mail.theraisingdad.com 0 rsmrf-org.asndi.org 0 mail.robbinshottubs.com 0 www.website-593b1361.afreshlifego.com 0 abmtahid.com 0 carlamyoung.com 0 www.website-52c62bbe.biztechnd.com 0 www.lilliquistforbellingham.taradactyldesign.com 0 www.impactfulseo.simplywebseo.com 0 www.floralite.revsz.com 0 mail.asndi.org 0 socialmedia.tsnpa.org 0 www.stephanieferrara.com 0 sunpower.abctrader.us 0 mail.embracingthesunlight.com 0 www.lawanalysis.net 0 ollieonlinemarketing.com 0 www.jmasonassociates.co.uk 0 prostadine.revsz.com 0 www.portfoliostyles.com 0 transformativesolutionsnetwork.org 0 marlodj.obertys.com 0 elisastancillevine.com 0 mail.hatvisuals.com 0 missinformed.blog 0 www.ncnativebees.org 0 glamorousbeauty-space.lanternticket.com 0 bethanychristianchurchofelpaso.com 0 myempoweringlife.com 0 www.wzr.mzi.mybluehost.me 0 blog.brooketuckerphotography.com 0 www.whimsyandwander.lauratyephotography.com 0 guidingpoint.org 0 mail.npo-qa.com 0 www.100k-crowd.co.uk 0 www.jlbccommunityalliance.avd.ofm.mybluehost.me 0 mail.cid5280.com 0 wgv.ehs.mybluehost.me 0 beverlypetclinic.com 0 www.codasocalconference.org 0 earthsolutionsinc.com 0 mail.dsmalliance.com 0 tangithomas.nbg.ehs.mybluehost.me 0 mail.mclaincounseling.com 1 workingtheimage-ca.writeeditcopy.com 0 website-43b8d4cd.legendinx.com 0 mail.aguadelavillahn.com 0 www.tetraig.guidingpc.com 0 ebntrading.com 0 www.rebornbuild.com 0 www.jackmanind.j4oilers.com 0 www.resourceinsuranceadvisors.com 0 unicoach.com 0 resourcewealthmanagement.com 0 www.thephotographybite.wan.vec.mybluehost.me 0 mail.beeseengear.com 0 settingsbyheidi.com 0 mail.mesllcga.com 0 www.transformativesolutionsnetwork.org 0 mail.alttransit.com 0 www.ultraomegaburn.revsz.com 0 www.nikolaikleistburkal.art-beats.com 0 website-d7bb6939.myempoweringlife.com 0 tourismshark.com 0 mail.womeninminerals.com 0 www.randytysonphotography.legionofreason.com 0 alohadavecookies.com 0 mail.simplywebseo.com 0 www.harborplumbingco.legendinx.com 0 crpdcourse.org 0 mail.hollyberryherbal.com 0 thetealcircle.com 0 mail.sheilasinspiredlife.com 0 elsakristen.com 0 mail.workingtheimage.ca 0 flexotone.revsz.com 0 synapsesmedicals.com 0 www.casecashfinancing.com 0 www.a1-freight.com 0 www.teamworkcares.com 0 www.pangeafiltration.com 0 mail.flatbin.com 0 embracingthesunlight.evangelineamel.com 0 www.gotogordon.com 0 sim-tel.com.au 0 www.thepumpkinbatch.serenafedor.com 0 www.discountbargainmalestrippers.taradactyldesign.com 0 mail.holywaterwashes.com 0 www.softwarelibre.org.bo 0 www.summaries-wiki.simplywebseo.com 0 bgsclassof96.com 0 braunleder.com 0 www.fruitfulfoodforestry.artofrv.com 0 mail.tomfastrealty.com 0 stuffwedo.blog 0 sbo88m.com 0 susanfoxmd.com 1 mail.nightlightguy.com 0 stereoinnovations.com 0 www.thejagroup.org 0 mail.photographybysri.com 0 dialdelivers.cedarwoodfarmstead.com 0 keativity.sc-hosts.com 0 www.parapenteguatemala.com 0 www.progenifix.trefort.net 0 jackmanind.com 0 s.estebanlima.com 0 www.tienda.guatech.online 0 mail.thebrandstand.co 0 www.nervecontrol911.revsz.com 1 thekicc.legendinx.com 0 veryelderberry.artofrv.com 0 www.dripstl.com 0 mail.karelwalle.com 1 mail.farafaralosparceros.com 0 mail.christiansthatparty.com 0 rnx.qiv.mybluehost.me 0 www.summaries.wiki 0 mail.soyemi.com 0 mail.pianoclinic.com 0 www.marmabotanica.com 0 www.greenwayoffice.com 0 mail.collectivesafety.com 0 www.rochlinlc.com 0 mail.pacificrimdoods.com 0 mail.knightwaylimited.com 0 mail.therealestatesharks.com 0 longislandchickencoops.com 0 www.alttransit.com 0 www.meisinhardware.chuagh.net 0 www.randytysonphotography.com 0 www.stevensweldingnd.com 0 www.website-64e0a88e.oneflymama.com 1 mail.tracerntnwidelog.com 0 jmghomeservices.soulsojourner.com 0 mail.legendinx.com 0 tangithomas.com 0 justsmokinbarbecue.com 0 foc.ehs.mybluehost.me 0 www.ringhush.revsz.com 0 jointgenesis.revsz.com 0 www.stevenkleindds.madsenadvertising.com 0 protectingpollinators.org 1 alimeliah.alisonmeliahphotography.com 0 www.keragenis.revsz.com 0 airphones.revsz.com 0 www.transformativesolutionsnetwork-org.tsnpa.info 0 switchcraftelectric.com 0 abbybell-org.bellcreativeco.com 0 christiansthatparty.com 0 www.art-beats.com 0 www.appetitesathome.com 0 mail.digitalnomadsasia.net 0 adventuristmoto.com 0 mail.stallfreepropellers.com 0 website-f9437d31.karthikpatil.com 0 www.enlitedesign.com 0 test.healthmediapolicy.com 0 www.mysilverlinings.me 0 serolean.trefort.net 0 tetradevelopment.com 0 www.jointpainhack.revsz.com 0 www.embracingthesunlight.evangelineamel.com 0 biovanish.revsz.com 0 www.sim-tel.com.au 0 www.ammaarquitectura.com 0 www.rsmrf.asndi.org 0 tracerntnwidelog.com 0 mail.leavingisliving.com 0 www.leavingisliving.com 0 www.theveggieguys.net 0 mail.artofrv.com 0 taleofmylife.com 0 andrewformountvernon.taradactyldesign.com 0